Citrus Sinensis ID: 028047


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210----
MDGSRQPLPLTTAYQRLELANVSPFTFLQAMFGLKCPIGVLAEEKILPLGKDISAVGICSFKNGIPEIKSCKDLPYFLSEKTKDLMVVDLVNRSKILFWSGIVLGSLSIGILGYAIVRNWNRWKDRQQRMSRQLTEAPSDDADSQIGSDEDVAGDIPDGQLCVVCLTRRRISAFNPCGHLVCCRRCAISVEREASPKCPVCRMTVRSSMRIYFS
cccccccccccEEEEcEEEcccccHHHHHHHHccccccHHHHHHHHcccccEEEEEEEEEEEccEEEEcccccccEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccEEEcccccccEEEEccccEEccHHHHHHHHHcccccccccccccccEEEEccc
cccccccccHHHHHHccccccccHHHHHHHHHccccccccEcHEEEcccccEEEEEEEEEEcccEEEEcccccccEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHccccHHHcccccccccEEEEcccccEEEEEccccEEEcHHHHHHHcccccccccccHHHHHHEEEEEcc
mdgsrqplplttayqrlelanvspftFLQAMfglkcpigvlaeekilplgkdisavgicsfkngipeiksckdlpyflsektkdLMVVDLVNRSKILFWSGIVLGSLSIGILGYAIVRNWNRWKDRQQRMSRQlteapsddadsqigsdedvagdipdgqlCVVCLTRrrisafnpcghlvccrrcaisvereaspkcpvcrmtvrssmriyfs
MDGSRQPLPLTTAYQRLELANVSPFTFLQAMFGLKCPIGVLAEEKILPLGKDISAVGICSFkngipeiksckdLPYFLSEKTKDLMVVDLVNRSKILFWSGIVLGSLSIGILGYAIVRNWNRWKDRQQRMSRQLteapsddadsqIGSDedvagdipdGQLCVVCLTRRRisafnpcghlvCCRRCAIsvereaspkcpvcrmtvrssmriyfs
MDGSRQPLPLTTAYQRLELANVSPFTFLQAMFGLKCPIGVLAEEKILPLGKDISAVGICSFKNGIPEIKSCKDLPYFLSEKTKDLMVVDLVNRSKILFWSGIVLGSLSIGILGYAIVRNWNRWKDRQQRMSRQLTEAPSDDADSQIGSDEDVAGDIPDGQLCVVCLTRRRISAFNPCGHLVCCRRCAISVEREASPKCPVCRMTVRSSMRIYFS
**********TTAYQRLELANVSPFTFLQAMFGLKCPIGVLAEEKILPLGKDISAVGICSFKNGIPEIKSCKDLPYFLSEKTKDLMVVDLVNRSKILFWSGIVLGSLSIGILGYAIVRNWNRWK******************************DIPDGQLCVVCLTRRRISAFNPCGHLVCCRRCAISVEREASPKCPVCRMTVR********
*****QP*PLTTAYQRLELANVSPFTFLQAMFGLKCPIGVLAEEKILPLGKDISAVGICSFKNGIPEIKSCKDLPYFLSEKTKDLMVVDLVNRSKILFWSGIVLGSLSIGILGYAIVRNWNRWKD************************************CVVCLTRRRISAFNPCGHLVCCRRCAISVEREASPKCPVCRMTVRSSMRIYFS
MDGSRQPLPLTTAYQRLELANVSPFTFLQAMFGLKCPIGVLAEEKILPLGKDISAVGICSFKNGIPEIKSCKDLPYFLSEKTKDLMVVDLVNRSKILFWSGIVLGSLSIGILGYAIVRNWNRWKD*********************GSDEDVAGDIPDGQLCVVCLTRRRISAFNPCGHLVCCRRCAISVEREASPKCPVCRMTVRSSMRIYFS
*****QPLPLTTAYQRLELANVSPFTFLQAMFGLKCPIGVLAEEKILPLGKDISAVGICSFKNGIPEIKSCKDLPYFLSEKTKDLMVVDLVNRSKILFWSGIVLGSLSIGILGYAIVRNWNRWKDRQQRMSRQLTEAP****************DIPDGQLCVVCLTRRRISAFNPCGHLVCCRRCAISVEREASPKCPVCRMTVRSSMRIYFS
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDGSRQPLPLTTAYQRLELANVSPFTFLQAMFGLKCPIGVLAEEKILPLGKDISAVGICSFKNGIPEIKSCKDLPYFLSEKTKDLMVVDLVNRSKILFWSGIVLGSLSIGILGYAIVRNWNRWKDRQQRMSRQLTEAPSDDADSQIGSDEDVAGDIPDGQLCVVCLTRRRISAFNPCGHLVCCRRCAISVEREASPKCPVCRMTVRSSMRIYFS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query214 2.2.26 [Sep-21-2011]
Q24306438 Apoptosis 1 inhibitor OS= yes no 0.252 0.123 0.457 3e-08
P41436275 Apoptosis inhibitor IAP O N/A no 0.252 0.196 0.440 5e-08
Q6NTT6353 Mitochondrial ubiquitin l N/A no 0.915 0.555 0.252 5e-07
Q969V5352 Mitochondrial ubiquitin l yes no 0.934 0.568 0.228 6e-07
Q4R7G8352 Mitochondrial ubiquitin l N/A no 0.799 0.485 0.237 1e-06
Q62210612 Baculoviral IAP repeat-co yes no 0.415 0.145 0.323 2e-06
A1E2V0604 Baculoviral IAP repeat-co yes no 0.242 0.086 0.438 2e-06
O08863600 Baculoviral IAP repeat-co no no 0.280 0.1 0.369 3e-06
Q90660611 Inhibitor of apoptosis pr no no 0.280 0.098 0.383 3e-06
Q95M72236 Baculoviral IAP repeat-co no no 0.289 0.262 0.358 4e-06
>sp|Q24306|IAP1_DROME Apoptosis 1 inhibitor OS=Drosophila melanogaster GN=th PE=1 SV=2 Back     alignment and function desciption
 Score = 58.9 bits (141), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 27/59 (45%), Positives = 35/59 (59%), Gaps = 5/59 (8%)

