Citrus Sinensis ID: 028062
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 214 | ||||||
| 145332667 | 1480 | bifunctional inhibitor/lipid transfer pr | 0.401 | 0.058 | 0.693 | 2e-33 | |
| 297835204 | 722 | predicted protein [Arabidopsis lyrata su | 0.411 | 0.121 | 0.7 | 1e-31 | |
| 15022163 | 407 | putative proline-rich protein [Solanum p | 0.406 | 0.213 | 0.741 | 3e-31 | |
| 359475712 | 310 | PREDICTED: uncharacterized protein LOC10 | 0.406 | 0.280 | 0.752 | 5e-31 | |
| 449456667 | 254 | PREDICTED: uncharacterized protein LOC10 | 0.406 | 0.342 | 0.741 | 7e-31 | |
| 449518449 | 143 | PREDICTED: 36.4 kDa proline-rich protein | 0.406 | 0.608 | 0.741 | 8e-31 | |
| 118486411 | 179 | unknown [Populus trichocarpa] | 0.406 | 0.486 | 0.741 | 5e-30 | |
| 224104875 | 179 | predicted protein [Populus trichocarpa] | 0.406 | 0.486 | 0.741 | 6e-30 | |
| 297804748 | 451 | hypothetical protein ARALYDRAFT_493374 [ | 0.406 | 0.192 | 0.755 | 2e-29 | |
| 224086363 | 85 | predicted protein [Populus trichocarpa] | 0.397 | 1.0 | 0.747 | 5e-29 |
| >gi|145332667|ref|NP_001078199.1| bifunctional inhibitor/lipid transfer protein/seed storage protein-like protein [Arabidopsis thaliana] gi|11994733|dbj|BAB03062.1| unnamed protein product [Arabidopsis thaliana] gi|332643072|gb|AEE76593.1| bifunctional inhibitor/lipid transfer protein/seed storage protein-like protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Score = 147 bits (372), Expect = 2e-33, Method: Compositional matrix adjust.
Identities = 61/88 (69%), Positives = 78/88 (88%), Gaps = 2/88 (2%)
Query: 127 QTCPIDALKLGACVDVLGGLIHIGLGDSAKEKCCPLLQGLADLDAAVCLCTAIRLKALNL 186
+TCPID LKLG+CVD+LGGL+HIG+G SAKEKCCP+++GL DLDAAVCLCT I+ K LN
Sbjct: 1395 KTCPIDTLKLGSCVDLLGGLVHIGIGKSAKEKCCPVVEGLVDLDAAVCLCTTIKAKLLN- 1453
Query: 187 INLLVPISLQVLVNDCGKYPPAGFQCPA 214
I++++PI+L+VL+N CGK PP GF+CPA
Sbjct: 1454 IDVILPIALEVLLN-CGKNPPPGFKCPA 1480
|
Source: Arabidopsis thaliana Species: Arabidopsis thaliana Genus: Arabidopsis Family: Brassicaceae Order: Brassicales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|297835204|ref|XP_002885484.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297331324|gb|EFH61743.1| predicted protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|15022163|gb|AAC49600.2| putative proline-rich protein [Solanum palustre] | Back alignment and taxonomy information |
|---|
| >gi|359475712|ref|XP_003631735.1| PREDICTED: uncharacterized protein LOC100233114 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|449456667|ref|XP_004146070.1| PREDICTED: uncharacterized protein LOC101218239 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449518449|ref|XP_004166254.1| PREDICTED: 36.4 kDa proline-rich protein-like, partial [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|118486411|gb|ABK95045.1| unknown [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224104875|ref|XP_002333889.1| predicted protein [Populus trichocarpa] gi|222838950|gb|EEE77301.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|297804748|ref|XP_002870258.1| hypothetical protein ARALYDRAFT_493374 [Arabidopsis lyrata subsp. lyrata] gi|297316094|gb|EFH46517.1| hypothetical protein ARALYDRAFT_493374 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|224086363|ref|XP_002307865.1| predicted protein [Populus trichocarpa] gi|222853841|gb|EEE91388.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 214 | ||||||
| TAIR|locus:2090419 | 334 | CWLP "cell wall-plasma membran | 0.401 | 0.257 | 0.719 | 5.5e-32 | |
| TAIR|locus:4010713767 | 1480 | AT3G22142 "AT3G22142" [Arabido | 0.401 | 0.058 | 0.693 | 7.9e-30 | |
| TAIR|locus:2203876 | 297 | AT1G62500 [Arabidopsis thalian | 0.406 | 0.292 | 0.685 | 1.3e-29 | |
| TAIR|locus:2041927 | 291 | AT2G10940 [Arabidopsis thalian | 0.387 | 0.285 | 0.658 | 2.2e-27 | |
| TAIR|locus:2135595 | 161 | AZI1 "azelaic acid induced 1" | 0.392 | 0.521 | 0.588 | 1.8e-23 | |
| TAIR|locus:2135610 | 168 | EARLI1 "EARLY ARABIDOPSIS ALUM | 0.387 | 0.494 | 0.595 | 3.8e-23 | |
| TAIR|locus:2135625 | 182 | AT4G12490 [Arabidopsis thalian | 0.387 | 0.456 | 0.595 | 4.8e-23 | |
| TAIR|locus:2135635 | 177 | AT4G12500 [Arabidopsis thalian | 0.387 | 0.468 | 0.583 | 7.8e-23 | |
| TAIR|locus:2050901 | 134 | AT2G45180 [Arabidopsis thalian | 0.387 | 0.619 | 0.588 | 7e-22 | |
| TAIR|locus:2203886 | 149 | AT1G62510 [Arabidopsis thalian | 0.387 | 0.557 | 0.571 | 7e-22 |
| TAIR|locus:2090419 CWLP "cell wall-plasma membrane linker protein" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 332 (121.9 bits), Expect = 5.5e-32, Sum P(2) = 5.5e-32
Identities = 64/89 (71%), Positives = 77/89 (86%)
Query: 127 QTCPIDALKLGACVDVLGGLIHIGLGDS-AKEKCCPLLQGLADLDAAVCLCTAIRLKALN 185
+TCPID LKLGACVDVLGGLIHIGLG S AK +CCP+L GL DLDAAVCLCT I+LK LN
Sbjct: 248 ETCPIDTLKLGACVDVLGGLIHIGLGKSHAKAECCPVLGGLLDLDAAVCLCTTIKLKLLN 307
Query: 186 LINLLVPISLQVLVNDCGKYPPAGFQCPA 214
I+L++PI+L++L+ DCGK PP+ F+CPA
Sbjct: 308 -IDLVLPIALELLL-DCGKTPPSDFKCPA 334
|
|
| TAIR|locus:4010713767 AT3G22142 "AT3G22142" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2203876 AT1G62500 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2041927 AT2G10940 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2135595 AZI1 "azelaic acid induced 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2135610 EARLI1 "EARLY ARABIDOPSIS ALUMINUM INDUCED 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2135625 AT4G12490 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2135635 AT4G12500 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2050901 AT2G45180 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2203886 AT1G62510 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 214 | |||
| cd01958 | 85 | cd01958, HPS_like, HPS_like: Hydrophobic Protein f | 1e-28 | |
| PRK14951 | 618 | PRK14951, PRK14951, DNA polymerase III subunits ga | 3e-12 | |
| PRK14950 | 585 | PRK14950, PRK14950, DNA polymerase III subunits ga | 3e-11 | |
| PRK12270 | 1228 | PRK12270, kgd, alpha-ketoglutarate decarboxylase; | 4e-11 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 2e-10 | |
| PRK14951 | 618 | PRK14951, PRK14951, DNA polymerase III subunits ga | 3e-10 | |
| PRK12270 | 1228 | PRK12270, kgd, alpha-ketoglutarate decarboxylase; | 3e-10 | |
| pfam00234 | 74 | pfam00234, Tryp_alpha_amyl, Protease inhibitor/see | 3e-10 | |
| pfam04652 | 315 | pfam04652, DUF605, Vta1 like | 5e-10 | |
| PRK12270 | 1228 | PRK12270, kgd, alpha-ketoglutarate decarboxylase; | 2e-09 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 3e-09 | |
| PRK12270 | 1228 | PRK12270, kgd, alpha-ketoglutarate decarboxylase; | 4e-09 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 6e-09 | |
| pfam04652 | 315 | pfam04652, DUF605, Vta1 like | 6e-09 | |
| PRK14948 | 620 | PRK14948, PRK14948, DNA polymerase III subunits ga | 8e-09 | |
| PRK14950 | 585 | PRK14950, PRK14950, DNA polymerase III subunits ga | 1e-08 | |
| pfam04652 | 315 | pfam04652, DUF605, Vta1 like | 1e-08 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 2e-08 | |
| PRK14948 | 620 | PRK14948, PRK14948, DNA polymerase III subunits ga | 2e-08 | |
| pfam09770 | 804 | pfam09770, PAT1, Topoisomerase II-associated prote | 3e-08 | |
| PRK14948 | 620 | PRK14948, PRK14948, DNA polymerase III subunits ga | 4e-08 | |
| PRK12323 | 700 | PRK12323, PRK12323, DNA polymerase III subunits ga | 4e-08 | |
| PRK14971 | 614 | PRK14971, PRK14971, DNA polymerase III subunits ga | 6e-08 | |
| pfam04652 | 315 | pfam04652, DUF605, Vta1 like | 7e-08 | |
| pfam09770 | 804 | pfam09770, PAT1, Topoisomerase II-associated prote | 8e-08 | |
| PRK12270 | 1228 | PRK12270, kgd, alpha-ketoglutarate decarboxylase; | 1e-07 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 1e-07 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 1e-07 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 2e-07 | |
| PRK14948 | 620 | PRK14948, PRK14948, DNA polymerase III subunits ga | 2e-07 | |
| PRK14954 | 620 | PRK14954, PRK14954, DNA polymerase III subunits ga | 2e-07 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 3e-07 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 4e-07 | |
| PRK14948 | 620 | PRK14948, PRK14948, DNA polymerase III subunits ga | 4e-07 | |
| PRK14971 | 614 | PRK14971, PRK14971, DNA polymerase III subunits ga | 6e-07 | |
| PRK07994 | 647 | PRK07994, PRK07994, DNA polymerase III subunits ga | 6e-07 | |
| pfam04652 | 315 | pfam04652, DUF605, Vta1 like | 7e-07 | |
| PRK14965 | 576 | PRK14965, PRK14965, DNA polymerase III subunits ga | 7e-07 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 8e-07 | |
| PRK12270 | 1228 | PRK12270, kgd, alpha-ketoglutarate decarboxylase; | 1e-06 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 1e-06 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 1e-06 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 1e-06 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 1e-06 | |
| PRK14948 | 620 | PRK14948, PRK14948, DNA polymerase III subunits ga | 1e-06 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 1e-06 | |