Query: 156 IPDGQLCVVCLTRRRISAFNPCGHLVCCRRCAISVEREASPKCPVCRMTVRSSMRIYFS 214
           IP+ +LC +C      +AF PCGH+V C +CA SV      KCP+CR      MR+YFS
Sbjct: 385 IPEEKLCKICYGAEYNTAFLPCGHVVACAKCASSVT-----KCPLCRKPFTDVMRVYFS 438




Anti-apoptotic protein which functions as a caspase regulator, using its E3 ubiquitin-protein ligase activity to smother caspase activity. Binds, ubiquitinates and inactivates initator caspase Nc, and effector caspases ICE and DCP-1. Acts as a NEDD8-E3 ubiquitin-protein ligase for ICE. Suppresses apoptosis by targeting the apoptosome for ubiquitination and inactivation. Plays an important role in cell motility. Overexpression suppresses rpr and W-dependent cell death in the eye. Interaction of th with Nc is required to suppress Nc-mediated cell death; th-mediated ubiquitination of Nc. Acts as a positive regulator of Wnt signaling.
Drosophila melanogaster (taxid: 7227)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -
>sp|P41436|IAP_GVCPM Apoptosis inhibitor IAP OS=Cydia pomonella granulosis virus (isolate Mexico/1963) GN=IAP PE=4 SV=1 Back     alignment and function description
>sp|Q6NTT6|MUL1_XENLA Mitochondrial ubiquitin ligase activator of nfkb 1 OS=Xenopus laevis GN=mul1 PE=2 SV=1 Back     alignment and function description
>sp|Q969V5|MUL1_HUMAN Mitochondrial ubiquitin ligase activator of NFKB 1 OS=Homo sapiens GN=MUL1 PE=1 SV=1 Back     alignment and function description
>sp|Q4R7G8|MUL1_MACFA Mitochondrial ubiquitin ligase activator of NFKB 1 OS=Macaca fascicularis GN=MUL1 PE=2 SV=1 Back     alignment and function description
>sp|Q62210|BIRC2_MOUSE Baculoviral IAP repeat-containing protein 2 OS=Mus musculus GN=Birc2 PE=1 SV=1 Back     alignment and function description
>sp|A1E2V0|BIRC3_CANFA Baculoviral IAP repeat-containing protein 3 OS=Canis familiaris GN=BIRC3 PE=2 SV=1 Back     alignment and function description
>sp|O08863|BIRC3_MOUSE Baculoviral IAP repeat-containing protein 3 OS=Mus musculus GN=Birc3 PE=1 SV=2 Back     alignment and function description
>sp|Q90660|BIR_CHICK Inhibitor of apoptosis protein OS=Gallus gallus GN=ITA PE=2 SV=1 Back     alignment and function description
>sp|Q95M72|BIRC8_PANTR Baculoviral IAP repeat-containing protein 8 OS=Pan troglodytes GN=BIRC8 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query214
225442119 391 PREDICTED: mitochondrial ubiquitin ligas 0.990 0.542 0.711 2e-87
449447892 389 PREDICTED: mitochondrial ubiquitin ligas 0.976 0.537 0.631 3e-77
224070805 391 predicted protein [Populus trichocarpa] 0.985 0.539 0.641 2e-76
356504268 388 PREDICTED: mitochondrial ubiquitin ligas 0.985 0.543 0.626 1e-74
224054081 390 predicted protein [Populus trichocarpa] 0.976 0.535 0.643 4e-74
356558912 383 PREDICTED: mitochondrial ubiquitin ligas 0.985 0.550 0.621 8e-74
255560625 387 ubiquitin-protein ligase, putative [Rici 0.985 0.545 0.638 3e-73
356567748 387 PREDICTED: mitochondrial ubiquitin ligas 0.985 0.545 0.626 3e-73
357514013 383 Baculoviral IAP repeat-containing protei 0.985 0.550 0.612 2e-71
18404810 383 E3 ubiquitin ligase-like protein [Arabid 0.962 0.537 0.574 1e-66
>gi|225442119|ref|XP_002274016.1| PREDICTED: mitochondrial ubiquitin ligase activator of nfkb 1 [Vitis vinifera] gi|297743001|emb|CBI35868.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  327 bits (837), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 153/215 (71%), Positives = 183/215 (85%), Gaps = 3/215 (1%)

Query: 1   MDGSRQPLPLTTAYQRLELANVSPFTFLQAMFGLKCPIGVLAEEKILPLGKDISAVGICS 60
           MDGSR PLPLTT Y +L+  N SP+TFLQA+FG   P+G+L EEK+LPLGK+I+AVGICS
Sbjct: 179 MDGSRHPLPLTTVYHQLQPVNASPYTFLQALFGHDYPVGLLDEEKLLPLGKEITAVGICS 238

Query: 61  FKNGIPEIKSCKDLPYFLSEKTKDLMVVDLVNRSKILFWSGIVLGSLSIGILGYAIVRNW 120
            KNGIPEIKSCKDLPYFLSE +KD MVVDLV +SK+LFWSG++LGS+SIG+LGYA+VRNW
Sbjct: 239 LKNGIPEIKSCKDLPYFLSEMSKDQMVVDLVFKSKVLFWSGVILGSVSIGVLGYAVVRNW 298

Query: 121 NRWKD-RQQRMSRQLTEAPSDDADSQIGSDEDVAGDIPDGQLCVVCLTRRRISAFNPCGH 179
           NRWK+ RQQR  R  ++A +DD D+QI   ED AGD+PDG+LCV+CL RR+ SAF PCGH
Sbjct: 299 NRWKEWRQQRGVRPPSQAVTDDTDTQIA--EDDAGDVPDGELCVICLMRRKRSAFVPCGH 356

Query: 180 LVCCRRCAISVEREASPKCPVCRMTVRSSMRIYFS 214
           LVCC+RCA+SVERE SPKCPVCR  +RSS+RIY S
Sbjct: 357 LVCCQRCALSVERELSPKCPVCRQIIRSSVRIYGS 391




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|449447892|ref|XP_004141700.1| PREDICTED: mitochondrial ubiquitin ligase activator of nfkb 1-like [Cucumis sativus] gi|449480528|ref|XP_004155921.1| PREDICTED: mitochondrial ubiquitin ligase activator of nfkb 1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|224070805|ref|XP_002303243.1| predicted protein [Populus trichocarpa] gi|222840675|gb|EEE78222.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356504268|ref|XP_003520919.1| PREDICTED: mitochondrial ubiquitin ligase activator of nfkb 1-like [Glycine max] Back     alignment and taxonomy information
>gi|224054081|ref|XP_002298092.1| predicted protein [Populus trichocarpa] gi|222845350|gb|EEE82897.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356558912|ref|XP_003547746.1| PREDICTED: mitochondrial ubiquitin ligase activator of NFKB 1-like [Glycine max] Back     alignment and taxonomy information
>gi|255560625|ref|XP_002521326.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223539404|gb|EEF40994.1| ubiquitin-protein ligase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356567748|ref|XP_003552078.1| PREDICTED: mitochondrial ubiquitin ligase activator of nfkb 1-like [Glycine max] Back     alignment and taxonomy information
>gi|357514013|ref|XP_003627295.1| Baculoviral IAP repeat-containing protein [Medicago truncatula] gi|66947626|emb|CAJ00009.1| C3HC4 zinc finger containing protein [Medicago truncatula] gi|355521317|gb|AET01771.1| Baculoviral IAP repeat-containing protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|18404810|ref|NP_564653.1| E3 ubiquitin ligase-like protein [Arabidopsis thaliana] gi|4587558|gb|AAD25789.1|AC006577_25 Contains similarity to gb|U45880 X-linked inhibitor of apotosis protein from Homo sapiens and contains PF|00097 Zinc finger C3HC4 (Ring finger) domain [Arabidopsis thaliana] gi|16604354|gb|AAL24183.1| At1g54150/F15I1_32 [Arabidopsis thaliana] gi|23505911|gb|AAN28815.1| At1g54150/F15I1_32 [Arabidopsis thaliana] gi|332194934|gb|AEE33055.1| E3 ubiquitin ligase-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query214
TAIR|locus:2014405383 SPL2 "SP1-like 2" [Arabidopsis 0.962 0.537 0.574 4.7e-64
TAIR|locus:2202882338 ZCF61 [Arabidopsis thaliana (t 0.911 0.576 0.273 6.2e-14
UNIPROTKB|E1BGD5350 MUL1 "Uncharacterized protein" 0.911 0.557 0.267 3.3e-12
MGI|MGI:1915600352 Mul1 "mitochondrial ubiquitin 0.925 0.562 0.25 3.3e-11
RGD|1309944352 Mul1 "mitochondrial E3 ubiquit 0.925 0.562 0.25 3.5e-10
TAIR|locus:4515103444178 AT4G24204 [Arabidopsis thalian 0.266 0.320 0.438 8.4e-10
FB|FBgn0035483338 Mul1 "Mitochondrial E3 ubiquit 0.929 0.588 0.231 1.6e-09
ZFIN|ZDB-GENE-050208-236352 mul1b "mitochondrial E3 ubiqui 0.934 0.568 0.242 4.2e-09
UNIPROTKB|I3LH19352 MUL1 "Uncharacterized protein" 0.911 0.553 0.255 9e-09
FB|FBgn0260635438 th "thread" [Drosophila melano 0.252 0.123 0.457 1e-08
TAIR|locus:2014405 SPL2 "SP1-like 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 653 (234.9 bits), Expect = 4.7e-64, P = 4.7e-64
 Identities = 123/214 (57%), Positives = 158/214 (73%)

Query:     1 MDGSRQPLPLTTAYQRLELANVSPFTFLQAMFGLKCPIGVLAEEKILPLGKDISAVGICS 60
             MDGSRQPLPLTT Y RL+  N S   FLQA      P+G+L  EKILP GKDI+AVGI S
Sbjct:   178 MDGSRQPLPLTTVYNRLQPINSS---FLQAFLYPDYPVGLLDIEKILPPGKDITAVGIYS 234

Query:    61 FKNGIPEIKSCKDLPYFLSEKTKDLMVVDLVNRSKILFWSGIVLGSLSIGILGYAIVRNW 120
             F NG+PEIKSC+DLPYFLSE TKD M+ DL+ ++  +F   ++LG +S+GIL YA VR W
Sbjct:   235 FNNGVPEIKSCQDLPYFLSEMTKDKMIEDLMEQTNFIFLGSVILGIVSVGILSYAAVRTW 294

Query:   121 NRWKDRQQRMSRQLTEAPSDDADSQIGSDEDVAGDIPDGQLCVVCLTRRRISAFNPCGHL 180
             N+WK  Q    R+L + P+D   S +  + + A +IPDG+LCV+C++RRR+ AF PCGH+
Sbjct:   295 NKWK--QWNHQRELPQRPND---SVVDDEPEDADEIPDGELCVICVSRRRVPAFIPCGHV 349

Query:   181 VCCRRCAISVEREASPKCPVCRMTVRSSMRIYFS 214
             VCCRRCA +VERE +PKCPVC  ++R SMR+Y+S
Sbjct:   350 VCCRRCASTVERELNPKCPVCLQSIRGSMRVYYS 383




GO:0005739 "mitochondrion" evidence=ISM
GO:0008270 "zinc ion binding" evidence=IEA
GO:0016881 "acid-amino acid ligase activity" evidence=IEA
GO:0009941 "chloroplast envelope" evidence=IDA
TAIR|locus:2202882 ZCF61 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|E1BGD5 MUL1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:1915600 Mul1 "mitochondrial ubiquitin ligase activator of NFKB 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1309944 Mul1 "mitochondrial E3 ubiquitin protein ligase 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
TAIR|locus:4515103444 AT4G24204 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
FB|FBgn0035483 Mul1 "Mitochondrial E3 ubiquitin protein ligase 1 homologue" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050208-236 mul1b "mitochondrial E3 ubiquitin ligase 1b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|I3LH19 MUL1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
FB|FBgn0260635 th "thread" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query214
pfam12483154 pfam12483, GIDE, E3 Ubiquitin ligase 6e-27
pfam1392049 pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RI 1e-11
cd0016245 cd00162, RING, RING-finger (Really Interesting New 2e-05
pfam1392345 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI 4e-05
COG5574271 COG5574, PEX10, RING-finger-containing E3 ubiquiti 0.003
>gnl|CDD|221597 pfam12483, GIDE, E3 Ubiquitin ligase Back     alignment and domain information
 Score =  100 bits (250), Expect = 6e-27
 Identities = 32/112 (28%), Positives = 56/112 (50%), Gaps = 2/112 (1%)