| PRK07994 | 647 | PRK07994, PRK07994, DNA polymerase III subunits ga | 1e-06 | |
| PTZ00144 | 418 | PTZ00144, PTZ00144, dihydrolipoamide succinyltrans | 1e-06 | |
| pfam05518 | 753 | pfam05518, Totivirus_coat, Totivirus coat protein | 1e-06 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 2e-06 | |
| pfam04652 | 315 | pfam04652, DUF605, Vta1 like | 2e-06 | |
| PRK14948 | 620 | PRK14948, PRK14948, DNA polymerase III subunits ga | 2e-06 | |
| PRK14948 | 620 | PRK14948, PRK14948, DNA polymerase III subunits ga | 2e-06 | |
| PRK14948 | 620 | PRK14948, PRK14948, DNA polymerase III subunits ga | 2e-06 | |
| PRK12323 | 700 | PRK12323, PRK12323, DNA polymerase III subunits ga | 2e-06 | |
| PRK14950 | 585 | PRK14950, PRK14950, DNA polymerase III subunits ga | 3e-06 | |
| PRK12323 | 700 | PRK12323, PRK12323, DNA polymerase III subunits ga | 3e-06 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 3e-06 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 4e-06 | |
| PRK06995 | 484 | PRK06995, flhF, flagellar biosynthesis regulator F | 4e-06 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 6e-06 | |
| PRK14086 | 617 | PRK14086, dnaA, chromosomal replication initiation | 6e-06 | |
| PRK03427 | 333 | PRK03427, PRK03427, cell division protein ZipA; Pr | 6e-06 | |
| PRK14954 | 620 | PRK14954, PRK14954, DNA polymerase III subunits ga | 8e-06 | |
| PRK14954 | 620 | PRK14954, PRK14954, DNA polymerase III subunits ga | 8e-06 | |
| PRK12270 | 1228 | PRK12270, kgd, alpha-ketoglutarate decarboxylase; | 1e-05 | |
| pfam09770 | 804 | pfam09770, PAT1, Topoisomerase II-associated prote | 1e-05 | |
| pfam02993 | 238 | pfam02993, MCPVI, Minor capsid protein VI | 1e-05 | |
| PRK11633 | 226 | PRK11633, PRK11633, cell division protein DedD; Pr | 1e-05 | |
| PHA03307 | 1352 | PHA03307, PHA03307, transcriptional regulator ICP4 | 1e-05 | |
| PRK07003 | 830 | PRK07003, PRK07003, DNA polymerase III subunits ga | 1e-05 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 2e-05 | |
| PRK15313 | 955 | PRK15313, PRK15313, autotransport protein MisL; Pr | 2e-05 | |
| PRK01297 | 475 | PRK01297, PRK01297, ATP-dependent RNA helicase Rhl | 2e-05 | |
| PRK14948 | 620 | PRK14948, PRK14948, DNA polymerase III subunits ga | 3e-05 | |
| PRK14948 | 620 | PRK14948, PRK14948, DNA polymerase III subunits ga | 3e-05 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 3e-05 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 3e-05 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 3e-05 | |
| PRK14965 | 576 | PRK14965, PRK14965, DNA polymerase III subunits ga | 3e-05 | |
| PTZ00144 | 418 | PTZ00144, PTZ00144, dihydrolipoamide succinyltrans | 3e-05 | |
| PRK01297 | 475 | PRK01297, PRK01297, ATP-dependent RNA helicase Rhl | 3e-05 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 4e-05 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 4e-05 | |
| pfam05518 | 753 | pfam05518, Totivirus_coat, Totivirus coat protein | 4e-05 | |
| PRK14948 | 620 | PRK14948, PRK14948, DNA polymerase III subunits ga | 5e-05 | |
| PRK14948 | 620 | PRK14948, PRK14948, DNA polymerase III subunits ga | 5e-05 | |
| PRK07994 | 647 | PRK07994, PRK07994, DNA polymerase III subunits ga | 5e-05 | |
| PRK11633 | 226 | PRK11633, PRK11633, cell division protein DedD; Pr | 5e-05 | |
| PRK09111 | 598 | PRK09111, PRK09111, DNA polymerase III subunits ga | 5e-05 | |
| pfam09770 | 804 | pfam09770, PAT1, Topoisomerase II-associated prote | 6e-05 | |
| pfam09770 | 804 | pfam09770, PAT1, Topoisomerase II-associated prote | 6e-05 | |
| PTZ00144 | 418 | PTZ00144, PTZ00144, dihydrolipoamide succinyltrans | 6e-05 | |
| PTZ00144 | 418 | PTZ00144, PTZ00144, dihydrolipoamide succinyltrans | 6e-05 | |
| PHA03307 | 1352 | PHA03307, PHA03307, transcriptional regulator ICP4 | 6e-05 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 7e-05 | |
| PRK14948 | 620 | PRK14948, PRK14948, DNA polymerase III subunits ga | 7e-05 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 8e-05 | |
| PRK09111 | 598 | PRK09111, PRK09111, DNA polymerase III subunits ga | 8e-05 | |
| PRK12323 | 700 | PRK12323, PRK12323, DNA polymerase III subunits ga | 9e-05 | |
| PRK14086 | 617 | PRK14086, dnaA, chromosomal replication initiation | 9e-05 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 1e-04 | |
| PRK14948 | 620 | PRK14948, PRK14948, DNA polymerase III subunits ga | 1e-04 | |
| PRK12323 | 700 | PRK12323, PRK12323, DNA polymerase III subunits ga | 1e-04 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 1e-04 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 1e-04 | |
| PRK14965 | 576 | PRK14965, PRK14965, DNA polymerase III subunits ga | 1e-04 | |
| pfam13388 | 422 | pfam13388, DUF4106, Protein of unknown function (D | 1e-04 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 2e-04 | |
| PRK12323 | 700 | PRK12323, PRK12323, DNA polymerase III subunits ga | 2e-04 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 2e-04 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 2e-04 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 2e-04 | |
| PRK09111 | 598 | PRK09111, PRK09111, DNA polymerase III subunits ga | 2e-04 | |
| PRK09111 | 598 | PRK09111, PRK09111, DNA polymerase III subunits ga | 2e-04 | |
| PRK12323 | 700 | PRK12323, PRK12323, DNA polymerase III subunits ga | 3e-04 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 3e-04 | |
| PRK11633 | 226 | PRK11633, PRK11633, cell division protein DedD; Pr | 3e-04 | |
| PHA03307 | 1352 | PHA03307, PHA03307, transcriptional regulator ICP4 | 3e-04 | |
| PHA03307 | 1352 | PHA03307, PHA03307, transcriptional regulator ICP4 | 3e-04 | |
| PRK06975 | 656 | PRK06975, PRK06975, bifunctional uroporphyrinogen- | 3e-04 | |
| pfam07174 | 297 | pfam07174, FAP, Fibronectin-attachment protein (FA | 3e-04 | |
| TIGR02784 | 1135 | TIGR02784, addA_alphas, double-strand break repair | 3e-04 | |
| PRK07994 | 647 | PRK07994, PRK07994, DNA polymerase III subunits ga | 4e-04 | |
| PRK07994 | 647 | PRK07994, PRK07994, DNA polymerase III subunits ga | 4e-04 | |
| pfam05518 | 753 | pfam05518, Totivirus_coat, Totivirus coat protein | 4e-04 | |
| PRK06995 | 484 | PRK06995, flhF, flagellar biosynthesis regulator F | 4e-04 | |
| pfam13388 | 422 | pfam13388, DUF4106, Protein of unknown function (D | 4e-04 | |
| PRK06975 | 656 | PRK06975, PRK06975, bifunctional uroporphyrinogen- | 4e-04 | |
| COG0810 | 244 | COG0810, TonB, Periplasmic protein TonB, links inn | 4e-04 | |
| COG0810 | 244 | COG0810, TonB, Periplasmic protein TonB, links inn | 4e-04 | |
| PRK00095 | 617 | PRK00095, mutL, DNA mismatch repair protein; Revie | 4e-04 | |
| PTZ00449 | 943 | PTZ00449, PTZ00449, 104 kDa microneme/rhoptry anti | 4e-04 | |
| PLN02983 | 274 | PLN02983, PLN02983, biotin carboxyl carrier protei | 4e-04 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 5e-04 | |
| PRK13042 | 291 | PRK13042, PRK13042, superantigen-like protein; Rev | 5e-04 | |
| pfam03153 | 332 | pfam03153, TFIIA, Transcription factor IIA, alpha/ | 5e-04 | |
| TIGR02927 | 579 | TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogena | 5e-04 | |
| pfam04652 | 315 | pfam04652, DUF605, Vta1 like | 6e-04 | |
| PRK03427 | 333 | PRK03427, PRK03427, cell division protein ZipA; Pr | 6e-04 | |
| PRK09111 | 598 | PRK09111, PRK09111, DNA polymerase III subunits ga | 6e-04 | |
| pfam03276 | 582 | pfam03276, Gag_spuma, Spumavirus gag protein | 6e-04 | |
| PHA03369 | 663 | PHA03369, PHA03369, capsid maturational protease; | 6e-04 | |
| PRK11892 | 464 | PRK11892, PRK11892, pyruvate dehydrogenase subunit | 6e-04 | |
| PRK14948 | 620 | PRK14948, PRK14948, DNA polymerase III subunits ga | 7e-04 | |
| PRK14086 | 617 | PRK14086, dnaA, chromosomal replication initiation | 7e-04 | |
| PLN02258 | 590 | PLN02258, PLN02258, 9-cis-epoxycarotenoid dioxygen | 7e-04 | |
| PRK07994 | 647 | PRK07994, PRK07994, DNA polymerase III subunits ga | 8e-04 | |
| PRK14963 | 504 | PRK14963, PRK14963, DNA polymerase III subunits ga | 8e-04 | |
| COG5178 | 2365 | COG5178, PRP8, U5 snRNP spliceosome subunit [RNA p | 8e-04 | |
| PRK13042 | 291 | PRK13042, PRK13042, superantigen-like protein; Rev | 9e-04 | |
| PRK11892 | 464 | PRK11892, PRK11892, pyruvate dehydrogenase subunit | 9e-04 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 0.001 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 0.001 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 0.001 | |
| PTZ00144 | 418 | PTZ00144, PTZ00144, dihydrolipoamide succinyltrans | 0.001 | |
| pfam05518 | 753 | pfam05518, Totivirus_coat, Totivirus coat protein | 0.001 | |
| PHA03307 | 1352 | PHA03307, PHA03307, transcriptional regulator ICP4 | 0.001 | |
| PRK07003 | 830 | PRK07003, PRK07003, DNA polymerase III subunits ga | 0.001 | |
| PRK15313 | 955 | PRK15313, PRK15313, autotransport protein MisL; Pr | 0.001 | |
| PRK01297 | 475 | PRK01297, PRK01297, ATP-dependent RNA helicase Rhl | 0.001 | |
| PLN02983 | 274 | PLN02983, PLN02983, biotin carboxyl carrier protei | 0.001 | |