Query: 1   MDGSRQPLPLTTAYQRLELANVSPFTFLQAMFGLKCPIGVLAEEKILPLGKDISAVG-IC 59
           MD S   + L T   R E +  S F+ L   F     +G    E++LP+G  ++ VG   
Sbjct: 43  MDPSGAEIELVTVLDRFEPSEGSLFSLLFGFFSGDVTLGYRYIERVLPVGTRLTVVGEAV 102

Query: 60  SFKNGIPEIKSCKDL-PYFLSEKTKDLMVVDLVNRSKILFWSGIVLGSLSIG 110
             ++G   I+      P+F+S K+++ ++  L + ++ LF+  I LG + IG
Sbjct: 103 RDEDGTLRIQKPSKGGPFFISTKSEEELIESLASSARTLFYGSIGLGVVGIG 154


This domain family is found in bacteria, archaea and eukaryotes, and is typically between 150 and 163 amino acids in length. There is a single completely conserved residue E that may be functionally important. GIDE is an E3 ubiquitin ligase which is involved in inducing apoptosis. Length = 154

>gnl|CDD|222454 pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>gnl|CDD|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|227861 COG5574, PEX10, RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 214
KOG1571355 consensus Predicted E3 ubiquitin ligase [Posttrans 99.97
PF12483160 GIDE: E3 Ubiquitin ligase; InterPro: IPR022170 Thi 99.85
KOG417262 consensus Predicted E3 ubiquitin ligase [Posttrans 99.5
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 99.4
KOG4265349 consensus Predicted E3 ubiquitin ligase [Posttrans 99.36
KOG4275350 consensus Predicted E3 ubiquitin ligase [Posttrans 99.22
KOG0317293 consensus Predicted E3 ubiquitin ligase, integral 99.21
PLN03208 193 E3 ubiquitin-protein ligase RMA2; Provisional 99.18
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 99.09
KOG0823 230 consensus Predicted E3 ubiquitin ligase [Posttrans 99.06
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 99.03
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 98.99
PHA02929238 N1R/p28-like protein; Provisional 98.91
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 98.84
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 98.77
KOG0320187 consensus Predicted E3 ubiquitin ligase [Posttrans 98.75
PHA02926242 zinc finger-like protein; Provisional 98.7
cd0016245 RING RING-finger (Really Interesting New Gene) dom 98.69
PF1463444 zf-RING_5: zinc-RING finger domain 98.64
smart0050463 Ubox Modified RING finger domain. Modified RING fi 98.62
KOG2164 513 consensus Predicted E3 ubiquitin ligase [Posttrans 98.61
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 98.61
COG5243 491 HRD1 HRD ubiquitin ligase complex, ER membrane com 98.56
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 98.55
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 98.51
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 98.47
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 98.36
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 98.33
KOG1785 563 consensus Tyrosine kinase negative regulator CBL [ 98.33
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 98.31
KOG1100207 consensus Predicted E3 ubiquitin ligase [Posttrans 98.28
KOG0287 442 consensus Postreplication repair protein RAD18 [Re 98.27
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 98.26
KOG2177 386 consensus Predicted E3 ubiquitin ligase [Posttrans 98.22
COG5432 391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 98.2
KOG0824 324 consensus Predicted E3 ubiquitin ligase [Posttrans 98.15
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 97.94
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 97.92
KOG0802 543 consensus E3 ubiquitin ligase [Posttranslational m 97.88
KOG0804 493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 97.82
KOG0311 381 consensus Predicted E3 ubiquitin ligase [Posttrans 97.7
KOG4692489 consensus Predicted E3 ubiquitin ligase [Posttrans 97.65
PF1444755 Prok-RING_4: Prokaryotic RING finger family 4 97.63
KOG0828636 consensus Predicted E3 ubiquitin ligase [Posttrans 97.45
TIGR00570 309 cdk7 CDK-activating kinase assembly factor MAT1. A 97.44
KOG4159 398 consensus Predicted E3 ubiquitin ligase [Posttrans 97.34
KOG1039 344 consensus Predicted E3 ubiquitin ligase [Posttrans 97.32
COG5236 493 Uncharacterized conserved protein, contains RING Z 97.21
COG5152259 Uncharacterized conserved protein, contains RING a 97.13
PF1457048 zf-RING_4: RING/Ubox like zinc-binding domain; PDB 96.93
KOG0297 391 consensus TNF receptor-associated factor [Signal t 96.88
KOG2879298 consensus Predicted E3 ubiquitin ligase [Posttrans 96.86
KOG1813313 consensus Predicted E3 ubiquitin ligase [Posttrans 96.86
KOG1734328 consensus Predicted RING-containing E3 ubiquitin l 96.82
smart0074449 RINGv The RING-variant domain is a C4HC3 zinc-fing 96.67
COG5222427 Uncharacterized conserved protein, contains RING Z 96.37
KOG2660 331 consensus Locus-specific chromosome binding protei 96.37
KOG3002 299 consensus Zn finger protein [General function pred 96.36
KOG0826357 consensus Predicted E3 ubiquitin ligase involved i 96.28
KOG1002 791 consensus Nucleotide excision repair protein RAD16 95.79
KOG0825 1134 consensus PHD Zn-finger protein [General function 95.78
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 95.67
KOG1814 445 consensus Predicted E3 ubiquitin ligase [Posttrans 95.65
PF07800162 DUF1644: Protein of unknown function (DUF1644); In 95.62
KOG1001 674 consensus Helicase-like transcription factor HLTF/ 95.51
PF05290140 Baculo_IE-1: Baculovirus immediate-early protein ( 95.47
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 95.41
COG5175 480 MOT2 Transcriptional repressor [Transcription] 95.14
PF04641260 Rtf2: Rtf2 RING-finger 95.13
COG52191525 Uncharacterized conserved protein, contains RING Z 95.02
KOG1428 3738 consensus Inhibitor of type V adenylyl cyclases/Ne 94.53
KOG3039303 consensus Uncharacterized conserved protein [Funct 94.47
KOG2932 389 consensus E3 ubiquitin ligase involved in ubiquiti 94.22
KOG149384 consensus Anaphase-promoting complex (APC), subuni 94.19
PF10272358 Tmpp129: Putative transmembrane protein precursor; 93.93
PF10367109 Vps39_2: Vacuolar sorting protein 39 domain 2; Int 93.74
KOG4445 368 consensus Uncharacterized conserved protein, conta 93.68
COG519488 APC11 Component of SCF ubiquitin ligase and anapha 93.04
PF0385450 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc 91.9
KOG2113394 consensus Predicted RNA binding protein, contains 91.85
COG5220 314 TFB3 Cdk activating kinase (CAK)/RNA polymerase II 91.44
KOG1941518 consensus Acetylcholine receptor-associated protei 91.4
KOG1571355 consensus Predicted E3 ubiquitin ligase [Posttrans 90.9
KOG4185 296 consensus Predicted E3 ubiquitin ligase [Posttrans 90.51
PHA02862156 5L protein; Provisional 89.95
KOG0827 465 consensus Predicted E3 ubiquitin ligase [Posttrans 89.4
PHA02825162 LAP/PHD finger-like protein; Provisional 89.27
PF05883134 Baculo_RING: Baculovirus U-box/Ring-like domain; I 89.24
KOG3161 861 consensus Predicted E3 ubiquitin ligase [Posttrans 88.64
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 87.0
PF04710416 Pellino: Pellino; InterPro: IPR006800 Pellino is i 86.83
PHA03096284 p28-like protein; Provisional 86.37
KOG2817394 consensus Predicted E3 ubiquitin ligase [Posttrans 86.17
KOG4362 684 consensus Transcriptional regulator BRCA1 [Replica 84.93
KOG3842429 consensus Adaptor protein Pellino [Signal transduc 83.06
KOG2930114 consensus SCF ubiquitin ligase, Rbx1 component [Po 82.42
KOG3579352 consensus Predicted E3 ubiquitin ligase [Posttrans 82.23
PF1290647 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A. 82.22
PF0811443 PMP1_2: ATPase proteolipid family; InterPro: IPR01 81.68
KOG1940276 consensus Zn-finger protein [General function pred 81.46
KOG3970 299 consensus Predicted E3 ubiquitin ligase [Posttrans 81.32
>KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
Probab=99.97  E-value=1.9e-31  Score=224.48  Aligned_cols=202  Identities=24%  Similarity=0.444  Sum_probs=163.1