| PRK11892 | 464 | PRK11892, PRK11892, pyruvate dehydrogenase subunit | 0.001 | |
| PRK11892 | 464 | PRK11892, PRK11892, pyruvate dehydrogenase subunit | 0.001 | |
| PLN02258 | 590 | PLN02258, PLN02258, 9-cis-epoxycarotenoid dioxygen | 0.001 | |
| PLN02258 | 590 | PLN02258, PLN02258, 9-cis-epoxycarotenoid dioxygen | 0.001 | |
| PRK14963 | 504 | PRK14963, PRK14963, DNA polymerase III subunits ga | 0.001 | |
| COG5178 | 2365 | COG5178, PRP8, U5 snRNP spliceosome subunit [RNA p | 0.001 | |
| pfam10152 | 147 | pfam10152, DUF2360, Predicted coiled-coil domain-c | 0.001 | |
| pfam04929 | 381 | pfam04929, Herpes_DNAp_acc, Herpes DNA replication | 0.001 | |
| PLN03209 | 576 | PLN03209, PLN03209, translocon at the inner envelo | 0.001 | |
| PRK09424 | 509 | PRK09424, pntA, NAD(P) transhydrogenase subunit al | 0.001 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 0.002 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 0.002 | |
| PRK14965 | 576 | PRK14965, PRK14965, DNA polymerase III subunits ga | 0.002 | |
| PRK11633 | 226 | PRK11633, PRK11633, cell division protein DedD; Pr | 0.002 | |
| PHA03307 | 1352 | PHA03307, PHA03307, transcriptional regulator ICP4 | 0.002 | |
| PRK07003 | 830 | PRK07003, PRK07003, DNA polymerase III subunits ga | 0.002 | |
| PRK01297 | 475 | PRK01297, PRK01297, ATP-dependent RNA helicase Rhl | 0.002 | |
| PRK01297 | 475 | PRK01297, PRK01297, ATP-dependent RNA helicase Rhl | 0.002 | |
| pfam13388 | 422 | pfam13388, DUF4106, Protein of unknown function (D | 0.002 | |
| PRK06975 | 656 | PRK06975, PRK06975, bifunctional uroporphyrinogen- | 0.002 | |
| TIGR02927 | 579 | TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogena | 0.002 | |
| PRK11892 | 464 | PRK11892, PRK11892, pyruvate dehydrogenase subunit | 0.002 | |
| PRK14963 | 504 | PRK14963, PRK14963, DNA polymerase III subunits ga | 0.002 | |
| COG5178 | 2365 | COG5178, PRP8, U5 snRNP spliceosome subunit [RNA p | 0.002 | |
| PRK10819 | 246 | PRK10819, PRK10819, transport protein TonB; Provis | 0.002 | |
| PHA03378 | 991 | PHA03378, PHA03378, EBNA-3B; Provisional | 0.002 | |
| TIGR00601 | 378 | TIGR00601, rad23, UV excision repair protein Rad23 | 0.002 | |
| PRK00404 | 141 | PRK00404, tatB, sec-independent translocase; Provi | 0.002 | |
| COG5373 | 931 | COG5373, COG5373, Predicted membrane protein [Func | 0.002 | |
| PRK10856 | 331 | PRK10856, PRK10856, cytoskeletal protein RodZ; Pro | 0.002 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 0.003 | |
| PHA03307 | 1352 | PHA03307, PHA03307, transcriptional regulator ICP4 | 0.003 | |
| PHA03307 | 1352 | PHA03307, PHA03307, transcriptional regulator ICP4 | 0.003 | |
| PRK15313 | 955 | PRK15313, PRK15313, autotransport protein MisL; Pr | 0.003 | |
| PRK06975 | 656 | PRK06975, PRK06975, bifunctional uroporphyrinogen- | 0.003 | |
| pfam07174 | 297 | pfam07174, FAP, Fibronectin-attachment protein (FA | 0.003 | |
| COG0810 | 244 | COG0810, TonB, Periplasmic protein TonB, links inn | 0.003 | |
| TIGR02927 | 579 | TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogena | 0.003 | |
| COG5373 | 931 | COG5373, COG5373, Predicted membrane protein [Func | 0.003 | |
| PRK14959 | 624 | PRK14959, PRK14959, DNA polymerase III subunits ga | 0.003 | |
| PLN02769 | 629 | PLN02769, PLN02769, Probable galacturonosyltransfe | 0.003 | |
| TIGR01645 | 612 | TIGR01645, half-pint, poly-U binding splicing fact | 0.003 | |
| PRK12323 | 700 | PRK12323, PRK12323, DNA polymerase III subunits ga | 0.004 | |
| PRK14971 | 614 | PRK14971, PRK14971, DNA polymerase III subunits ga | 0.004 | |
| PRK07994 | 647 | PRK07994, PRK07994, DNA polymerase III subunits ga | 0.004 | |
| PRK07003 | 830 | PRK07003, PRK07003, DNA polymerase III subunits ga | 0.004 | |
| COG0810 | 244 | COG0810, TonB, Periplasmic protein TonB, links inn | 0.004 | |
| PLN02258 | 590 | PLN02258, PLN02258, 9-cis-epoxycarotenoid dioxygen | 0.004 | |
| PRK11855 | 547 | PRK11855, PRK11855, dihydrolipoamide acetyltransfe | 0.004 | |
| pfam01044 | 850 | pfam01044, Vinculin, Vinculin family | 0.004 |
| >gnl|CDD|238924 cd01958, HPS_like, HPS_like: Hydrophobic Protein from Soybean (HPS)-like subfamily; composed of proteins with similarity to HPS, a small hydrophobic protein with unknown function related to cereal-type alpha-amylase inhibitors and lipid transfer proteins | Back alignment and domain information |
|---|
Score = 102 bits (256), Expect = 1e-28
Identities = 47/86 (54%), Positives = 60/86 (69%), Gaps = 2/86 (2%)
Query: 127 QTCPIDALKLGACVDVLGGLIHIGLGDSAKEKCCPLLQGLADLDAAVCLCTAIRLKALNL 186
TCP DALKLG C +VLG + LG A + CCPL+ GLADLDAAVCLCTAI+ L
Sbjct: 2 PTCPRDALKLGVCANVLGLSLL-LLGTPAVQPCCPLIGGLADLDAAVCLCTAIKANILG- 59
Query: 187 INLLVPISLQVLVNDCGKYPPAGFQC 212
I++ +P++L +L+N CG+ P GF C
Sbjct: 60 ISINIPVALSLLLNSCGRNVPPGFTC 85
|
In addition to HPS, members of this subfamily include a hybrid proline-rich protein (HyPRP) from maize, a dark-inducible protein (LeDI-2) from Lithospermum erythrorhizon, maize ZRP3 protein, and rice RcC3 protein. HyPRP is an embryo-specific protein that contains an N-terminal proline-rich domain and a C-terminal HPS-like cysteine-rich domain. It has been suggested that HyPRP may be involved in the stability and defense of the developing embryo. LeDI-2 is a root-specific protein that may be involved in regulating the biosynthesis of shikonin derivatives in L. erythrorhizon. Maize ZRP3 and rice RcC3 are root-specific proteins whose functions are yet to be determined. It has been reported that ZRP3 largely accumulates in a distinct subset of cortical cells. Length = 85 |
| >gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|215810 pfam00234, Tryp_alpha_amyl, Protease inhibitor/seed storage/LTP family | Back alignment and domain information |
|---|
| >gnl|CDD|218191 pfam04652, DUF605, Vta1 like | Back alignment and domain information |
|---|
| >gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218191 pfam04652, DUF605, Vta1 like | Back alignment and domain information |
|---|
| >gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218191 pfam04652, DUF605, Vta1 like | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 | Back alignment and domain information |
|---|
| >gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237874 PRK14971, PRK14971, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218191 pfam04652, DUF605, Vta1 like | Back alignment and domain information |
|---|
| >gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 | Back alignment and domain information |
|---|
| >gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184918 PRK14954, PRK14954, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237874 PRK14971, PRK14971, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|218191 pfam04652, DUF605, Vta1 like | Back alignment and domain information |
|---|
| >gnl|CDD|237871 PRK14965, PRK14965, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|240289 PTZ00144, PTZ00144, dihydrolipoamide succinyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218621 pfam05518, Totivirus_coat, Totivirus coat protein | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218191 pfam04652, DUF605, Vta1 like | Back alignment and domain information |
|---|
| >gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235904 PRK06995, flhF, flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237605 PRK14086, dnaA, chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235124 PRK03427, PRK03427, cell division protein ZipA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184918 PRK14954, PRK14954, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184918 PRK14954, PRK14954, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 | Back alignment and domain information |
|---|
| >gnl|CDD|217310 pfam02993, MCPVI, Minor capsid protein VI | Back alignment and domain information |
|---|
| >gnl|CDD|236940 PRK11633, PRK11633, cell division protein DedD; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235906 PRK07003, PRK07003, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237940 PRK15313, PRK15313, autotransport protein MisL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234938 PRK01297, PRK01297, ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237871 PRK14965, PRK14965, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240289 PTZ00144, PTZ00144, dihydrolipoamide succinyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234938 PRK01297, PRK01297, ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|218621 pfam05518, Totivirus_coat, Totivirus coat protein | Back alignment and domain information |
|---|
| >gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236940 PRK11633, PRK11633, cell division protein DedD; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236382 PRK09111, PRK09111, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 | Back alignment and domain information |
|---|
| >gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 | Back alignment and domain information |