Q ss_pred             CCCCCCceeeeeceeeCC-CchhhhhhhhhcCceeceeeeeeeeecCCCeeeeEe-eeeecCCceeecCC-CCCCeeeec
Q 028047            4 SRQPLPLTTAYQRLELAN-VSPFTFLQAMFGLKCPIGVLAEEKILPLGKDISAVG-ICSFKNGIPEIKSC-KDLPYFLSE   80 (214)
Q Consensus         4 ~~~~l~~~~v~~~f~p~~-~~~~~~~~~~~sg~~~~G~~~~E~~L~~g~~it~vG-l~~~~~g~~~l~~~-~~~p~~ls~   80 (214)
                      ++..++++++|+.|+|+. -++.++.+++++|.++.|++++|++||+|+.+|++| ++.++.+..++++| +|.+|+.+.
T Consensus       139 ~~~~l~l~~~~d~f~~s~p~s~~~~~~~~~sg~~~~~~~~~~~~l~~~~~~t~l~e~v~d~~~~~r~~~~~~g~~~v~~s  218 (355)
T KOG1571|consen  139 GRLFLPLNVVYDLFEPSDPCSLVDVGGGYHSGVRRGGFRETERVLPLGTRLTALGELVRDGYCGVRVQPPMQGPLYVTKS  218 (355)
T ss_pred             eeeeecceeeeccccccCcceeeecccccccceeeecccceEEeeccccceeeeehheecCCCceEecCCccCcceeecc
Confidence            345789999999999999 599999999999999999999999999999999999 87888778899987 455555555


Q ss_pred             cCHHHHHHHhhhhhhhhhhhhhhhchhHHHHHHHHHHHHHHH--HHHHHHHHHHHhhhCCCc-----ccc-----ccCCC
Q 028047           81 KTKDLMVVDLVNRSKILFWSGIVLGSLSIGILGYAIVRNWNR--WKDRQQRMSRQLTEAPSD-----DAD-----SQIGS  148 (214)
Q Consensus        81 ~~~d~Li~~l~~~~~~~~~~~i~~~~~~~~~~~~~~~r~~~~--~~~~~~~~~~~~~~~~~~-----~~~-----~~~~~  148 (214)
                      . .++||.++....+..+|.+++++..++.++.+....++..  ++++++.  .+.++.+..     ..+     ..+. 
T Consensus       219 ~-~d~LIsr~g~~s~~~kv~~~~~~~~~~ills~~~~d~~led~r~~r~~l--~k~~~~~~~~rae~~s~g~~gtr~~~-  294 (355)
T KOG1571|consen  219 A-ADRLISREGDLSFFVKVNGMVFGTLGVILLSFIVKDNYLEDDRRQRREL--VKRVEDLATVRAELLSRGVRGTRIQN-  294 (355)
T ss_pred             c-hhhHHHhhccceeeeeecceeeeeeeEEeehHHHHHHHHHHHHHHHHHH--HHhhhhhhhheeeeeccccccccccc-
Confidence            5 9999999999999999999999999999999999988876  5554444  222222211     000     0111 


Q ss_pred             CccccCCCccccccccccccccceEEccCCCccccHhhHHHhhcCCCcccccccccccceEEeeeC
Q 028047          149 DEDVAGDIPDGQLCVVCLTRRRISAFNPCGHLVCCRRCAISVEREASPKCPVCRMTVRSSMRIYFS  214 (214)
Q Consensus       149 ~~~~~~~~~~~~~C~IC~~~~~~~~~lpCgH~~~C~~C~~~~~~~~~~~CP~CR~~i~~~~~i~~s  214 (214)
                      +.....+.+....|+||.+++.+++++||||+|||..|+..+.     .||+||+.|...+++|.+
T Consensus       295 ~~~~~~~~~~p~lcVVcl~e~~~~~fvpcGh~ccct~cs~~l~-----~CPvCR~rI~~~~k~y~~  355 (355)
T KOG1571|consen  295 ENGTFRELPQPDLCVVCLDEPKSAVFVPCGHVCCCTLCSKHLP-----QCPVCRQRIRLVRKRYRS  355 (355)
T ss_pred             ccCcccccCCCCceEEecCCccceeeecCCcEEEchHHHhhCC-----CCchhHHHHHHHHHHhcC
Confidence            1112233445669999999999999999999999999999886     699999999999999975



>PF12483 GIDE: E3 Ubiquitin ligase; InterPro: IPR022170 This domain family is found in bacteria, archaea and eukaryotes, and is typically between 150 and 163 amino acids in length Back     alignment and domain information
>KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>KOG1100 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14447 Prok-RING_4: Prokaryotic RING finger family 4 Back     alignment and domain information
>KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 Back     alignment and domain information
>KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B Back     alignment and domain information
>KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] Back     alignment and domain information
>KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] Back     alignment and domain information
>KOG3002 consensus Zn finger protein [General function prediction only] Back     alignment and domain information
>KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information
>KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function Back     alignment and domain information
>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0 Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG1428 consensus Inhibitor of type V adenylyl cyclases/Neuronal presynaptic protein Highwire/PAM/RPM-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2932 consensus E3 ubiquitin ligase involved in ubiquitination of E-cadherin complex [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10272 Tmpp129: Putative transmembrane protein precursor; InterPro: IPR018801 This entry consists of proteins conserved from worms to humans Back     alignment and domain information
>PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 Back     alignment and domain information
>KOG4445 consensus Uncharacterized conserved protein, contains RWD domain [Function unknown] Back     alignment and domain information
>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>PF03854 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG2113 consensus Predicted RNA binding protein, contains KH domain [General function prediction only] Back     alignment and domain information
>COG5220 TFB3 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB3 [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4185 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02862 5L protein; Provisional Back     alignment and domain information
>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02825 LAP/PHD finger-like protein; Provisional Back     alignment and domain information
>PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length Back     alignment and domain information
>KOG3161 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF04710 Pellino: Pellino; InterPro: IPR006800 Pellino is involved in Toll-like signalling pathways, and associates with the kinase domain of the Pelle Ser/Thr kinase [, , ] Back     alignment and domain information
>PHA03096 p28-like protein; Provisional Back     alignment and domain information
>KOG2817 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4362 consensus Transcriptional regulator BRCA1 [Replication, recombination and repair; Transcription] Back     alignment and domain information
>KOG3842 consensus Adaptor protein Pellino [Signal transduction mechanisms] Back     alignment and domain information
>KOG2930 consensus SCF ubiquitin ligase, Rbx1 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3579 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12906 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A Back     alignment and domain information
>PF08114 PMP1_2: ATPase proteolipid family; InterPro: IPR012589 This family consists of small proteolipids associated with the plasma membrane H+ ATPase Back     alignment and domain information
>KOG1940 consensus Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG3970 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query214
3t6p_A345 Iap Antagonist-Induced Conformational Change In Cia 6e-07
3eb5_A74 Structure Of The Ciap2 Ring Domain Length = 74 2e-06
4ic2_A74 Crystal Structure Of The Xiap Ring Domain Length = 3e-06
2ecg_A75 Solution Structure Of The Ring Domain Of The Baculo 3e-06
4ic3_A74 Crystal Structure Of The F495l Mutant Xiap Ring Dom 9e-06
2yhn_A79 The Idol-Ube2d Complex Mediates Sterol-Dependent De 2e-05
4auq_B62 Structure Of Birc7-Ubch5b-Ub Complex. Length = 62 4e-04
>pdb|3T6P|A Chain A, Iap Antagonist-Induced Conformational Change In Ciap1 Promotes E3 Ligase Activation Via Dimerization Length = 345 Back     alignment and structure

Iteration: 1

Score = 50.8 bits (120), Expect = 6e-07, Method: Compositional matrix adjust. Identities = 31/102 (30%), Positives = 50/102 (49%), Gaps = 13/102 (12%) Query: 121 NRWKDRQQRMSRQLTEAPSDDADSQIGSDEDVAGDIPDGQL--------CVVCLTRRRIS 172 N +K+ + + L + D + + EDV+G + QL C VC+ + Sbjct: 249 NIFKNSLKEIDSTLYKNLFVDKNMKYIPTEDVSGLSLEEQLRRLQEERTCKVCMDKEVSV 308 Query: 173 AFNPCGHLVCCRRCAISVEREASPKCPVCRMTVRSSMRIYFS 214 F PCGHLV C+ CA S+ KCP+CR ++ ++R + S Sbjct: 309 VFIPCGHLVVCQECAPSLR-----KCPICRGIIKGTVRTFLS 345
>pdb|3EB5|A Chain A, Structure Of The Ciap2 Ring Domain Length = 74 Back     alignment and structure
>pdb|4IC2|A Chain A, Crystal Structure Of The Xiap Ring Domain Length = 74 Back     alignment and structure
>pdb|2ECG|A Chain A, Solution Structure Of The Ring Domain Of The Baculoviral Iap Repeat-Containing Protein 4 From Homo Sapiens Length = 75 Back     alignment and structure
>pdb|4IC3|A Chain A, Crystal Structure Of The F495l Mutant Xiap Ring Domain Length = 74 Back     alignment and structure
>pdb|2YHN|A Chain A, The Idol-Ube2d Complex Mediates Sterol-Dependent Degradation Of The Ldl Receptor Length = 79 Back     alignment and structure
>pdb|4AUQ|B Chain B, Structure Of Birc7-Ubch5b-Ub Complex. Length = 62 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query214
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 1e-18
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 3e-17
2ea5_A68 Cell growth regulator with ring finger domain prot 4e-15
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 5e-15
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 1e-14
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 3e-14
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 1e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-06
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 1e-05
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 3e-05
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 3e-05
4epo_C149 E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 7e-05
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 9e-05
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 2e-04
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 2e-04
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 2e-04
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 3e-04
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 6e-04
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
 Score = 76.0 bits (187), Expect = 1e-18
 Identities = 24/78 (30%), Positives = 41/78 (52%), Gaps = 5/78 (6%)

Query: 137 APSDDADSQIGSDEDVAGDIPDGQLCVVCLTRRRISAFNPCGHLVCCRRCAISVEREASP 196
           + S  +  +  S E+    + + +LC +C+ R     F PCGHLV C++CA +V+     
Sbjct: 3   SGSSGSLQKEISTEEQLRRLQEEKLCKICMDRNIAIVFVPCGHLVTCKQCAEAVD----- 57