|---|
| >gnl|CDD|240289 PTZ00144, PTZ00144, dihydrolipoamide succinyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240289 PTZ00144, PTZ00144, dihydrolipoamide succinyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236382 PRK09111, PRK09111, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237605 PRK14086, dnaA, chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237871 PRK14965, PRK14965, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222095 pfam13388, DUF4106, Protein of unknown function (DUF4106) | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236382 PRK09111, PRK09111, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236382 PRK09111, PRK09111, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236940 PRK11633, PRK11633, cell division protein DedD; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235899 PRK06975, PRK06975, bifunctional uroporphyrinogen-III synthetase/uroporphyrin-III C-methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|219321 pfam07174, FAP, Fibronectin-attachment protein (FAP) | Back alignment and domain information |
|---|
| >gnl|CDD|234012 TIGR02784, addA_alphas, double-strand break repair helicase AddA, alphaproteobacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|218621 pfam05518, Totivirus_coat, Totivirus coat protein | Back alignment and domain information |
|---|
| >gnl|CDD|235904 PRK06995, flhF, flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|222095 pfam13388, DUF4106, Protein of unknown function (DUF4106) | Back alignment and domain information |
|---|
| >gnl|CDD|235899 PRK06975, PRK06975, bifunctional uroporphyrinogen-III synthetase/uroporphyrin-III C-methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|223880 COG0810, TonB, Periplasmic protein TonB, links inner and outer membranes [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|223880 COG0810, TonB, Periplasmic protein TonB, links inner and outer membranes [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|234630 PRK00095, mutL, DNA mismatch repair protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|185628 PTZ00449, PTZ00449, 104 kDa microneme/rhoptry antigen; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215533 PLN02983, PLN02983, biotin carboxyl carrier protein of acetyl-CoA carboxylase | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|183854 PRK13042, PRK13042, superantigen-like protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|217392 pfam03153, TFIIA, Transcription factor IIA, alpha/beta subunit | Back alignment and domain information |
|---|
| >gnl|CDD|200219 TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|218191 pfam04652, DUF605, Vta1 like | Back alignment and domain information |
|---|
| >gnl|CDD|235124 PRK03427, PRK03427, cell division protein ZipA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236382 PRK09111, PRK09111, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|217469 pfam03276, Gag_spuma, Spumavirus gag protein | Back alignment and domain information |
|---|
| >gnl|CDD|223061 PHA03369, PHA03369, capsid maturational protease; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237011 PRK11892, PRK11892, pyruvate dehydrogenase subunit beta; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237605 PRK14086, dnaA, chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215145 PLN02258, PLN02258, 9-cis-epoxycarotenoid dioxygenase NCED | Back alignment and domain information |
|---|
| >gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|184927 PRK14963, PRK14963, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227505 COG5178, PRP8, U5 snRNP spliceosome subunit [RNA processing and modification] | Back alignment and domain information |
|---|
| >gnl|CDD|183854 PRK13042, PRK13042, superantigen-like protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|237011 PRK11892, PRK11892, pyruvate dehydrogenase subunit beta; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|240289 PTZ00144, PTZ00144, dihydrolipoamide succinyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218621 pfam05518, Totivirus_coat, Totivirus coat protein | Back alignment and domain information |
|---|
| >gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235906 PRK07003, PRK07003, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237940 PRK15313, PRK15313, autotransport protein MisL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234938 PRK01297, PRK01297, ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215533 PLN02983, PLN02983, biotin carboxyl carrier protein of acetyl-CoA carboxylase | Back alignment and domain information |
|---|
| >gnl|CDD|237011 PRK11892, PRK11892, pyruvate dehydrogenase subunit beta; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237011 PRK11892, PRK11892, pyruvate dehydrogenase subunit beta; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215145 PLN02258, PLN02258, 9-cis-epoxycarotenoid dioxygenase NCED | Back alignment and domain information |
|---|
| >gnl|CDD|215145 PLN02258, PLN02258, 9-cis-epoxycarotenoid dioxygenase NCED | Back alignment and domain information |
|---|
| >gnl|CDD|184927 PRK14963, PRK14963, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227505 COG5178, PRP8, U5 snRNP spliceosome subunit [RNA processing and modification] | Back alignment and domain information |
|---|
| >gnl|CDD|220603 pfam10152, DUF2360, Predicted coiled-coil domain-containing protein (DUF2360) | Back alignment and domain information |
|---|
| >gnl|CDD|218332 pfam04929, Herpes_DNAp_acc, Herpes DNA replication accessory factor | Back alignment and domain information |
|---|
| >gnl|CDD|178748 PLN03209, PLN03209, translocon at the inner envelope of chloroplast subunit 62; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236507 PRK09424, pntA, NAD(P) transhydrogenase subunit alpha; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237871 PRK14965, PRK14965, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236940 PRK11633, PRK11633, cell division protein DedD; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235906 PRK07003, PRK07003, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|234938 PRK01297, PRK01297, ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234938 PRK01297, PRK01297, ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222095 pfam13388, DUF4106, Protein of unknown function (DUF4106) | Back alignment and domain information |
|---|
| >gnl|CDD|235899 PRK06975, PRK06975, bifunctional uroporphyrinogen-III synthetase/uroporphyrin-III C-methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|200219 TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|237011 PRK11892, PRK11892, pyruvate dehydrogenase subunit beta; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184927 PRK14963, PRK14963, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227505 COG5178, PRP8, U5 snRNP spliceosome subunit [RNA processing and modification] | Back alignment and domain information |
|---|
| >gnl|CDD|236768 PRK10819, PRK10819, transport protein TonB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223065 PHA03378, PHA03378, EBNA-3B; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233045 TIGR00601, rad23, UV excision repair protein Rad23 | Back alignment and domain information |
|---|
| >gnl|CDD|166942 PRK00404, tatB, sec-independent translocase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227665 COG5373, COG5373, Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|236776 PRK10856, PRK10856, cytoskeletal protein RodZ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237940 PRK15313, PRK15313, autotransport protein MisL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235899 PRK06975, PRK06975, bifunctional uroporphyrinogen-III synthetase/uroporphyrin-III C-methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|219321 pfam07174, FAP, Fibronectin-attachment protein (FAP) | Back alignment and domain information |
|---|
| >gnl|CDD|223880 COG0810, TonB, Periplasmic protein TonB, links inner and outer membranes [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|200219 TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|227665 COG5373, COG5373, Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|184923 PRK14959, PRK14959, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215412 PLN02769, PLN02769, Probable galacturonosyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|130706 TIGR01645, half-pint, poly-U binding splicing factor, half-pint family | Back alignment and domain information |
|---|
| >gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237874 PRK14971, PRK14971, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235906 PRK07003, PRK07003, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|223880 COG0810, TonB, Periplasmic protein TonB, links inner and outer membranes [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|215145 PLN02258, PLN02258, 9-cis-epoxycarotenoid dioxygenase NCED | Back alignment and domain information |
|---|
| >gnl|CDD|237000 PRK11855, PRK11855, dihydrolipoamide acetyltransferase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|216263 pfam01044, Vinculin, Vinculin family | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 214 | |||
| PF14547 | 85 | Hydrophob_seed: Hydrophobic seed protein | 100.0 | |
| cd01958 | 85 | HPS_like HPS_like: Hydrophobic Protein from Soybea | 100.0 | |
| smart00499 | 79 | AAI Plant lipid transfer protein / seed storage pr | 97.22 | |
| cd04660 | 73 | nsLTP_like nsLTP_like: Non-specific lipid-transfer | 96.76 | |
| PF14368 | 96 | LTP_2: Probable lipid transfer; PDB: 2RKN_A 1N89_A | 96.36 | |
| cd00010 | 63 | AAI_LTSS AAI_LTSS: Alpha-Amylase Inhibitors (AAI), | 95.78 | |
| cd01959 | 66 | nsLTP2 nsLTP2: Non-specific lipid-transfer protein | 95.72 | |
| PF00234 | 90 | Tryp_alpha_amyl: Protease inhibitor/seed storage/L | 95.1 | |
| PF04554 | 58 | Extensin_2: Extensin-like region; InterPro: IPR006 | 93.48 | |
| cd01960 | 89 | nsLTP1 nsLTP1: Non-specific lipid-transfer protein | 92.48 | |
| PF04554 | 58 | Extensin_2: Extensin-like region; InterPro: IPR006 | 90.43 |
| >PF14547 Hydrophob_seed: Hydrophobic seed protein | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.3e-35 Score=225.43 Aligned_cols=85 Identities=58% Similarity=1.189 Sum_probs=83.2
Q ss_pred CCCccccCccccccccccccccccCCCCCCCCchhhhccccccchhhhhHHHhhhhccccccccchhhHHHhhhcCCCCC
Q 028062 128 TCPIDALKLGACVDVLGGLIHIGLGDSAKEKCCPLLQGLADLDAAVCLCTAIRLKALNLINLLVPISLQVLVNDCGKYPP 207 (214)
Q Consensus 128 tCP~DaLKLgvCanVLgGLv~~~lG~P~~~pCCpLI~GLaDldAAvCLCtAIKAnVLGlInlniPi~L~lLLN~CGK~~P 207 (214)
+||+|++|||+|+||| ||+++.+|.+.+++||++|+||+|+|||+|||+|+|+|+||+||+|+|+++++|+|.|||++|
T Consensus 1 ~CP~d~lkLgvC~~vL-~l~~~~~g~~~~~~CC~li~gL~d~~AA~CLC~aika~vlg~i~~~ipv~l~~lln~CGk~~p 79 (85)
T PF14547_consen 1 TCPRDALKLGVCANVL-GLVNLVIGNPPRQPCCSLIAGLADLDAAVCLCTAIKANVLGLINVNIPVALNLLLNACGKTVP 79 (85)
T ss_pred CCCCcchhhhhhhhhh-hhhccccCCCCCCCcChHHhCcccchHHHHHHHHHhhhcccccccccccHHHHHHHHhCCcCc
Confidence 6999999999999999 799999999999999999999999999999999999999999999999999999999999999
Q ss_pred CCCcCC
Q 028062 208 AGFQCP 213 (214)
Q Consensus 208 ~GF~C~ 213 (214)
+||+|+
T Consensus 80 ~gf~C~ 85 (85)
T PF14547_consen 80 SGFTCP 85 (85)
T ss_pred CCCcCC
Confidence 999996
|
|
| >cd01958 HPS_like HPS_like: Hydrophobic Protein from Soybean (HPS)-like subfamily; composed of proteins with similarity to HPS, a small hydrophobic protein with unknown function related to cereal-type alpha-amylase inhibitors and lipid transfer proteins | Back alignment and domain information |
|---|
| >smart00499 AAI Plant lipid transfer protein / seed storage protein / trypsin-alpha amylase inhibitor domain family | Back alignment and domain information |
|---|
| >cd04660 nsLTP_like nsLTP_like: Non-specific lipid-transfer protein (nsLTP)-like subfamily; composed of predominantly uncharacterized proteins with similarity to nsLTPs, including Medicago truncatula MtN5, the root-specific Phaseolus vulgaris PVR3, Antirrhinum majus FIL1, and Lilium longiflorum LIM3 | Back alignment and domain information |
|---|
| >PF14368 LTP_2: Probable lipid transfer; PDB: 2RKN_A 1N89_A 1TUK_A | Back alignment and domain information |
|---|
| >cd00010 AAI_LTSS AAI_LTSS: Alpha-Amylase Inhibitors (AAI), Lipid Transfer (LT) and Seed Storage (SS) Protein family; a protein family unique to higher plants that includes cereal-type alpha-amylase inhibitors, lipid transfer proteins, seed storage proteins, and similar proteins | Back alignment and domain information |
|---|
| >cd01959 nsLTP2 nsLTP2: Non-specific lipid-transfer protein type 2 (nsLTP2) subfamily; Plant nsLTPs are small, soluble proteins that facilitate the transfer of fatty acids, phospholipids, glycolipids, and steroids between membranes | Back alignment and domain information |
|---|
| >PF00234 Tryp_alpha_amyl: Protease inhibitor/seed storage/LTP family This is a small subfamily; InterPro: IPR003612 This domain is found is several proteins, including plant lipid transfer proteins [], seed storage proteins [] and trypsin-alpha amylase inhibitors [, ] | Back alignment and domain information |
|---|
| >PF04554 Extensin_2: Extensin-like region; InterPro: IPR006706 Extensins are homologous hydroxyproline-rich glycoproteins (HRGPs) found in the plant extracellular matrix | Back alignment and domain information |
|---|
| >cd01960 nsLTP1 nsLTP1: Non-specific lipid-transfer protein type 1 (nsLTP1) subfamily; Plant nsLTPs are small, soluble proteins that facilitate the transfer of fatty acids, phospholipids, glycolipids, and steroids between membranes | Back alignment and domain information |
|---|
| >PF04554 Extensin_2: Extensin-like region; InterPro: IPR006706 Extensins are homologous hydroxyproline-rich glycoproteins (HRGPs) found in the plant extracellular matrix | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 214 | ||||
| 1hyp_A | 80 | Crystal Structure Of Hydrophobic Protein From Soybe | 8e-07 |
| >pdb|1HYP|A Chain A, Crystal Structure Of Hydrophobic Protein From Soybean; A Member Of A New Cystine-Rich Family Length = 80 | Back alignment and structure |
|
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 214 | |||
| 1hyp_A | 80 | Hydrophobic protein from soybean; hydrophobic SEED | 3e-20 | |
| 3gdb_A | 937 | Endo-D, putative uncharacterized protein SPR0440; | 1e-11 | |
| 3gdb_A | 937 | Endo-D, putative uncharacterized protein SPR0440; | 1e-10 | |
| 3gdb_A | 937 | Endo-D, putative uncharacterized protein SPR0440; | 2e-10 | |
| 3gdb_A | 937 | Endo-D, putative uncharacterized protein SPR0440; | 4e-10 | |
| 3gdb_A | 937 | Endo-D, putative uncharacterized protein SPR0440; | 1e-07 | |
| 3gdb_A | 937 | Endo-D, putative uncharacterized protein SPR0440; | 2e-06 | |
| 3gdb_A | 937 | Endo-D, putative uncharacterized protein SPR0440; | 3e-06 | |
| 3gdb_A | 937 | Endo-D, putative uncharacterized protein SPR0440; | 4e-04 | |
| 3nwa_A | 703 | GB, GB-1, GB1, envelope glycoprotein B; coiled-coi | 5e-10 | |
| 3nwa_A | 703 | GB, GB-1, GB1, envelope glycoprotein B; coiled-coi | 3e-05 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 1e-09 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 2e-08 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 2e-08 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 2e-08 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 2e-08 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 9e-08 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 1e-07 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 3e-05 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 6e-05 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 9e-05 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 2e-04 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 5e-04 | |
| 3iox_A | 497 | AGI/II, PA; alpha helix, PPII helix, supersandwich | 2e-09 | |
| 3iox_A | 497 | AGI/II, PA; alpha helix, PPII helix, supersandwich | 2e-09 | |
| 3iox_A | 497 | AGI/II, PA; alpha helix, PPII helix, supersandwich | 7e-06 | |
| 3iox_A | 497 | AGI/II, PA; alpha helix, PPII helix, supersandwich | 7e-05 | |
| 3v1v_A | 433 | 2-MIB synthase, 2-methylisoborneol synthase; class | 2e-09 | |
| 3v1v_A | 433 | 2-MIB synthase, 2-methylisoborneol synthase; class | 3e-08 | |
| 3v1v_A | 433 | 2-MIB synthase, 2-methylisoborneol synthase; class | 8e-07 | |
| 3v1v_A | 433 | 2-MIB synthase, 2-methylisoborneol synthase; class | 1e-05 | |
| 3v1v_A | 433 | 2-MIB synthase, 2-methylisoborneol synthase; class | 2e-05 | |
| 3v1v_A | 433 | 2-MIB synthase, 2-methylisoborneol synthase; class | 6e-05 | |
| 1pk8_A | 422 | RAT synapsin I; ATP binding, ATP grAsp, calcium (I | 1e-07 | |
| 1pk8_A | 422 | RAT synapsin I; ATP binding, ATP grAsp, calcium (I | 2e-05 | |
| 1pk8_A | 422 | RAT synapsin I; ATP binding, ATP grAsp, calcium (I | 4e-05 | |
| 3dzy_A | 467 | Retinoic acid receptor RXR-alpha; DNA-binding, HOS | 8e-06 | |
| 3dzy_A | 467 | Retinoic acid receptor RXR-alpha; DNA-binding, HOS | 3e-05 | |
| 3dzy_A | 467 | Retinoic acid receptor RXR-alpha; DNA-binding, HOS | 1e-04 | |
| 3dzy_A | 467 | Retinoic acid receptor RXR-alpha; DNA-binding, HOS | 4e-04 | |
| 2h8h_A | 535 | Proto-oncogene tyrosine-protein kinase SRC; SRC ki | 1e-05 | |
| 3dva_I | 428 | Dihydrolipoyllysine-residue acetyltransferase comp | 2e-05 | |
| 3dva_I | 428 | Dihydrolipoyllysine-residue acetyltransferase comp | 5e-04 | |
| 3dva_I | 428 | Dihydrolipoyllysine-residue acetyltransferase comp | 6e-04 | |
| 2z73_A | 448 | Rhodopsin; visual pigment, GQ-type, G-protein coup | 3e-05 | |
| 2yew_A | 253 | Capsid protein, coat protein; alphavirus, molecula | 3e-05 | |
| 2yew_A | 253 | Capsid protein, coat protein; alphavirus, molecula | 9e-05 | |
| 2yew_A | 253 | Capsid protein, coat protein; alphavirus, molecula | 4e-04 | |
| 2yew_A | 253 | Capsid protein, coat protein; alphavirus, molecula | 5e-04 | |
| 2uv9_A | 1878 | Fatty acid synthase alpha subunits; fungal, dehydr | 3e-05 | |
| 2uv9_A | 1878 | Fatty acid synthase alpha subunits; fungal, dehydr | 1e-04 | |
| 2uv9_A | 1878 | Fatty acid synthase alpha subunits; fungal, dehydr | 2e-04 | |
| 2uv9_A | 1878 | Fatty acid synthase alpha subunits; fungal, dehydr | 2e-04 | |
| 2uv9_A | 1878 | Fatty acid synthase alpha subunits; fungal, dehydr | 3e-04 | |
| 2uv9_A | 1878 | Fatty acid synthase alpha subunits; fungal, dehydr | 5e-04 | |
| 2uv9_A | 1878 | Fatty acid synthase alpha subunits; fungal, dehydr | 6e-04 | |
| 2uv9_A | 1878 | Fatty acid synthase alpha subunits; fungal, dehydr | 6e-04 | |
| 2uv8_A | 1887 | Fatty acid synthase subunit alpha (FAS2); fatty ac | 4e-05 | |
| 2uv8_A | 1887 | Fatty acid synthase subunit alpha (FAS2); fatty ac | 6e-05 | |
| 2uv8_A | 1887 | Fatty acid synthase subunit alpha (FAS2); fatty ac | 7e-05 | |
| 2uv8_A | 1887 | Fatty acid synthase subunit alpha (FAS2); fatty ac | 7e-05 | |
| 2uv8_A | 1887 | Fatty acid synthase subunit alpha (FAS2); fatty ac | 3e-04 | |
| 2uv8_A | 1887 | Fatty acid synthase subunit alpha (FAS2); fatty ac | 3e-04 | |
| 2uv8_A | 1887 | Fatty acid synthase subunit alpha (FAS2); fatty ac | 5e-04 | |
| 2uv8_A | 1887 | Fatty acid synthase subunit alpha (FAS2); fatty ac | 6e-04 | |
| 2uv8_A | 1887 | Fatty acid synthase subunit alpha (FAS2); fatty ac | 8e-04 | |
| 2uv8_A | 1887 | Fatty acid synthase subunit alpha (FAS2); fatty ac | 8e-04 | |
| 2iut_A | 574 | DNA translocase FTSK; nucleotide-binding, chromoso | 5e-05 | |
| 2iut_A | 574 | DNA translocase FTSK; nucleotide-binding, chromoso | 2e-04 | |
| 1x9d_A | 538 | Endoplasmic reticulum mannosyl-oligosaccharide 1, | 1e-04 | |
| 1x9d_A | 538 | Endoplasmic reticulum mannosyl-oligosaccharide 1, | 1e-04 | |
| 1x9d_A | 538 | Endoplasmic reticulum mannosyl-oligosaccharide 1, | 2e-04 | |
| 1x9d_A | 538 | Endoplasmic reticulum mannosyl-oligosaccharide 1, | 3e-04 | |
| 2pzi_A | 681 | Probable serine/threonine-protein kinase PKNG; ATP | 1e-04 | |
| 2pzi_A | 681 | Probable serine/threonine-protein kinase PKNG; ATP | 2e-04 | |
| 2wvr_C | 546 | DNA replication factor CDT1; DNA replication licen | 2e-04 | |
| 2wvr_C | 546 | DNA replication factor CDT1; DNA replication licen | 3e-04 | |
| 2wvr_C | 546 | DNA replication factor CDT1; DNA replication licen | 3e-04 | |
| 3tx7_B | 352 | Nuclear receptor subfamily 5 group A member 2; LRH | 2e-04 | |
| 3a58_A | 320 | Exocyst complex component SEC3; protein complex, P | 4e-04 | |
| 3a58_A | 320 | Exocyst complex component SEC3; protein complex, P | 5e-04 | |
| 3a58_A | 320 | Exocyst complex component SEC3; protein complex, P | 5e-04 | |
| 1deq_A | 390 | Fibrinogen (alpha chain); coiled-coil, blood clott | 4e-04 | |
| 1deq_A | 390 | Fibrinogen (alpha chain); coiled-coil, blood clott | 7e-04 | |
| 2wd6_A | 349 | Agglutinin receptor; cell adhesion, secreted, V-re | 5e-04 | |
| 2wd6_A | 349 | Agglutinin receptor; cell adhesion, secreted, V-re | 7e-04 | |
| 2wd6_A | 349 | Agglutinin receptor; cell adhesion, secreted, V-re | 8e-04 | |
| 2es4_D | 332 | Lipase chaperone; protein-protein complex, steric | 5e-04 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 5e-04 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 6e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 6e-04 | |
| 2vg3_A | 284 | Undecaprenyl pyrophosphate synthetase; transferase | 7e-04 |
| >1hyp_A Hydrophobic protein from soybean; hydrophobic SEED protein; 1.80A {Glycine max} SCOP: a.52.1.1 Length = 80 | Back alignment and structure |
|---|
Score = 80.3 bits (198), Expect = 3e-20
Identities = 28/89 (31%), Positives = 47/89 (52%), Gaps = 14/89 (15%)
Query: 126 QQTCPIDALKLGACVDVLGGLIHIGLGDSAKEKCCPLLQGLADLDAAVCLCTAIRLKALN 185
+ +CP L C+++LGG + + CC L+ GL D++A VCLC +R +
Sbjct: 5 RPSCP----DLSICLNILGGSLG------TVDDCCALIGGLGDIEAIVCLCIQLRALGI- 53
Query: 186 LINLLVPISLQVLVNDCGKYPPAGFQCPA 214
L + +LQ+++N CG+ P+ CP
Sbjct: 54 ---LNLNRNLQLILNSCGRSYPSNATCPR 79
|
| >3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937 | Back alignment and structure |
|---|
| >3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937 | Back alignment and structure |
|---|
| >3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937 | Back alignment and structure |
|---|
| >3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937 | Back alignment and structure |
|---|
| >3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937 | Back alignment and structure |
|---|
| >3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937 | Back alignment and structure |
|---|
| >3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937 | Back alignment and structure |
|---|
| >3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937 | Back alignment and structure |
|---|
| >3nwa_A GB, GB-1, GB1, envelope glycoprotein B; coiled-coil, membrane fusion, viral P glycoprotein B, HSV-1, membrane; HET: NAG; 2.26A {Human herpesvirus 1} PDB: 3nwf_A* 3nw8_A* 3nwd_A* Length = 703 | Back alignment and structure |
|---|
| >3nwa_A GB, GB-1, GB1, envelope glycoprotein B; coiled-coil, membrane fusion, viral P glycoprotein B, HSV-1, membrane; HET: NAG; 2.26A {Human herpesvirus 1} PDB: 3nwf_A* 3nw8_A* 3nwd_A* Length = 703 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >3iox_A AGI/II, PA; alpha helix, PPII helix, supersandwich fold, surface adhesin WALL, peptidoglycan-anchor, cell adhesion; HET: PMS; 1.80A {Streptococcus mutans} PDB: 3ipk_A* 1jmm_A Length = 497 | Back alignment and structure |
|---|
| >3iox_A AGI/II, PA; alpha helix, PPII helix, supersandwich fold, surface adhesin WALL, peptidoglycan-anchor, cell adhesion; HET: PMS; 1.80A {Streptococcus mutans} PDB: 3ipk_A* 1jmm_A Length = 497 | Back alignment and structure |
|---|
| >3iox_A AGI/II, PA; alpha helix, PPII helix, supersandwich fold, surface adhesin WALL, peptidoglycan-anchor, cell adhesion; HET: PMS; 1.80A {Streptococcus mutans} PDB: 3ipk_A* 1jmm_A Length = 497 | Back alignment and structure |
|---|
| >3iox_A AGI/II, PA; alpha helix, PPII helix, supersandwich fold, surface adhesin WALL, peptidoglycan-anchor, cell adhesion; HET: PMS; 1.80A {Streptococcus mutans} PDB: 3ipk_A* 1jmm_A Length = 497 | Back alignment and structure |
|---|
| >3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 | Back alignment and structure |
|---|
| >3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 | Back alignment and structure |
|---|
| >3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 | Back alignment and structure |
|---|
| >3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 | Back alignment and structure |
|---|
| >3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 | Back alignment and structure |
|---|
| >3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 | Back alignment and structure |
|---|
| >1pk8_A RAT synapsin I; ATP binding, ATP grAsp, calcium (II) ION, membrane protein; HET: ATP; 2.10A {Rattus norvegicus} SCOP: c.30.1.5 d.142.1.3 PDB: 1px2_A* Length = 422 | Back alignment and structure |
|---|
| >1pk8_A RAT synapsin I; ATP binding, ATP grAsp, calcium (II) ION, membrane protein; HET: ATP; 2.10A {Rattus norvegicus} SCOP: c.30.1.5 d.142.1.3 PDB: 1px2_A* Length = 422 | Back alignment and structure |
|---|
| >1pk8_A RAT synapsin I; ATP binding, ATP grAsp, calcium (II) ION, membrane protein; HET: ATP; 2.10A {Rattus norvegicus} SCOP: c.30.1.5 d.142.1.3 PDB: 1px2_A* Length = 422 | Back alignment and structure |
|---|
| >3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 | Back alignment and structure |
|---|
| >3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 | Back alignment and structure |
|---|
| >3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 | Back alignment and structure |
|---|
| >3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 | Back alignment and structure |
|---|
| >2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Length = 535 | Back alignment and structure |
|---|
| >3dva_I Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; oxidoreductase, multienzyme complex; HET: TPW; 2.35A {Bacillus stearothermophilus} PDB: 3dv0_I* 3duf_I* 1b5s_A 1lab_A 1lac_A 1w3d_A Length = 428 | Back alignment and structure |
|---|
| >3dva_I Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; oxidoreductase, multienzyme complex; HET: TPW; 2.35A {Bacillus stearothermophilus} PDB: 3dv0_I* 3duf_I* 1b5s_A 1lab_A 1lac_A 1w3d_A Length = 428 | Back alignment and structure |
|---|
| >3dva_I Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; oxidoreductase, multienzyme complex; HET: TPW; 2.35A {Bacillus stearothermophilus} PDB: 3dv0_I* 3duf_I* 1b5s_A 1lab_A 1lac_A 1w3d_A Length = 428 | Back alignment and structure |
|---|
| >2z73_A Rhodopsin; visual pigment, GQ-type, G-protein coupled receptor, chromophore, glycoprotein, lipoprotein, membrane, palmitate phosphorylation; HET: BOG RET PLM TWT PC1; 2.50A {Todarodes pacificus} PDB: 3aym_A* 3ayn_A* 2ziy_A* Length = 448 | Back alignment and structure |
|---|
| >2yew_A Capsid protein, coat protein; alphavirus, molecular dynamics; 5.00A {Barmah forest virus} Length = 253 | Back alignment and structure |
|---|
| >2yew_A Capsid protein, coat protein; alphavirus, molecular dynamics; 5.00A {Barmah forest virus} Length = 253 | Back alignment and structure |
|---|
| >2yew_A Capsid protein, coat protein; alphavirus, molecular dynamics; 5.00A {Barmah forest virus} Length = 253 | Back alignment and structure |
|---|
| >2yew_A Capsid protein, coat protein; alphavirus, molecular dynamics; 5.00A {Barmah forest virus} Length = 253 | Back alignment and structure |
|---|
| >2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* Length = 1878 | Back alignment and structure |
|---|
| >2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* Length = 1878 | Back alignment and structure |
|---|
| >2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* Length = 1878 | Back alignment and structure |
|---|
| >2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* Length = 1878 | Back alignment and structure |
|---|
| >2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* Length = 1878 | Back alignment and structure |
|---|
| >2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* Length = 1878 | Back alignment and structure |
|---|
| >2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* Length = 1878 | Back alignment and structure |
|---|
| >2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* Length = 1878 | Back alignment and structure |
|---|
| >2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* Length = 1887 | Back alignment and structure |
|---|
| >2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* Length = 1887 | Back alignment and structure |
|---|
| >2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* Length = 1887 | Back alignment and structure |
|---|
| >2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* Length = 1887 | Back alignment and structure |
|---|
| >2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* Length = 1887 | Back alignment and structure |
|---|
| >2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* Length = 1887 | Back alignment and structure |
|---|
| >2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* Length = 1887 | Back alignment and structure |
|---|
| >2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* Length = 1887 | Back alignment and structure |
|---|
| >2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* Length = 1887 | Back alignment and structure |
|---|
| >2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* Length = 1887 | Back alignment and structure |
|---|
| >2iut_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- cell division, DNA translocation, KOPS, membrane; HET: DNA SAP; 2.25A {Pseudomonas aeruginosa} PDB: 2iuu_A* Length = 574 | Back alignment and structure |
|---|
| >2iut_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- cell division, DNA translocation, KOPS, membrane; HET: DNA SAP; 2.25A {Pseudomonas aeruginosa} PDB: 2iuu_A* Length = 574 | Back alignment and structure |
|---|
| >1x9d_A Endoplasmic reticulum mannosyl-oligosaccharide 1, 2-alpha-mannosidase; substrate analogue, glycosyl hydrolase; HET: SMD; 1.41A {Homo sapiens} SCOP: a.102.2.1 PDB: 1fo3_A* 1fo2_A* 1fmi_A Length = 538 | Back alignment and structure |
|---|
| >1x9d_A Endoplasmic reticulum mannosyl-oligosaccharide 1, 2-alpha-mannosidase; substrate analogue, glycosyl hydrolase; HET: SMD; 1.41A {Homo sapiens} SCOP: a.102.2.1 PDB: 1fo3_A* 1fo2_A* 1fmi_A Length = 538 | Back alignment and structure |
|---|
| >1x9d_A Endoplasmic reticulum mannosyl-oligosaccharide 1, 2-alpha-mannosidase; substrate analogue, glycosyl hydrolase; HET: SMD; 1.41A {Homo sapiens} SCOP: a.102.2.1 PDB: 1fo3_A* 1fo2_A* 1fmi_A Length = 538 | Back alignment and structure |
|---|
| >1x9d_A Endoplasmic reticulum mannosyl-oligosaccharide 1, 2-alpha-mannosidase; substrate analogue, glycosyl hydrolase; HET: SMD; 1.41A {Homo sapiens} SCOP: a.102.2.1 PDB: 1fo3_A* 1fo2_A* 1fmi_A Length = 538 | Back alignment and structure |
|---|
| >2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Length = 681 | Back alignment and structure |
|---|
| >2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Length = 681 | Back alignment and structure |
|---|
| >2wvr_C DNA replication factor CDT1; DNA replication license, DNA replication inhibitor, phosphoprotein, UBL conjugation, DNA-binding, polymorphism; HET: DNA; 3.30A {Homo sapiens} PDB: 2klo_A* Length = 546 | Back alignment and structure |
|---|
| >2wvr_C DNA replication factor CDT1; DNA replication license, DNA replication inhibitor, phosphoprotein, UBL conjugation, DNA-binding, polymorphism; HET: DNA; 3.30A {Homo sapiens} PDB: 2klo_A* Length = 546 | Back alignment and structure |
|---|
| >2wvr_C DNA replication factor CDT1; DNA replication license, DNA replication inhibitor, phosphoprotein, UBL conjugation, DNA-binding, polymorphism; HET: DNA; 3.30A {Homo sapiens} PDB: 2klo_A* Length = 546 | Back alignment and structure |
|---|
| >3tx7_B Nuclear receptor subfamily 5 group A member 2; LRH-1, beta-catenin, armadillo repeat, nuclear receptor LIGA binding domain, protein binding; HET: P6L; 2.76A {Homo sapiens} Length = 352 | Back alignment and structure |
|---|
| >3a58_A Exocyst complex component SEC3; protein complex, PH domain, GTPase, membrane traffic, coiled coil, exocytosis, phosphoprotein; HET: GNP; 2.60A {Saccharomyces cerevisiae} Length = 320 | Back alignment and structure |
|---|
| >3a58_A Exocyst complex component SEC3; protein complex, PH domain, GTPase, membrane traffic, coiled coil, exocytosis, phosphoprotein; HET: GNP; 2.60A {Saccharomyces cerevisiae} Length = 320 | Back alignment and structure |
|---|
| >3a58_A Exocyst complex component SEC3; protein complex, PH domain, GTPase, membrane traffic, coiled coil, exocytosis, phosphoprotein; HET: GNP; 2.60A {Saccharomyces cerevisiae} Length = 320 | Back alignment and structure |
|---|
| >2wd6_A Agglutinin receptor; cell adhesion, secreted, V-region, cell WALL, AG I/II protei surface adhesin, peptidoglycan-anchor; 2.30A {Streptococcus gordonii} Length = 349 | Back alignment and structure |
|---|
| >2wd6_A Agglutinin receptor; cell adhesion, secreted, V-region, cell WALL, AG I/II protei surface adhesin, peptidoglycan-anchor; 2.30A {Streptococcus gordonii} Length = 349 | Back alignment and structure |
|---|
| >2wd6_A Agglutinin receptor; cell adhesion, secreted, V-region, cell WALL, AG I/II protei surface adhesin, peptidoglycan-anchor; 2.30A {Streptococcus gordonii} Length = 349 | Back alignment and structure |
|---|
| >2es4_D Lipase chaperone; protein-protein complex, steric chaperone, triacylglycerol hydrolase, all alpha helix protein, A/B hydrolase fold; 1.85A {Burkholderia glumae} SCOP: a.137.15.1 Length = 332 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >2vg3_A Undecaprenyl pyrophosphate synthetase; transferase, cell WALL biogenesis/degradation, cell cycle, P transferase; HET: GPP; 1.8A {Mycobacterium tuberculosis} PDB: 2vg2_A* 2vg4_A Length = 284 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 214 | |||
| 1hyp_A | 80 | Hydrophobic protein from soybean; hydrophobic SEED | 99.96 | |
| 1l6h_A | 69 | LTP2, non-specific lipid transfer protein; NSLTP2, | 96.26 | |
| 1n89_A | 67 | Lipid transfer protein; lipid transport; HET: PGM; | 96.17 | |
| 2rkn_A | 77 | DIR1 protein, AT5G48485; LTP, defense signaling pr | 95.62 | |
| 2ljo_A | 93 | Non-specific lipid-transfer protein 2; lipid trans | 94.16 | |
| 1siy_A | 91 | LTP 1, NS-LTP1, nonspecific lipid-transfer protein | 93.63 | |
| 2alg_A | 92 | Non-specific lipid transfer protein; LTP, NS-LTP, | 93.09 | |
| 1bwo_A | 90 | NS-LTP1, nonspecific lipid-transfer protein; wheat | 92.84 | |
| 1afh_A | 93 | Maize nonspecific lipid transfer protein; lipid-bi | 92.72 | |
| 1t12_A | 91 | LTP 1, nonspecific lipid-transfer protein 1; cyste | 91.33 |
| >1hyp_A Hydrophobic protein from soybean; hydrophobic SEED protein; 1.80A {Glycine max} SCOP: a.52.1.1 | Back alignment and structure |
|---|
Probab=99.96 E-value=2.6e-30 Score=194.46 Aligned_cols=75 Identities=43% Similarity=1.021 Sum_probs=67.1
Q ss_pred CCCCCccccCccccccccccccccccCCCCCCCCchhhhccccccchhhhhHHHhhhhccccccccchhhHHHhhhcCCC
Q 028062 126 QQTCPIDALKLGACVDVLGGLIHIGLGDSAKEKCCPLLQGLADLDAAVCLCTAIRLKALNLINLLVPISLQVLVNDCGKY 205 (214)
Q Consensus 126 ~~tCP~DaLKLgvCanVLgGLv~~~lG~P~~~pCCpLI~GLaDldAAvCLCtAIKAnVLGlInlniPi~L~lLLN~CGK~ 205 (214)
.++|| |||+|+|||||++ | .+++||++|+||+|+|||+||||||| +|| | +|++++|++|+|.|||+
T Consensus 5 ~~~CP----kLgvCanvL~g~~----~--~~~~CC~Ll~GL~dleAAvCLCtaik--~Lg-i-lnlpv~L~llln~Cgk~ 70 (80)
T 1hyp_A 5 RPSCP----DLSICLNILGGSL----G--TVDDCCALIGGLGDIEAIVCLCIQLR--ALG-I-LNLNRNLQLILNSCGRS 70 (80)
T ss_dssp -CCSC----CCGGGGGGGGTCC----T--THHHHHHHHHTSCHHHHHHHHHHHHH--HHT-C-SCHHHHHHHHHHHTTCS
T ss_pred CCCCC----chhHHHHHhCcCC----C--CCCccchhhhCcchhhhhhhhhhhcc--ccc-e-eecChhHHHHHHHhCCc
Confidence 46799 8999999998653 2 56789999999999999999999999 499 7 89999999999999999
Q ss_pred CCCCCcCCC
Q 028062 206 PPAGFQCPA 214 (214)
Q Consensus 206 ~P~GF~C~~ 214 (214)
+|+||+|+.
T Consensus 71 ~P~gF~C~~ 79 (80)
T 1hyp_A 71 YPSNATCPR 79 (80)
T ss_dssp SCCCCCCSC
T ss_pred CcCCCCCCC
Confidence 999999974
|
| >1l6h_A LTP2, non-specific lipid transfer protein; NSLTP2, plant LTP, lipid transport; NMR {Oryza sativa} SCOP: a.52.1.1 | Back alignment and structure |
|---|
| >1n89_A Lipid transfer protein; lipid transport; HET: PGM; NMR {Triticum turgidum subsp} SCOP: a.52.1.1 PDB: 1tuk_A* | Back alignment and structure |
|---|
| >2rkn_A DIR1 protein, AT5G48485; LTP, defense signaling protein, signaling protein, lipid TRA; HET: LP3; 1.60A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2ljo_A Non-specific lipid-transfer protein 2; lipid transport; NMR {Lens culinaris} | Back alignment and structure |
|---|
| >1siy_A LTP 1, NS-LTP1, nonspecific lipid-transfer protein 1; alpha helix, lipid binding protein; NMR {Vigna radiata var} | Back alignment and structure |
|---|
| >2alg_A Non-specific lipid transfer protein; LTP, NS-LTP, FOOD allergen, lipid transport; HET: DAO P6G; 2.30A {Prunus persica} PDB: 2b5s_A* | Back alignment and structure |
|---|
| >1bwo_A NS-LTP1, nonspecific lipid-transfer protein; wheat, lipid binding, crystallography; HET: LPC; 2.10A {Triticum aestivum} SCOP: a.52.1.1 PDB: 1cz2_A* 1gh1_A 1be2_A* 1jtb_A* 1lip_A 1mid_A* 3cee_A* 3gsh_A* | Back alignment and structure |
|---|
| >1afh_A Maize nonspecific lipid transfer protein; lipid-binding protein, molecular modeling,; NMR {Zea mays} SCOP: a.52.1.1 PDB: 1fk0_A* 1fk1_A* 1fk2_A* 1fk3_A* 1fk4_A* 1fk5_A* 1fk6_A* 1fk7_A* 1mzl_A 1mzm_A* 1bv2_A 1rzl_A* 1uva_A* 1uvb_A* 1uvc_A* | Back alignment and structure |
|---|
| >1t12_A LTP 1, nonspecific lipid-transfer protein 1; cystein rich protein, lipid transport; NMR {Nicotiana tabacum} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 214 | ||||
| d1hypa_ | 75 | a.52.1.1 (A:) Soybean hydrophobic protein {Soybean | 4e-23 | |
| d1hbxg_ | 155 | a.4.5.21 (G:) Serum response factor accessory prot | 5e-04 |
| >d1hypa_ a.52.1.1 (A:) Soybean hydrophobic protein {Soybean (Glycine max) [TaxId: 3847]} Length = 75 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin family: Plant lipid-transfer and hydrophobic proteins domain: Soybean hydrophobic protein species: Soybean (Glycine max) [TaxId: 3847]
Score = 86.3 bits (214), Expect = 4e-23
Identities = 28/87 (32%), Positives = 46/87 (52%), Gaps = 14/87 (16%)
Query: 128 TCPIDALKLGACVDVLGGLIHIGLGDSAKEKCCPLLQGLADLDAAVCLCTAIRLKALNLI 187
+CP L C+++LGG + + CC L+ GL D++A VCLC +R +
Sbjct: 2 SCP----DLSICLNILGGSLG------TVDDCCALIGGLGDIEAIVCLCIQLRALGI--- 48
Query: 188 NLLVPISLQVLVNDCGKYPPAGFQCPA 214
L + +LQ+++N CG+ P+ CP
Sbjct: 49 -LNLNRNLQLILNSCGRSYPSNATCPR 74
|
| >d1hbxg_ a.4.5.21 (G:) Serum response factor accessory protein 1a, SAP-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 155 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 214 | |||
| d1hypa_ | 75 | Soybean hydrophobic protein {Soybean (Glycine max) | 99.96 | |
| d1fk5a_ | 93 | Plant non-specific lipid-transfer protein (ns-LTP, | 95.3 | |
| d1mida_ | 91 | Plant non-specific lipid-transfer protein (ns-LTP, | 93.88 | |
| d1tuka1 | 67 | Non-specific lipid-transfer protein homologue (ns- | 91.9 | |
| d1l6ha_ | 69 | Non-specific lipid-transfer protein homologue (ns- | 89.49 |
| >d1hypa_ a.52.1.1 (A:) Soybean hydrophobic protein {Soybean (Glycine max) [TaxId: 3847]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin family: Plant lipid-transfer and hydrophobic proteins domain: Soybean hydrophobic protein species: Soybean (Glycine max) [TaxId: 3847]
Probab=99.96 E-value=9.4e-31 Score=193.16 Aligned_cols=74 Identities=39% Similarity=0.949 Sum_probs=66.2
Q ss_pred CCCCccccCccccccccccccccccCCCCCCCCchhhhccccccchhhhhHHHhhhhccccccccchhhHHHhhhcCCCC
Q 028062 127 QTCPIDALKLGACVDVLGGLIHIGLGDSAKEKCCPLLQGLADLDAAVCLCTAIRLKALNLINLLVPISLQVLVNDCGKYP 206 (214)
Q Consensus 127 ~tCP~DaLKLgvCanVLgGLv~~~lG~P~~~pCCpLI~GLaDldAAvCLCtAIKAnVLGlInlniPi~L~lLLN~CGK~~ 206 (214)
.+|| |||+|+|||||+++ ..++||++|+||+|+|||+||||||||+ | | +|+||+|++|+|.|||++
T Consensus 1 PtCP----Klg~C~nvLg~~~~------~~~~CC~Ll~GL~dleAAvCLCtaika~--~-l-lnvpv~l~llln~Cgk~~ 66 (75)
T d1hypa_ 1 PSCP----DLSICLNILGGSLG------TVDDCCALIGGLGDIEAIVCLCIQLRAL--G-I-LNLNRNLQLILNSCGRSY 66 (75)
T ss_dssp CCSC----CCGGGGGGGGTCCT------THHHHHHHHHTSCHHHHHHHHHHHHHHH--T-C-SCHHHHHHHHHHHTTCSS
T ss_pred CCCC----chhhHHHHhcCccC------CCCCcchHHhhHHHHHHHHHHHHHHHHh--h-h-ccccchHHHHHHHcCCcC
Confidence 3799 89999999997753 4578999999999999999999999995 4 3 678899999999999999
Q ss_pred CCCCcCCC
Q 028062 207 PAGFQCPA 214 (214)
Q Consensus 207 P~GF~C~~ 214 (214)
|+||+|++
T Consensus 67 P~gF~CP~ 74 (75)
T d1hypa_ 67 PSNATCPR 74 (75)
T ss_dssp CCCCCCSC
T ss_pred cCCCcCCC
Confidence 99999975
|
| >d1fk5a_ a.52.1.1 (A:) Plant non-specific lipid-transfer protein (ns-LTP, ns-LTP1) {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1mida_ a.52.1.1 (A:) Plant non-specific lipid-transfer protein (ns-LTP, ns-LTP1) {Barley (Hordeum vulgare) [TaxId: 4513]} | Back information, alignment and structure |
|---|
| >d1tuka1 a.52.1.1 (A:1-67) Non-specific lipid-transfer protein homologue (ns-LTP2) {Triticum turgidum [TaxId: 4571]} | Back information, alignment and structure |
|---|
| >d1l6ha_ a.52.1.1 (A:) Non-specific lipid-transfer protein homologue (ns-LTP2) {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|