Query: 197 KCPVCRMTVRSSMRIYFS 214
           KCP+C   +    +I+ S
Sbjct: 58  KCPMCYTVITFKQKIFMS 75


>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Length = 79 Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A Length = 345 Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Length = 63 Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Length = 64 Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Length = 118 Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100 Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Length = 141 Back     alignment and structure
>4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149 Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Length = 124 Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 65 Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, chromosomal protein, DNA repair, metal-binding; 2.12A {Homo sapiens} Length = 115 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Length = 170 Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query214
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 99.58
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 99.58
2ea5_A68 Cell growth regulator with ring finger domain prot 99.58
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 99.49
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 99.48
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 99.43
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 99.32
2ysl_A73 Tripartite motif-containing protein 31; ring-type 99.32
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 99.31
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 99.29
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 99.29
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 99.28
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 99.27
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 99.26
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 99.23
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 99.23
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 99.23
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 99.23
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 99.21
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 99.2
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 99.2
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 99.2
2ecw_A85 Tripartite motif-containing protein 30; metal bind 99.19
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 99.19
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 99.19
2ysj_A63 Tripartite motif-containing protein 31; ring-type 99.17
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 99.17
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 99.16
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 99.16
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 99.16
2ect_A78 Ring finger protein 126; metal binding protein, st 99.15
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 99.15
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 99.15
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 99.14
2ecm_A55 Ring finger and CHY zinc finger domain- containing 99.13
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 99.13
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 99.12
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 99.11
1z6u_A150 NP95-like ring finger protein isoform B; structura 99.08
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 99.07
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 99.06
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 99.06
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 99.06
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 99.05
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 99.05
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 99.04
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 99.04
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 99.02
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 99.02
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 99.02
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 99.01
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 98.97
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 98.95
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.89
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 98.87
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.87
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 98.86
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 98.85
2f42_A179 STIP1 homology and U-box containing protein 1; cha 98.81
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.78
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 98.74
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 98.68
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 98.5
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 98.44
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 98.42
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 98.34
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 98.29
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 97.89
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 97.88
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 97.85
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 97.47
2jun_A101 Midline-1; B-BOX, TRIM, ring finger, alternative s 94.75
3nw0_A238 Non-structural maintenance of chromosomes element 94.63
2ko5_A99 Ring finger protein Z; lassa fever virus-Z, negati 93.65
2cs3_A93 Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, s 92.79
1i4o_C141 X-linked IAP, baculoviral IAP repeat-containing pr 92.44
2i3h_A133 Baculoviral IAP repeat-containing protein 7; zinc 90.96
2poi_A94 Baculoviral IAP repeat-containing protein 4; zinc 88.98
2qra_D111 XIAP, baculoviral IAP repeat-containing protein 4, 88.64
1jd5_A124 DIAP1, apoptosis 1 inhibitor; IAP, caspase activat 87.75
2vm5_A106 Baculoviral IAP repeat-containing protein 1; apopt 87.43
3mup_A122 Baculoviral IAP repeat-containing protein 2; zinc- 84.72
1g73_C121 Inhibitors of apoptosis-like protein ILP; helix bu 84.33
1se0_A116 Apoptosis 1 inhibitor; apoptosis, IAP, BIR, caspas 83.86
3d9t_A97 Baculoviral IAP repeat-containing protein 2; zinc 83.8
3m1d_A85 Baculoviral IAP repeat-containing protein 2; BIR, 82.15
3t6p_A 345 Baculoviral IAP repeat-containing protein 2; ring, 81.36
3hl5_A95 Baculoviral IAP repeat-containing protein 4; BIR, 80.4
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
Probab=99.58  E-value=6.3e-16  Score=101.30  Aligned_cols=56  Identities=30%  Similarity=0.723  Sum_probs=50.0

Q ss_pred             cccccccccccccceEEc--cCCCccccHhhHHHhhcCCCcccccccccccceEEeeeC
Q 028047          158 DGQLCVVCLTRRRISAFN--PCGHLVCCRRCAISVEREASPKCPVCRMTVRSSMRIYFS  214 (214)
Q Consensus       158 ~~~~C~IC~~~~~~~~~l--pCgH~~~C~~C~~~~~~~~~~~CP~CR~~i~~~~~i~~s  214 (214)
                      ++..|+||++++++++++  ||||.++|..|+..++.. +..||+||++|..++++|.|
T Consensus         7 ~~~~C~IC~~~~~~~~~~~~pCgH~~~C~~C~~~~~~~-~~~CPiCR~~i~~~i~i~~~   64 (64)
T 2vje_A            7 AIEPCVICQGRPKNGCIVHGKTGHLMACFTCAKKLKKR-NKPCPVCRQPIQMIVLTYFP   64 (64)
T ss_dssp             GGSCCTTTSSSCSCEEEEETTEEEEEECHHHHHHHHHT-TCCCTTTCCCCCEEEEEECC
T ss_pred             CcCCCCcCCCCCCCEEEECCCCCChhhHHHHHHHHHHc-CCcCCCcCcchhceEeeecC
Confidence            456899999999999988  999997799999999853 45799999999999999986



>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Back     alignment and structure
>2cs3_A Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.3 Back     alignment and structure
>1i4o_C X-linked IAP, baculoviral IAP repeat-containing protein 4; protease-inhibitor, apoptosis-hydrolase complex; 2.40A {Homo sapiens} PDB: 1kmc_C 1i51_E 1i3o_E 1c9q_A Back     alignment and structure
>2i3h_A Baculoviral IAP repeat-containing protein 7; zinc binding, peptide complex, apoptosis inhibition, peptidomimetic, small molecule, drug design, inhibitor/apoptosis complex; HET: BTB; 1.62A {Homo sapiens} SCOP: g.52.1.1 PDB: 2i3i_A* 3f7h_A* 3f7i_A* 3gt9_A* 3gta_A* 1tw6_A* 3uw5_A* 3f7g_A* 1oxn_A* 1oxq_A* 1oy7_A* Back     alignment and structure
>2poi_A Baculoviral IAP repeat-containing protein 4; zinc finger, signaling protein/apoptosis complex; 1.80A {Homo sapiens} PDB: 2pop_B Back     alignment and structure
>2qra_D XIAP, baculoviral IAP repeat-containing protein 4, inhibitor; apoptosis, signaling protein, zinc binding; 2.50A {Homo sapiens} Back     alignment and structure
>1jd5_A DIAP1, apoptosis 1 inhibitor; IAP, caspase activation; 1.90A {Drosophila melanogaster} SCOP: g.52.1.1 PDB: 1jd4_A 1jd6_A 1q4q_A Back     alignment and structure
>2vm5_A Baculoviral IAP repeat-containing protein 1; apoptosis; 1.80A {Homo sapiens} Back     alignment and structure
>3mup_A Baculoviral IAP repeat-containing protein 2; zinc-finger motif, apoptosis inhibitor; HET: SMK; 2.60A {Homo sapiens} SCOP: g.52.1.1 PDB: 3oz1_A* 4eb9_A* Back     alignment and structure
>1g73_C Inhibitors of apoptosis-like protein ILP; helix bundle, zinc-binding domain, apoptosis/apoptosis inhibitor complex; 2.00A {Homo sapiens} SCOP: g.52.1.1 PDB: 3cm2_D* 3clx_D* 3cm7_C* 1f9x_A 1g3f_A 1tfq_A* 1tft_A* 3eyl_A* 3g76_A* 2jk7_A* 2opz_A 2opy_A* 1xb0_A 1xb1_A Back     alignment and structure
>1se0_A Apoptosis 1 inhibitor; apoptosis, IAP, BIR, caspase; 1.75A {Drosophila melanogaster} SCOP: g.52.1.1 PDB: 1sdz_A 3sip_E Back     alignment and structure
>3d9t_A Baculoviral IAP repeat-containing protein 2; zinc finger, apoptosis, cytoplasm, metal-binding, polymorphism, zinc, zinc-finger, alternative splicing, hydrolase, protease; 1.50A {Homo sapiens} SCOP: g.52.1.1 PDB: 3d9u_A 3uw4_A* 2uvl_A Back     alignment and structure
>3m1d_A Baculoviral IAP repeat-containing protein 2; BIR, apoptosis, cytoplasm, polymorphism, zinc, zinc-FIN metal binding protein; 2.00A {Homo sapiens} PDB: 3m0a_D 3m0d_D Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>3hl5_A Baculoviral IAP repeat-containing protein 4; BIR, apoptosis, small molecule drug discovery, structur drug design, ligase, metal-binding; HET: 9JZ; 1.80A {Homo sapiens} PDB: 1nw9_A 2vsl_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 214
d1fbva479 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta 2e-09
d1rmda286 g.44.1.1 (A:1-86) V(D)J recombination activating p 2e-05
d1bora_56 g.44.1.1 (A:) Acute promyelocytic leukaemia proto- 2e-04
d1chca_68 g.44.1.1 (A:) Immediate early protein, IEEHV {Equi 0.002
d1jm7a_103 g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie 0.003
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: CBL
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 50.4 bits (120), Expect = 2e-09
 Identities = 16/55 (29%), Positives = 23/55 (41%), Gaps = 1/55 (1%)

Query: 158 DGQLCVVCLTRRRISAFNPCGHLVCCRRCAISVEREASPKCPVCRMTVRSSMRIY 212
             QLC +C    +     PCGH + C  C  S +      CP CR  ++ +  I 
Sbjct: 22  TFQLCKICAENDKDVKIEPCGH-LMCTSCLTSWQESEGQGCPFCRCEIKGTEPIV 75


>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query214
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 99.4
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 99.29
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 99.25
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 99.21
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 99.18
d2c2la280 STIP1 homology and U box-containing protein 1, STU 99.15
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 99.13
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 99.13
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 99.13
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 99.07
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 99.0
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 98.93
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 98.79
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 98.75
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 98.75
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 98.59
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 97.92
d2cs3a180 Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [ 91.88
d2vsla196 BIR domains of XIAP {Human (Homo sapiens) [TaxId: 87.92
d2i3ha190 BIR-containing protein 7 (ML-IAP, livin) {Human (H 87.73
d3d9ta187 2MIHB/C-IAP-1 {Human (Homo sapiens) [TaxId: 9606]} 85.7
d1i3oe_111 BIR domains of XIAP {Human (Homo sapiens) [TaxId: 85.46
d1jd5a_105 BIR domains of DIAP1 {Fruit fly (Drosophila melano 84.56
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: CBL
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.40  E-value=4.7e-14  Score=94.52  Aligned_cols=52  Identities=33%  Similarity=0.836  Sum_probs=45.5

Q ss_pred             cccccccccccceEEccCCCccccHhhHHHhhcCCCcccccccccccceEEee
Q 028047          160 QLCVVCLTRRRISAFNPCGHLVCCRRCAISVEREASPKCPVCRMTVRSSMRIY  212 (214)
Q Consensus       160 ~~C~IC~~~~~~~~~lpCgH~~~C~~C~~~~~~~~~~~CP~CR~~i~~~~~i~  212 (214)
                      ..|+||++...+++++||||.| |..|+..|.......||+||..|.....+.
T Consensus        24 ~~C~IC~~~~~~~~~~~CgH~f-C~~Ci~~wl~~~~~~CP~Cr~~i~~~~~i~   75 (79)
T d1fbva4          24 QLCKICAENDKDVKIEPCGHLM-CTSCLTSWQESEGQGCPFCRCEIKGTEPIV   75 (79)
T ss_dssp             TBCTTTSSSBCCEECSSSCCEE-CHHHHHHHHHTTCCSCTTTCCCCCCCCCSS
T ss_pred             CCCccCCCcCCCeEEeCCCCee-eHHHHHHHHHHCcCcCCCCCcCccCCceee
Confidence            4799999999999999999999 999999998655567999999998876553



>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cs3a1 g.44.1.3 (A:8-87) Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vsla1 g.52.1.1 (A:250-345) BIR domains of XIAP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i3ha1 g.52.1.1 (A:78-167) BIR-containing protein 7 (ML-IAP, livin) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3d9ta1 g.52.1.1 (A:260-346) 2MIHB/C-IAP-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i3oe_ g.52.1.1 (E:) BIR domains of XIAP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jd5a_ g.52.1.1 (A:) BIR domains of DIAP1 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure