Citrus Sinensis ID: 028062


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210----
MGKYQLASSFILLLNLGTLLTSLACDCSNNPPPPPASKTPNCPPPPSSPSPKTPPPPPPFVKSPPPPPPVVKSAPPPPPPVAKSPPPPPPVVKSPPPPIVKPPPPNGPSPKSPPPPSVRYPPPPKQQTCPIDALKLGACVDVLGGLIHIGLGDSAKEKCCPLLQGLADLDAAVCLCTAIRLKALNLINLLVPISLQVLVNDCGKYPPAGFQCPA
ccccHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHcccEEEcccccccccccccccccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHccccccccccccc
ccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHEHHHHcccEEEEEcccccccccHHHHHHHcHHHHHHHHHHHHHHHHcEEEccccHHHHHHHHHccccccccccccc
MGKYQLASSFILLLNLGTLLTslacdcsnnpppppasktpncppppsspspktppppppfvksppppppvvksappppppvaksppppppvvksppppivkppppngpspksppppsvryppppkqqtcpidalklgACVDVLGGLIhiglgdsakekccpllqgLADLDAAVCLCTAIRLKALNLINLLVPISLQVLVndcgkyppagfqcpa
MGKYQLASSFILLLNLGTLLTSLACDCSNNPPPPPASKTPNCPPPPSSPSPKTPPPPPPFVKSPPPPPPVVKSAPPPPPPVAKSPPPPPPVVKSPPPPIVKPPPPNGPSPKSPPPPSVRYPPPPKQQTCPIDALKLGACVDVLGGLIHIGLGDSAKEKCCPLLQGLADLDAAVCLCTAIRLKALNLINLLVPISLQVLVNDCGKYPPAGFQCPA
MGKYQLASSFIlllnlgtlltslACDCSNNpppppasktpncppppsspspktppppppfvksppppppvvksappppppvaksppppppvvksppppivkppppngpspksppppsvryppppKQQTCPIDALKLGACVDVLGGLIHIGLGDSAKEKCCPLLQGLADLDAAVCLCTAIRLKALNLINLLVPISLQVLVNDCGKYPPAGFQCPA
********************************************************************************************************************************CPIDALKLGACVDVLGGLIHIGLGDSAKEKCCPLLQGLADLDAAVCLCTAIRLKALNLINLLVPISLQVLVNDCGKYPPA******
******A**FILLLNLGTLLTSLACD*********************SPSPKTPPPPPPFVKSPPPPPP********************PV**S**********************************CPIDALKLGACVDVLGGLIHIGLGDSAKEKCCPLLQGLADLDAAVCLCTAIRLKALNLINLLVPISLQVLVNDCGKYPPAGFQCP*
MGKYQLASSFILLLNLGTLLTSLACDCSNN**************************************************************KSPPPPIVKPP***************RYPPPPKQQTCPIDALKLGACVDVLGGLIHIGLGDSAKEKCCPLLQGLADLDAAVCLCTAIRLKALNLINLLVPISLQVLVNDCGKYPPAGFQCPA
*GKYQLASSFILLLNLGTLLTSLACDCSNNPPPPPASKTPNCPPPPSSPSPKTPPPPPPFVKSPPPPPPVVKSAPPPPPPVAKSPPPPPPVVKSPP*PIVKPPPPNGPSPKSPPPPSV********QTCPIDALKLGACVDVLGGLIHIGLGDSAKEKCCPLLQGLADLDAAVCLCTAIRLKALNLINLLVPISLQVLVNDCGKYPPAGFQCPA
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGKYQLASSFILLLNLGTLLTSLACDCSNNPPPPPASKTPNCPPPPSSPSPKTPPPPPPFVKSPPPPPPVVKSAPPPPPPVAKSPPPPPPVVKSPPPPIVKPPPPNGPSPKSPPPPSVRYPPPPKQQTCPIDALKLGACVDVLGGLIHIGLGDSAKEKCCPLLQGLADLDAAVCLCTAIRLKALNLINLLVPISLQVLVNDCGKYPPAGFQCPA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query214 2.2.26 [Sep-21-2011]
Q00451346 36.4 kDa proline-rich pro N/A no 0.411 0.254 0.764 2e-26
Q01595129 Cortical cell-delineating N/A no 0.392 0.651 0.545 3e-16
Q8RW93128 Putative lipid-binding pr no no 0.425 0.710 0.468 6e-15
P14009137 14 kDa proline-rich prote N/A no 0.392 0.613 0.505 5e-14
>sp|Q00451|PRF1_SOLLC 36.4 kDa proline-rich protein OS=Solanum lycopersicum GN=TPRP-F1 PE=2 SV=1 Back     alignment and function desciption
 Score =  119 bits (298), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 68/89 (76%), Positives = 79/89 (88%), Gaps = 1/89 (1%)

Query: 126 QQTCPIDALKLGACVDVLGGLIHIGLGDSAKEKCCPLLQGLADLDAAVCLCTAIRLKALN 185
           Q TCPIDALKLGACVDVLGGLIHIG+G SAK+ CCPLL GL DLDAA+CLCT IRLK LN
Sbjct: 258 QPTCPIDALKLGACVDVLGGLIHIGIGGSAKQTCCPLLGGLVDLDAAICLCTTIRLKLLN 317

Query: 186 LINLLVPISLQVLVNDCGKYPPAGFQCPA 214
            IN+++PI+LQVL++DCGKYPP  F+CP+
Sbjct: 318 -INIILPIALQVLIDDCGKYPPKDFKCPS 345





Solanum lycopersicum (taxid: 4081)
>sp|Q01595|CCDP_MAIZE Cortical cell-delineating protein OS=Zea mays PE=2 SV=1 Back     alignment and function description
>sp|Q8RW93|LBP65_ARATH Putative lipid-binding protein At4g00165 OS=Arabidopsis thaliana GN=At4g00165 PE=2 SV=1 Back     alignment and function description
>sp|P14009|14KD_DAUCA 14 kDa proline-rich protein DC2.15 OS=Daucus carota PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query214
145332667 1480 bifunctional inhibitor/lipid transfer pr 0.401 0.058 0.693 2e-33
297835204 722 predicted protein [Arabidopsis lyrata su 0.411 0.121 0.7 1e-31
15022163 407 putative proline-rich protein [Solanum p 0.406 0.213 0.741 3e-31
359475712310 PREDICTED: uncharacterized protein LOC10 0.406 0.280 0.752 5e-31
449456667254 PREDICTED: uncharacterized protein LOC10 0.406 0.342 0.741 7e-31
449518449143 PREDICTED: 36.4 kDa proline-rich protein 0.406 0.608 0.741 8e-31
118486411179 unknown [Populus trichocarpa] 0.406 0.486 0.741 5e-30
224104875179 predicted protein [Populus trichocarpa] 0.406 0.486 0.741 6e-30
297804748 451 hypothetical protein ARALYDRAFT_493374 [ 0.406 0.192 0.755 2e-29
22408636385 predicted protein [Populus trichocarpa] 0.397 1.0 0.747 5e-29
>gi|145332667|ref|NP_001078199.1| bifunctional inhibitor/lipid transfer protein/seed storage protein-like protein [Arabidopsis thaliana] gi|11994733|dbj|BAB03062.1| unnamed protein product [Arabidopsis thaliana] gi|332643072|gb|AEE76593.1| bifunctional inhibitor/lipid transfer protein/seed storage protein-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
 Score =  147 bits (372), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 61/88 (69%), Positives = 78/88 (88%), Gaps = 2/88 (2%)

Query: 127  QTCPIDALKLGACVDVLGGLIHIGLGDSAKEKCCPLLQGLADLDAAVCLCTAIRLKALNL 186
            +TCPID LKLG+CVD+LGGL+HIG+G SAKEKCCP+++GL DLDAAVCLCT I+ K LN 
Sbjct: 1395 KTCPIDTLKLGSCVDLLGGLVHIGIGKSAKEKCCPVVEGLVDLDAAVCLCTTIKAKLLN- 1453

Query: 187  INLLVPISLQVLVNDCGKYPPAGFQCPA 214
            I++++PI+L+VL+N CGK PP GF+CPA
Sbjct: 1454 IDVILPIALEVLLN-CGKNPPPGFKCPA 1480




Source: Arabidopsis thaliana

Species: Arabidopsis thaliana

Genus: Arabidopsis

Family: Brassicaceae

Order: Brassicales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|297835204|ref|XP_002885484.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297331324|gb|EFH61743.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|15022163|gb|AAC49600.2| putative proline-rich protein [Solanum palustre] Back     alignment and taxonomy information
>gi|359475712|ref|XP_003631735.1| PREDICTED: uncharacterized protein LOC100233114 [Vitis vinifera] Back     alignment and taxonomy information
>gi|449456667|ref|XP_004146070.1| PREDICTED: uncharacterized protein LOC101218239 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449518449|ref|XP_004166254.1| PREDICTED: 36.4 kDa proline-rich protein-like, partial [Cucumis sativus] Back     alignment and taxonomy information
>gi|118486411|gb|ABK95045.1| unknown [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224104875|ref|XP_002333889.1| predicted protein [Populus trichocarpa] gi|222838950|gb|EEE77301.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297804748|ref|XP_002870258.1| hypothetical protein ARALYDRAFT_493374 [Arabidopsis lyrata subsp. lyrata] gi|297316094|gb|EFH46517.1| hypothetical protein ARALYDRAFT_493374 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|224086363|ref|XP_002307865.1| predicted protein [Populus trichocarpa] gi|222853841|gb|EEE91388.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query214
TAIR|locus:2090419334 CWLP "cell wall-plasma membran 0.401 0.257 0.719 5.5e-32
TAIR|locus:40107137671480 AT3G22142 "AT3G22142" [Arabido 0.401 0.058 0.693 7.9e-30
TAIR|locus:2203876297 AT1G62500 [Arabidopsis thalian 0.406 0.292 0.685 1.3e-29
TAIR|locus:2041927291 AT2G10940 [Arabidopsis thalian 0.387 0.285 0.658 2.2e-27
TAIR|locus:2135595161 AZI1 "azelaic acid induced 1" 0.392 0.521 0.588 1.8e-23
TAIR|locus:2135610168 EARLI1 "EARLY ARABIDOPSIS ALUM 0.387 0.494 0.595 3.8e-23
TAIR|locus:2135625182 AT4G12490 [Arabidopsis thalian 0.387 0.456 0.595 4.8e-23
TAIR|locus:2135635177 AT4G12500 [Arabidopsis thalian 0.387 0.468 0.583 7.8e-23
TAIR|locus:2050901134 AT2G45180 [Arabidopsis thalian 0.387 0.619 0.588 7e-22
TAIR|locus:2203886149 AT1G62510 [Arabidopsis thalian 0.387 0.557 0.571 7e-22
TAIR|locus:2090419 CWLP "cell wall-plasma membrane linker protein" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 332 (121.9 bits), Expect = 5.5e-32, Sum P(2) = 5.5e-32
 Identities = 64/89 (71%), Positives = 77/89 (86%)

Query:   127 QTCPIDALKLGACVDVLGGLIHIGLGDS-AKEKCCPLLQGLADLDAAVCLCTAIRLKALN 185
             +TCPID LKLGACVDVLGGLIHIGLG S AK +CCP+L GL DLDAAVCLCT I+LK LN
Sbjct:   248 ETCPIDTLKLGACVDVLGGLIHIGLGKSHAKAECCPVLGGLLDLDAAVCLCTTIKLKLLN 307

Query:   186 LINLLVPISLQVLVNDCGKYPPAGFQCPA 214
              I+L++PI+L++L+ DCGK PP+ F+CPA
Sbjct:   308 -IDLVLPIALELLL-DCGKTPPSDFKCPA 334


GO:0006869 "lipid transport" evidence=IEA;ISS
GO:0008289 "lipid binding" evidence=ISS
GO:0006944 "cellular membrane fusion" evidence=RCA
GO:0009556 "microsporogenesis" evidence=RCA
GO:0052543 "callose deposition in cell wall" evidence=RCA
TAIR|locus:4010713767 AT3G22142 "AT3G22142" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2203876 AT1G62500 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2041927 AT2G10940 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2135595 AZI1 "azelaic acid induced 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2135610 EARLI1 "EARLY ARABIDOPSIS ALUMINUM INDUCED 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2135625 AT4G12490 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2135635 AT4G12500 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2050901 AT2G45180 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2203886 AT1G62510 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query214
cd0195885 cd01958, HPS_like, HPS_like: Hydrophobic Protein f 1e-28
PRK14951618 PRK14951, PRK14951, DNA polymerase III subunits ga 3e-12
PRK14950585 PRK14950, PRK14950, DNA polymerase III subunits ga 3e-11
PRK12270 1228 PRK12270, kgd, alpha-ketoglutarate decarboxylase; 4e-11
PHA032473151 PHA03247, PHA03247, large tegument protein UL36; P 2e-10
PRK14951618 PRK14951, PRK14951, DNA polymerase III subunits ga 3e-10
PRK12270 1228 PRK12270, kgd, alpha-ketoglutarate decarboxylase; 3e-10
pfam0023474 pfam00234, Tryp_alpha_amyl, Protease inhibitor/see 3e-10
pfam04652315 pfam04652, DUF605, Vta1 like 5e-10
PRK12270 1228 PRK12270, kgd, alpha-ketoglutarate decarboxylase; 2e-09
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 3e-09
PRK12270 1228 PRK12270, kgd, alpha-ketoglutarate decarboxylase; 4e-09
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 6e-09
pfam04652315 pfam04652, DUF605, Vta1 like 6e-09
PRK14948620 PRK14948, PRK14948, DNA polymerase III subunits ga 8e-09
PRK14950585 PRK14950, PRK14950, DNA polymerase III subunits ga 1e-08
pfam04652315 pfam04652, DUF605, Vta1 like 1e-08
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 2e-08
PRK14948620 PRK14948, PRK14948, DNA polymerase III subunits ga 2e-08
pfam09770 804 pfam09770, PAT1, Topoisomerase II-associated prote 3e-08
PRK14948620 PRK14948, PRK14948, DNA polymerase III subunits ga 4e-08
PRK12323 700 PRK12323, PRK12323, DNA polymerase III subunits ga 4e-08
PRK14971614 PRK14971, PRK14971, DNA polymerase III subunits ga 6e-08
pfam04652315 pfam04652, DUF605, Vta1 like 7e-08
pfam09770 804 pfam09770, PAT1, Topoisomerase II-associated prote 8e-08
PRK12270 1228 PRK12270, kgd, alpha-ketoglutarate decarboxylase; 1e-07
PHA032473151 PHA03247, PHA03247, large tegument protein UL36; P 1e-07
PRK07764 824 PRK07764, PRK07764, DNA polymerase III subunits ga 1e-07
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 2e-07
PRK14948620 PRK14948, PRK14948, DNA polymerase III subunits ga 2e-07
PRK14954620 PRK14954, PRK14954, DNA polymerase III subunits ga 2e-07
PRK07764 824 PRK07764, PRK07764, DNA polymerase III subunits ga 3e-07
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 4e-07
PRK14948620 PRK14948, PRK14948, DNA polymerase III subunits ga 4e-07
PRK14971614 PRK14971, PRK14971, DNA polymerase III subunits ga 6e-07
PRK07994 647 PRK07994, PRK07994, DNA polymerase III subunits ga 6e-07
pfam04652315 pfam04652, DUF605, Vta1 like 7e-07
PRK14965576 PRK14965, PRK14965, DNA polymerase III subunits ga 7e-07
PRK07764 824 PRK07764, PRK07764, DNA polymerase III subunits ga 8e-07
PRK12270 1228 PRK12270, kgd, alpha-ketoglutarate decarboxylase; 1e-06
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 1e-06
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 1e-06
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 1e-06
PHA032473151 PHA03247, PHA03247, large tegument protein UL36; P 1e-06
PRK14948620 PRK14948, PRK14948, DNA polymerase III subunits ga 1e-06
PRK07764 824 PRK07764, PRK07764, DNA polymerase III subunits ga 1e-06
PRK07994647 PRK07994, PRK07994, DNA polymerase III subunits ga 1e-06
PTZ00144 418 PTZ00144, PTZ00144, dihydrolipoamide succinyltrans 1e-06
pfam05518753 pfam05518, Totivirus_coat, Totivirus coat protein 1e-06
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 2e-06
pfam04652315 pfam04652, DUF605, Vta1 like 2e-06
PRK14948620 PRK14948, PRK14948, DNA polymerase III subunits ga 2e-06
PRK14948620 PRK14948, PRK14948, DNA polymerase III subunits ga 2e-06
PRK14948620 PRK14948, PRK14948, DNA polymerase III subunits ga 2e-06
PRK12323 700 PRK12323, PRK12323, DNA polymerase III subunits ga 2e-06
PRK14950585 PRK14950, PRK14950, DNA polymerase III subunits ga 3e-06
PRK12323700 PRK12323, PRK12323, DNA polymerase III subunits ga 3e-06
PRK07764 824 PRK07764, PRK07764, DNA polymerase III subunits ga 3e-06
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 4e-06
PRK06995 484 PRK06995, flhF, flagellar biosynthesis regulator F 4e-06
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 6e-06
PRK14086 617 PRK14086, dnaA, chromosomal replication initiation 6e-06
PRK03427333 PRK03427, PRK03427, cell division protein ZipA; Pr 6e-06
PRK14954620 PRK14954, PRK14954, DNA polymerase III subunits ga 8e-06
PRK14954620 PRK14954, PRK14954, DNA polymerase III subunits ga 8e-06
PRK12270 1228 PRK12270, kgd, alpha-ketoglutarate decarboxylase; 1e-05
pfam09770 804 pfam09770, PAT1, Topoisomerase II-associated prote 1e-05
pfam02993238 pfam02993, MCPVI, Minor capsid protein VI 1e-05
PRK11633226 PRK11633, PRK11633, cell division protein DedD; Pr 1e-05
PHA03307 1352 PHA03307, PHA03307, transcriptional regulator ICP4 1e-05
PRK07003 830 PRK07003, PRK07003, DNA polymerase III subunits ga 1e-05
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 2e-05
PRK15313 955 PRK15313, PRK15313, autotransport protein MisL; Pr 2e-05
PRK01297 475 PRK01297, PRK01297, ATP-dependent RNA helicase Rhl 2e-05
PRK14948620 PRK14948, PRK14948, DNA polymerase III subunits ga 3e-05
PRK14948620 PRK14948, PRK14948, DNA polymerase III subunits ga 3e-05
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 3e-05
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 3e-05
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 3e-05
PRK14965576 PRK14965, PRK14965, DNA polymerase III subunits ga 3e-05
PTZ00144 418 PTZ00144, PTZ00144, dihydrolipoamide succinyltrans 3e-05
PRK01297 475 PRK01297, PRK01297, ATP-dependent RNA helicase Rhl 3e-05
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 4e-05
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 4e-05
pfam05518753 pfam05518, Totivirus_coat, Totivirus coat protein 4e-05
PRK14948620 PRK14948, PRK14948, DNA polymerase III subunits ga 5e-05
PRK14948 620 PRK14948, PRK14948, DNA polymerase III subunits ga 5e-05
PRK07994647 PRK07994, PRK07994, DNA polymerase III subunits ga 5e-05
PRK11633226 PRK11633, PRK11633, cell division protein DedD; Pr 5e-05
PRK09111598 PRK09111, PRK09111, DNA polymerase III subunits ga 5e-05
pfam09770 804 pfam09770, PAT1, Topoisomerase II-associated prote 6e-05
pfam09770 804 pfam09770, PAT1, Topoisomerase II-associated prote 6e-05
PTZ00144 418 PTZ00144, PTZ00144, dihydrolipoamide succinyltrans 6e-05
PTZ00144 418 PTZ00144, PTZ00144, dihydrolipoamide succinyltrans 6e-05
PHA03307 1352 PHA03307, PHA03307, transcriptional regulator ICP4 6e-05
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 7e-05
PRK14948620 PRK14948, PRK14948, DNA polymerase III subunits ga 7e-05
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 8e-05
PRK09111598 PRK09111, PRK09111, DNA polymerase III subunits ga 8e-05
PRK12323700 PRK12323, PRK12323, DNA polymerase III subunits ga 9e-05
PRK14086 617 PRK14086, dnaA, chromosomal replication initiation 9e-05
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 1e-04
PRK14948620 PRK14948, PRK14948, DNA polymerase III subunits ga 1e-04
PRK12323700 PRK12323, PRK12323, DNA polymerase III subunits ga 1e-04
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 1e-04
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 1e-04
PRK14965576 PRK14965, PRK14965, DNA polymerase III subunits ga 1e-04
pfam13388422 pfam13388, DUF4106, Protein of unknown function (D 1e-04
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 2e-04
PRK12323700 PRK12323, PRK12323, DNA polymerase III subunits ga 2e-04
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 2e-04
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 2e-04
PRK07764 824 PRK07764, PRK07764, DNA polymerase III subunits ga 2e-04
PRK09111598 PRK09111, PRK09111, DNA polymerase III subunits ga 2e-04
PRK09111598 PRK09111, PRK09111, DNA polymerase III subunits ga 2e-04
PRK12323700 PRK12323, PRK12323, DNA polymerase III subunits ga 3e-04
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 3e-04
PRK11633226 PRK11633, PRK11633, cell division protein DedD; Pr 3e-04
PHA03307 1352 PHA03307, PHA03307, transcriptional regulator ICP4 3e-04
PHA03307 1352 PHA03307, PHA03307, transcriptional regulator ICP4 3e-04
PRK06975 656 PRK06975, PRK06975, bifunctional uroporphyrinogen- 3e-04
pfam07174297 pfam07174, FAP, Fibronectin-attachment protein (FA 3e-04
TIGR027841135 TIGR02784, addA_alphas, double-strand break repair 3e-04
PRK07994 647 PRK07994, PRK07994, DNA polymerase III subunits ga 4e-04
PRK07994647 PRK07994, PRK07994, DNA polymerase III subunits ga 4e-04
pfam05518753 pfam05518, Totivirus_coat, Totivirus coat protein 4e-04
PRK06995 484 PRK06995, flhF, flagellar biosynthesis regulator F 4e-04
pfam13388422 pfam13388, DUF4106, Protein of unknown function (D 4e-04
PRK06975 656 PRK06975, PRK06975, bifunctional uroporphyrinogen- 4e-04
COG0810244 COG0810, TonB, Periplasmic protein TonB, links inn 4e-04
COG0810244 COG0810, TonB, Periplasmic protein TonB, links inn 4e-04
PRK00095 617 PRK00095, mutL, DNA mismatch repair protein; Revie 4e-04
PTZ00449 943 PTZ00449, PTZ00449, 104 kDa microneme/rhoptry anti 4e-04
PLN02983274 PLN02983, PLN02983, biotin carboxyl carrier protei 4e-04
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 5e-04
PRK13042291 PRK13042, PRK13042, superantigen-like protein; Rev 5e-04
pfam03153332 pfam03153, TFIIA, Transcription factor IIA, alpha/ 5e-04
TIGR02927 579 TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogena 5e-04
pfam04652315 pfam04652, DUF605, Vta1 like 6e-04
PRK03427333 PRK03427, PRK03427, cell division protein ZipA; Pr 6e-04
PRK09111598 PRK09111, PRK09111, DNA polymerase III subunits ga 6e-04
pfam03276 582 pfam03276, Gag_spuma, Spumavirus gag protein 6e-04
PHA03369 663 PHA03369, PHA03369, capsid maturational protease; 6e-04
PRK11892 464 PRK11892, PRK11892, pyruvate dehydrogenase subunit 6e-04
PRK14948 620 PRK14948, PRK14948, DNA polymerase III subunits ga 7e-04
PRK14086 617 PRK14086, dnaA, chromosomal replication initiation 7e-04
PLN02258 590 PLN02258, PLN02258, 9-cis-epoxycarotenoid dioxygen 7e-04
PRK07994 647 PRK07994, PRK07994, DNA polymerase III subunits ga 8e-04
PRK14963504 PRK14963, PRK14963, DNA polymerase III subunits ga 8e-04
COG5178 2365 COG5178, PRP8, U5 snRNP spliceosome subunit [RNA p 8e-04
PRK13042 291 PRK13042, PRK13042, superantigen-like protein; Rev 9e-04
PRK11892 464 PRK11892, PRK11892, pyruvate dehydrogenase subunit 9e-04
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 0.001
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 0.001
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 0.001
PTZ00144 418 PTZ00144, PTZ00144, dihydrolipoamide succinyltrans 0.001
pfam05518753 pfam05518, Totivirus_coat, Totivirus coat protein 0.001
PHA03307 1352 PHA03307, PHA03307, transcriptional regulator ICP4 0.001
PRK07003 830 PRK07003, PRK07003, DNA polymerase III subunits ga 0.001
PRK15313 955 PRK15313, PRK15313, autotransport protein MisL; Pr 0.001
PRK01297 475 PRK01297, PRK01297, ATP-dependent RNA helicase Rhl 0.001
PLN02983274 PLN02983, PLN02983, biotin carboxyl carrier protei 0.001
PRK11892 464 PRK11892, PRK11892, pyruvate dehydrogenase subunit 0.001
PRK11892 464 PRK11892, PRK11892, pyruvate dehydrogenase subunit 0.001
PLN02258 590 PLN02258, PLN02258, 9-cis-epoxycarotenoid dioxygen 0.001
PLN02258 590 PLN02258, PLN02258, 9-cis-epoxycarotenoid dioxygen 0.001
PRK14963504 PRK14963, PRK14963, DNA polymerase III subunits ga 0.001
COG5178 2365 COG5178, PRP8, U5 snRNP spliceosome subunit [RNA p 0.001
pfam10152147 pfam10152, DUF2360, Predicted coiled-coil domain-c 0.001
pfam04929381 pfam04929, Herpes_DNAp_acc, Herpes DNA replication 0.001
PLN03209576 PLN03209, PLN03209, translocon at the inner envelo 0.001
PRK09424509 PRK09424, pntA, NAD(P) transhydrogenase subunit al 0.001
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 0.002
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 0.002
PRK14965576 PRK14965, PRK14965, DNA polymerase III subunits ga 0.002
PRK11633226 PRK11633, PRK11633, cell division protein DedD; Pr 0.002
PHA03307 1352 PHA03307, PHA03307, transcriptional regulator ICP4 0.002
PRK07003 830 PRK07003, PRK07003, DNA polymerase III subunits ga 0.002
PRK01297 475 PRK01297, PRK01297, ATP-dependent RNA helicase Rhl 0.002
PRK01297 475 PRK01297, PRK01297, ATP-dependent RNA helicase Rhl 0.002
pfam13388422 pfam13388, DUF4106, Protein of unknown function (D 0.002
PRK06975 656 PRK06975, PRK06975, bifunctional uroporphyrinogen- 0.002
TIGR02927 579 TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogena 0.002
PRK11892 464 PRK11892, PRK11892, pyruvate dehydrogenase subunit 0.002
PRK14963504 PRK14963, PRK14963, DNA polymerase III subunits ga 0.002
COG5178 2365 COG5178, PRP8, U5 snRNP spliceosome subunit [RNA p 0.002
PRK10819246 PRK10819, PRK10819, transport protein TonB; Provis 0.002
PHA03378 991 PHA03378, PHA03378, EBNA-3B; Provisional 0.002
TIGR00601 378 TIGR00601, rad23, UV excision repair protein Rad23 0.002
PRK00404141 PRK00404, tatB, sec-independent translocase; Provi 0.002
COG5373 931 COG5373, COG5373, Predicted membrane protein [Func 0.002
PRK10856331 PRK10856, PRK10856, cytoskeletal protein RodZ; Pro 0.002
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 0.003
PHA03307 1352 PHA03307, PHA03307, transcriptional regulator ICP4 0.003
PHA03307 1352 PHA03307, PHA03307, transcriptional regulator ICP4 0.003
PRK15313 955 PRK15313, PRK15313, autotransport protein MisL; Pr 0.003
PRK06975 656 PRK06975, PRK06975, bifunctional uroporphyrinogen- 0.003
pfam07174297 pfam07174, FAP, Fibronectin-attachment protein (FA 0.003
COG0810244 COG0810, TonB, Periplasmic protein TonB, links inn 0.003
TIGR02927 579 TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogena 0.003
COG5373 931 COG5373, COG5373, Predicted membrane protein [Func 0.003
PRK14959624 PRK14959, PRK14959, DNA polymerase III subunits ga 0.003
PLN02769 629 PLN02769, PLN02769, Probable galacturonosyltransfe 0.003
TIGR01645 612 TIGR01645, half-pint, poly-U binding splicing fact 0.003
PRK12323700 PRK12323, PRK12323, DNA polymerase III subunits ga 0.004
PRK14971614 PRK14971, PRK14971, DNA polymerase III subunits ga 0.004
PRK07994647 PRK07994, PRK07994, DNA polymerase III subunits ga 0.004
PRK07003 830 PRK07003, PRK07003, DNA polymerase III subunits ga 0.004
COG0810244 COG0810, TonB, Periplasmic protein TonB, links inn 0.004
PLN02258 590 PLN02258, PLN02258, 9-cis-epoxycarotenoid dioxygen 0.004
PRK11855 547 PRK11855, PRK11855, dihydrolipoamide acetyltransfe 0.004
pfam01044850 pfam01044, Vinculin, Vinculin family 0.004
>gnl|CDD|238924 cd01958, HPS_like, HPS_like: Hydrophobic Protein from Soybean (HPS)-like subfamily; composed of proteins with similarity to HPS, a small hydrophobic protein with unknown function related to cereal-type alpha-amylase inhibitors and lipid transfer proteins Back     alignment and domain information
 Score =  102 bits (256), Expect = 1e-28
 Identities = 47/86 (54%), Positives = 60/86 (69%), Gaps = 2/86 (2%)

Query: 127 QTCPIDALKLGACVDVLGGLIHIGLGDSAKEKCCPLLQGLADLDAAVCLCTAIRLKALNL 186
            TCP DALKLG C +VLG  +   LG  A + CCPL+ GLADLDAAVCLCTAI+   L  
Sbjct: 2   PTCPRDALKLGVCANVLGLSLL-LLGTPAVQPCCPLIGGLADLDAAVCLCTAIKANILG- 59

Query: 187 INLLVPISLQVLVNDCGKYPPAGFQC 212
           I++ +P++L +L+N CG+  P GF C
Sbjct: 60  ISINIPVALSLLLNSCGRNVPPGFTC 85


In addition to HPS, members of this subfamily include a hybrid proline-rich protein (HyPRP) from maize, a dark-inducible protein (LeDI-2) from Lithospermum erythrorhizon, maize ZRP3 protein, and rice RcC3 protein. HyPRP is an embryo-specific protein that contains an N-terminal proline-rich domain and a C-terminal HPS-like cysteine-rich domain. It has been suggested that HyPRP may be involved in the stability and defense of the developing embryo. LeDI-2 is a root-specific protein that may be involved in regulating the biosynthesis of shikonin derivatives in L. erythrorhizon. Maize ZRP3 and rice RcC3 are root-specific proteins whose functions are yet to be determined. It has been reported that ZRP3 largely accumulates in a distinct subset of cortical cells. Length = 85

>gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|215810 pfam00234, Tryp_alpha_amyl, Protease inhibitor/seed storage/LTP family Back     alignment and domain information
>gnl|CDD|218191 pfam04652, DUF605, Vta1 like Back     alignment and domain information
>gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|218191 pfam04652, DUF605, Vta1 like Back     alignment and domain information
>gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|218191 pfam04652, DUF605, Vta1 like Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 Back     alignment and domain information
>gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237874 PRK14971, PRK14971, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|218191 pfam04652, DUF605, Vta1 like Back     alignment and domain information
>gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 Back     alignment and domain information
>gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|184918 PRK14954, PRK14954, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237874 PRK14971, PRK14971, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|218191 pfam04652, DUF605, Vta1 like Back     alignment and domain information
>gnl|CDD|237871 PRK14965, PRK14965, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|240289 PTZ00144, PTZ00144, dihydrolipoamide succinyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|218621 pfam05518, Totivirus_coat, Totivirus coat protein Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|218191 pfam04652, DUF605, Vta1 like Back     alignment and domain information
>gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|235904 PRK06995, flhF, flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|237605 PRK14086, dnaA, chromosomal replication initiation protein; Provisional Back     alignment and domain information
>gnl|CDD|235124 PRK03427, PRK03427, cell division protein ZipA; Provisional Back     alignment and domain information
>gnl|CDD|184918 PRK14954, PRK14954, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|184918 PRK14954, PRK14954, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 Back     alignment and domain information
>gnl|CDD|217310 pfam02993, MCPVI, Minor capsid protein VI Back     alignment and domain information
>gnl|CDD|236940 PRK11633, PRK11633, cell division protein DedD; Provisional Back     alignment and domain information
>gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional Back     alignment and domain information
>gnl|CDD|235906 PRK07003, PRK07003, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|237940 PRK15313, PRK15313, autotransport protein MisL; Provisional Back     alignment and domain information
>gnl|CDD|234938 PRK01297, PRK01297, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|237871 PRK14965, PRK14965, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|240289 PTZ00144, PTZ00144, dihydrolipoamide succinyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|234938 PRK01297, PRK01297, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|218621 pfam05518, Totivirus_coat, Totivirus coat protein Back     alignment and domain information
>gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|236940 PRK11633, PRK11633, cell division protein DedD; Provisional Back     alignment and domain information
>gnl|CDD|236382 PRK09111, PRK09111, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 Back     alignment and domain information
>gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 Back     alignment and domain information
>gnl|CDD|240289 PTZ00144, PTZ00144, dihydrolipoamide succinyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|240289 PTZ00144, PTZ00144, dihydrolipoamide succinyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|236382 PRK09111, PRK09111, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237605 PRK14086, dnaA, chromosomal replication initiation protein; Provisional Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|237871 PRK14965, PRK14965, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|222095 pfam13388, DUF4106, Protein of unknown function (DUF4106) Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|236382 PRK09111, PRK09111, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|236382 PRK09111, PRK09111, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|236940 PRK11633, PRK11633, cell division protein DedD; Provisional Back     alignment and domain information
>gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional Back     alignment and domain information
>gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional Back     alignment and domain information
>gnl|CDD|235899 PRK06975, PRK06975, bifunctional uroporphyrinogen-III synthetase/uroporphyrin-III C-methyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|219321 pfam07174, FAP, Fibronectin-attachment protein (FAP) Back     alignment and domain information
>gnl|CDD|234012 TIGR02784, addA_alphas, double-strand break repair helicase AddA, alphaproteobacterial type Back     alignment and domain information
>gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|218621 pfam05518, Totivirus_coat, Totivirus coat protein Back     alignment and domain information
>gnl|CDD|235904 PRK06995, flhF, flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>gnl|CDD|222095 pfam13388, DUF4106, Protein of unknown function (DUF4106) Back     alignment and domain information
>gnl|CDD|235899 PRK06975, PRK06975, bifunctional uroporphyrinogen-III synthetase/uroporphyrin-III C-methyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|223880 COG0810, TonB, Periplasmic protein TonB, links inner and outer membranes [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|223880 COG0810, TonB, Periplasmic protein TonB, links inner and outer membranes [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|234630 PRK00095, mutL, DNA mismatch repair protein; Reviewed Back     alignment and domain information
>gnl|CDD|185628 PTZ00449, PTZ00449, 104 kDa microneme/rhoptry antigen; Provisional Back     alignment and domain information
>gnl|CDD|215533 PLN02983, PLN02983, biotin carboxyl carrier protein of acetyl-CoA carboxylase Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|183854 PRK13042, PRK13042, superantigen-like protein; Reviewed Back     alignment and domain information
>gnl|CDD|217392 pfam03153, TFIIA, Transcription factor IIA, alpha/beta subunit Back     alignment and domain information
>gnl|CDD|200219 TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase Back     alignment and domain information
>gnl|CDD|218191 pfam04652, DUF605, Vta1 like Back     alignment and domain information
>gnl|CDD|235124 PRK03427, PRK03427, cell division protein ZipA; Provisional Back     alignment and domain information
>gnl|CDD|236382 PRK09111, PRK09111, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|217469 pfam03276, Gag_spuma, Spumavirus gag protein Back     alignment and domain information
>gnl|CDD|223061 PHA03369, PHA03369, capsid maturational protease; Provisional Back     alignment and domain information
>gnl|CDD|237011 PRK11892, PRK11892, pyruvate dehydrogenase subunit beta; Provisional Back     alignment and domain information
>gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237605 PRK14086, dnaA, chromosomal replication initiation protein; Provisional Back     alignment and domain information
>gnl|CDD|215145 PLN02258, PLN02258, 9-cis-epoxycarotenoid dioxygenase NCED Back     alignment and domain information
>gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|184927 PRK14963, PRK14963, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|227505 COG5178, PRP8, U5 snRNP spliceosome subunit [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|183854 PRK13042, PRK13042, superantigen-like protein; Reviewed Back     alignment and domain information
>gnl|CDD|237011 PRK11892, PRK11892, pyruvate dehydrogenase subunit beta; Provisional Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|240289 PTZ00144, PTZ00144, dihydrolipoamide succinyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|218621 pfam05518, Totivirus_coat, Totivirus coat protein Back     alignment and domain information
>gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional Back     alignment and domain information
>gnl|CDD|235906 PRK07003, PRK07003, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|237940 PRK15313, PRK15313, autotransport protein MisL; Provisional Back     alignment and domain information
>gnl|CDD|234938 PRK01297, PRK01297, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|215533 PLN02983, PLN02983, biotin carboxyl carrier protein of acetyl-CoA carboxylase Back     alignment and domain information
>gnl|CDD|237011 PRK11892, PRK11892, pyruvate dehydrogenase subunit beta; Provisional Back     alignment and domain information
>gnl|CDD|237011 PRK11892, PRK11892, pyruvate dehydrogenase subunit beta; Provisional Back     alignment and domain information
>gnl|CDD|215145 PLN02258, PLN02258, 9-cis-epoxycarotenoid dioxygenase NCED Back     alignment and domain information
>gnl|CDD|215145 PLN02258, PLN02258, 9-cis-epoxycarotenoid dioxygenase NCED Back     alignment and domain information
>gnl|CDD|184927 PRK14963, PRK14963, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|227505 COG5178, PRP8, U5 snRNP spliceosome subunit [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|220603 pfam10152, DUF2360, Predicted coiled-coil domain-containing protein (DUF2360) Back     alignment and domain information
>gnl|CDD|218332 pfam04929, Herpes_DNAp_acc, Herpes DNA replication accessory factor Back     alignment and domain information
>gnl|CDD|178748 PLN03209, PLN03209, translocon at the inner envelope of chloroplast subunit 62; Provisional Back     alignment and domain information
>gnl|CDD|236507 PRK09424, pntA, NAD(P) transhydrogenase subunit alpha; Provisional Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|237871 PRK14965, PRK14965, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|236940 PRK11633, PRK11633, cell division protein DedD; Provisional Back     alignment and domain information
>gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional Back     alignment and domain information
>gnl|CDD|235906 PRK07003, PRK07003, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|234938 PRK01297, PRK01297, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|234938 PRK01297, PRK01297, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|222095 pfam13388, DUF4106, Protein of unknown function (DUF4106) Back     alignment and domain information
>gnl|CDD|235899 PRK06975, PRK06975, bifunctional uroporphyrinogen-III synthetase/uroporphyrin-III C-methyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|200219 TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase Back     alignment and domain information
>gnl|CDD|237011 PRK11892, PRK11892, pyruvate dehydrogenase subunit beta; Provisional Back     alignment and domain information
>gnl|CDD|184927 PRK14963, PRK14963, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|227505 COG5178, PRP8, U5 snRNP spliceosome subunit [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|236768 PRK10819, PRK10819, transport protein TonB; Provisional Back     alignment and domain information
>gnl|CDD|223065 PHA03378, PHA03378, EBNA-3B; Provisional Back     alignment and domain information
>gnl|CDD|233045 TIGR00601, rad23, UV excision repair protein Rad23 Back     alignment and domain information
>gnl|CDD|166942 PRK00404, tatB, sec-independent translocase; Provisional Back     alignment and domain information
>gnl|CDD|227665 COG5373, COG5373, Predicted membrane protein [Function unknown] Back     alignment and domain information
>gnl|CDD|236776 PRK10856, PRK10856, cytoskeletal protein RodZ; Provisional Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional Back     alignment and domain information
>gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional Back     alignment and domain information
>gnl|CDD|237940 PRK15313, PRK15313, autotransport protein MisL; Provisional Back     alignment and domain information
>gnl|CDD|235899 PRK06975, PRK06975, bifunctional uroporphyrinogen-III synthetase/uroporphyrin-III C-methyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|219321 pfam07174, FAP, Fibronectin-attachment protein (FAP) Back     alignment and domain information
>gnl|CDD|223880 COG0810, TonB, Periplasmic protein TonB, links inner and outer membranes [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|200219 TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase Back     alignment and domain information
>gnl|CDD|227665 COG5373, COG5373, Predicted membrane protein [Function unknown] Back     alignment and domain information
>gnl|CDD|184923 PRK14959, PRK14959, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|215412 PLN02769, PLN02769, Probable galacturonosyltransferase Back     alignment and domain information
>gnl|CDD|130706 TIGR01645, half-pint, poly-U binding splicing factor, half-pint family Back     alignment and domain information
>gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237874 PRK14971, PRK14971, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|235906 PRK07003, PRK07003, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|223880 COG0810, TonB, Periplasmic protein TonB, links inner and outer membranes [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|215145 PLN02258, PLN02258, 9-cis-epoxycarotenoid dioxygenase NCED Back     alignment and domain information
>gnl|CDD|237000 PRK11855, PRK11855, dihydrolipoamide acetyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|216263 pfam01044, Vinculin, Vinculin family Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 214
PF1454785 Hydrophob_seed: Hydrophobic seed protein 100.0
cd0195885 HPS_like HPS_like: Hydrophobic Protein from Soybea 100.0
smart0049979 AAI Plant lipid transfer protein / seed storage pr 97.22
cd0466073 nsLTP_like nsLTP_like: Non-specific lipid-transfer 96.76
PF1436896 LTP_2: Probable lipid transfer; PDB: 2RKN_A 1N89_A 96.36
cd0001063 AAI_LTSS AAI_LTSS: Alpha-Amylase Inhibitors (AAI), 95.78
cd0195966 nsLTP2 nsLTP2: Non-specific lipid-transfer protein 95.72
PF0023490 Tryp_alpha_amyl: Protease inhibitor/seed storage/L 95.1
PF0455458 Extensin_2: Extensin-like region; InterPro: IPR006 93.48
cd0196089 nsLTP1 nsLTP1: Non-specific lipid-transfer protein 92.48
PF0455458 Extensin_2: Extensin-like region; InterPro: IPR006 90.43
>PF14547 Hydrophob_seed: Hydrophobic seed protein Back     alignment and domain information
Probab=100.00  E-value=1.3e-35  Score=225.43  Aligned_cols=85  Identities=58%  Similarity=1.189  Sum_probs=83.2

Q ss_pred             CCCccccCccccccccccccccccCCCCCCCCchhhhccccccchhhhhHHHhhhhccccccccchhhHHHhhhcCCCCC
Q 028062          128 TCPIDALKLGACVDVLGGLIHIGLGDSAKEKCCPLLQGLADLDAAVCLCTAIRLKALNLINLLVPISLQVLVNDCGKYPP  207 (214)
Q Consensus       128 tCP~DaLKLgvCanVLgGLv~~~lG~P~~~pCCpLI~GLaDldAAvCLCtAIKAnVLGlInlniPi~L~lLLN~CGK~~P  207 (214)
                      +||+|++|||+|+||| ||+++.+|.+.+++||++|+||+|+|||+|||+|+|+|+||+||+|+|+++++|+|.|||++|
T Consensus         1 ~CP~d~lkLgvC~~vL-~l~~~~~g~~~~~~CC~li~gL~d~~AA~CLC~aika~vlg~i~~~ipv~l~~lln~CGk~~p   79 (85)
T PF14547_consen    1 TCPRDALKLGVCANVL-GLVNLVIGNPPRQPCCSLIAGLADLDAAVCLCTAIKANVLGLINVNIPVALNLLLNACGKTVP   79 (85)
T ss_pred             CCCCcchhhhhhhhhh-hhhccccCCCCCCCcChHHhCcccchHHHHHHHHHhhhcccccccccccHHHHHHHHhCCcCc
Confidence            6999999999999999 799999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCcCC
Q 028062          208 AGFQCP  213 (214)
Q Consensus       208 ~GF~C~  213 (214)
                      +||+|+
T Consensus        80 ~gf~C~   85 (85)
T PF14547_consen   80 SGFTCP   85 (85)
T ss_pred             CCCcCC
Confidence            999996



>cd01958 HPS_like HPS_like: Hydrophobic Protein from Soybean (HPS)-like subfamily; composed of proteins with similarity to HPS, a small hydrophobic protein with unknown function related to cereal-type alpha-amylase inhibitors and lipid transfer proteins Back     alignment and domain information
>smart00499 AAI Plant lipid transfer protein / seed storage protein / trypsin-alpha amylase inhibitor domain family Back     alignment and domain information
>cd04660 nsLTP_like nsLTP_like: Non-specific lipid-transfer protein (nsLTP)-like subfamily; composed of predominantly uncharacterized proteins with similarity to nsLTPs, including Medicago truncatula MtN5, the root-specific Phaseolus vulgaris PVR3, Antirrhinum majus FIL1, and Lilium longiflorum LIM3 Back     alignment and domain information
>PF14368 LTP_2: Probable lipid transfer; PDB: 2RKN_A 1N89_A 1TUK_A Back     alignment and domain information
>cd00010 AAI_LTSS AAI_LTSS: Alpha-Amylase Inhibitors (AAI), Lipid Transfer (LT) and Seed Storage (SS) Protein family; a protein family unique to higher plants that includes cereal-type alpha-amylase inhibitors, lipid transfer proteins, seed storage proteins, and similar proteins Back     alignment and domain information
>cd01959 nsLTP2 nsLTP2: Non-specific lipid-transfer protein type 2 (nsLTP2) subfamily; Plant nsLTPs are small, soluble proteins that facilitate the transfer of fatty acids, phospholipids, glycolipids, and steroids between membranes Back     alignment and domain information
>PF00234 Tryp_alpha_amyl: Protease inhibitor/seed storage/LTP family This is a small subfamily; InterPro: IPR003612 This domain is found is several proteins, including plant lipid transfer proteins [], seed storage proteins [] and trypsin-alpha amylase inhibitors [, ] Back     alignment and domain information
>PF04554 Extensin_2: Extensin-like region; InterPro: IPR006706 Extensins are homologous hydroxyproline-rich glycoproteins (HRGPs) found in the plant extracellular matrix Back     alignment and domain information
>cd01960 nsLTP1 nsLTP1: Non-specific lipid-transfer protein type 1 (nsLTP1) subfamily; Plant nsLTPs are small, soluble proteins that facilitate the transfer of fatty acids, phospholipids, glycolipids, and steroids between membranes Back     alignment and domain information
>PF04554 Extensin_2: Extensin-like region; InterPro: IPR006706 Extensins are homologous hydroxyproline-rich glycoproteins (HRGPs) found in the plant extracellular matrix Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query214
1hyp_A80 Crystal Structure Of Hydrophobic Protein From Soybe 8e-07
>pdb|1HYP|A Chain A, Crystal Structure Of Hydrophobic Protein From Soybean; A Member Of A New Cystine-Rich Family Length = 80 Back     alignment and structure

Iteration: 1

Score = 50.1 bits (118), Expect = 8e-07, Method: Compositional matrix adjust. Identities = 32/89 (35%), Positives = 52/89 (58%), Gaps = 14/89 (15%) Query: 125 KQQTCPIDALKLGACVDVLGGLIHIGLGDSAKEKCCPLLQGLADLDAAVCLCTAIRLKAL 184 + +CP L C+++LGG + + CC L+ GL D++A VCLC I+L+AL Sbjct: 4 TRPSCP----DLSICLNILGGSL------GTVDDCCALIGGLGDIEAIVCLC--IQLRAL 51 Query: 185 NLINLLVPISLQVLVNDCGKYPPAGFQCP 213 ++NL +LQ+++N CG+ P+ CP Sbjct: 52 GILNL--NRNLQLILNSCGRSYPSNATCP 78

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query214
1hyp_A80 Hydrophobic protein from soybean; hydrophobic SEED 3e-20
3gdb_A 937 Endo-D, putative uncharacterized protein SPR0440; 1e-11
3gdb_A 937 Endo-D, putative uncharacterized protein SPR0440; 1e-10
3gdb_A 937 Endo-D, putative uncharacterized protein SPR0440; 2e-10
3gdb_A 937 Endo-D, putative uncharacterized protein SPR0440; 4e-10
3gdb_A 937 Endo-D, putative uncharacterized protein SPR0440; 1e-07
3gdb_A 937 Endo-D, putative uncharacterized protein SPR0440; 2e-06
3gdb_A 937 Endo-D, putative uncharacterized protein SPR0440; 3e-06
3gdb_A 937 Endo-D, putative uncharacterized protein SPR0440; 4e-04
3nwa_A 703 GB, GB-1, GB1, envelope glycoprotein B; coiled-coi 5e-10
3nwa_A 703 GB, GB-1, GB1, envelope glycoprotein B; coiled-coi 3e-05
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 1e-09
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 2e-08
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 2e-08
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 2e-08
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 2e-08
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 9e-08
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 1e-07
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 3e-05
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 6e-05
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 9e-05
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 2e-04
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 5e-04
3iox_A497 AGI/II, PA; alpha helix, PPII helix, supersandwich 2e-09
3iox_A497 AGI/II, PA; alpha helix, PPII helix, supersandwich 2e-09
3iox_A497 AGI/II, PA; alpha helix, PPII helix, supersandwich 7e-06
3iox_A497 AGI/II, PA; alpha helix, PPII helix, supersandwich 7e-05
3v1v_A 433 2-MIB synthase, 2-methylisoborneol synthase; class 2e-09
3v1v_A 433 2-MIB synthase, 2-methylisoborneol synthase; class 3e-08
3v1v_A 433 2-MIB synthase, 2-methylisoborneol synthase; class 8e-07
3v1v_A 433 2-MIB synthase, 2-methylisoborneol synthase; class 1e-05
3v1v_A 433 2-MIB synthase, 2-methylisoborneol synthase; class 2e-05
3v1v_A 433 2-MIB synthase, 2-methylisoborneol synthase; class 6e-05
1pk8_A 422 RAT synapsin I; ATP binding, ATP grAsp, calcium (I 1e-07
1pk8_A 422 RAT synapsin I; ATP binding, ATP grAsp, calcium (I 2e-05
1pk8_A 422 RAT synapsin I; ATP binding, ATP grAsp, calcium (I 4e-05
3dzy_A 467 Retinoic acid receptor RXR-alpha; DNA-binding, HOS 8e-06
3dzy_A 467 Retinoic acid receptor RXR-alpha; DNA-binding, HOS 3e-05
3dzy_A 467 Retinoic acid receptor RXR-alpha; DNA-binding, HOS 1e-04
3dzy_A 467 Retinoic acid receptor RXR-alpha; DNA-binding, HOS 4e-04
2h8h_A 535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 1e-05
3dva_I 428 Dihydrolipoyllysine-residue acetyltransferase comp 2e-05
3dva_I 428 Dihydrolipoyllysine-residue acetyltransferase comp 5e-04
3dva_I 428 Dihydrolipoyllysine-residue acetyltransferase comp 6e-04
2z73_A448 Rhodopsin; visual pigment, GQ-type, G-protein coup 3e-05
2yew_A253 Capsid protein, coat protein; alphavirus, molecula 3e-05
2yew_A253 Capsid protein, coat protein; alphavirus, molecula 9e-05
2yew_A253 Capsid protein, coat protein; alphavirus, molecula 4e-04
2yew_A253 Capsid protein, coat protein; alphavirus, molecula 5e-04
2uv9_A 1878 Fatty acid synthase alpha subunits; fungal, dehydr 3e-05
2uv9_A 1878 Fatty acid synthase alpha subunits; fungal, dehydr 1e-04
2uv9_A 1878 Fatty acid synthase alpha subunits; fungal, dehydr 2e-04
2uv9_A 1878 Fatty acid synthase alpha subunits; fungal, dehydr 2e-04
2uv9_A 1878 Fatty acid synthase alpha subunits; fungal, dehydr 3e-04
2uv9_A 1878 Fatty acid synthase alpha subunits; fungal, dehydr 5e-04
2uv9_A 1878 Fatty acid synthase alpha subunits; fungal, dehydr 6e-04
2uv9_A 1878 Fatty acid synthase alpha subunits; fungal, dehydr 6e-04
2uv8_A 1887 Fatty acid synthase subunit alpha (FAS2); fatty ac 4e-05
2uv8_A 1887 Fatty acid synthase subunit alpha (FAS2); fatty ac 6e-05
2uv8_A 1887 Fatty acid synthase subunit alpha (FAS2); fatty ac 7e-05
2uv8_A 1887 Fatty acid synthase subunit alpha (FAS2); fatty ac 7e-05
2uv8_A 1887 Fatty acid synthase subunit alpha (FAS2); fatty ac 3e-04
2uv8_A 1887 Fatty acid synthase subunit alpha (FAS2); fatty ac 3e-04
2uv8_A 1887 Fatty acid synthase subunit alpha (FAS2); fatty ac 5e-04
2uv8_A 1887 Fatty acid synthase subunit alpha (FAS2); fatty ac 6e-04
2uv8_A 1887 Fatty acid synthase subunit alpha (FAS2); fatty ac 8e-04
2uv8_A 1887 Fatty acid synthase subunit alpha (FAS2); fatty ac 8e-04
2iut_A 574 DNA translocase FTSK; nucleotide-binding, chromoso 5e-05
2iut_A 574 DNA translocase FTSK; nucleotide-binding, chromoso 2e-04
1x9d_A 538 Endoplasmic reticulum mannosyl-oligosaccharide 1, 1e-04
1x9d_A 538 Endoplasmic reticulum mannosyl-oligosaccharide 1, 1e-04
1x9d_A 538 Endoplasmic reticulum mannosyl-oligosaccharide 1, 2e-04
1x9d_A 538 Endoplasmic reticulum mannosyl-oligosaccharide 1, 3e-04
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 1e-04
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 2e-04
2wvr_C 546 DNA replication factor CDT1; DNA replication licen 2e-04
2wvr_C 546 DNA replication factor CDT1; DNA replication licen 3e-04
2wvr_C 546 DNA replication factor CDT1; DNA replication licen 3e-04
3tx7_B 352 Nuclear receptor subfamily 5 group A member 2; LRH 2e-04
3a58_A320 Exocyst complex component SEC3; protein complex, P 4e-04
3a58_A320 Exocyst complex component SEC3; protein complex, P 5e-04
3a58_A320 Exocyst complex component SEC3; protein complex, P 5e-04
1deq_A390 Fibrinogen (alpha chain); coiled-coil, blood clott 4e-04
1deq_A390 Fibrinogen (alpha chain); coiled-coil, blood clott 7e-04
2wd6_A349 Agglutinin receptor; cell adhesion, secreted, V-re 5e-04
2wd6_A349 Agglutinin receptor; cell adhesion, secreted, V-re 7e-04
2wd6_A349 Agglutinin receptor; cell adhesion, secreted, V-re 8e-04
2es4_D 332 Lipase chaperone; protein-protein complex, steric 5e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 5e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 6e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 6e-04
2vg3_A284 Undecaprenyl pyrophosphate synthetase; transferase 7e-04
>1hyp_A Hydrophobic protein from soybean; hydrophobic SEED protein; 1.80A {Glycine max} SCOP: a.52.1.1 Length = 80 Back     alignment and structure
 Score = 80.3 bits (198), Expect = 3e-20
 Identities = 28/89 (31%), Positives = 47/89 (52%), Gaps = 14/89 (15%)

Query: 126 QQTCPIDALKLGACVDVLGGLIHIGLGDSAKEKCCPLLQGLADLDAAVCLCTAIRLKALN 185
           + +CP     L  C+++LGG +         + CC L+ GL D++A VCLC  +R   + 
Sbjct: 5   RPSCP----DLSICLNILGGSLG------TVDDCCALIGGLGDIEAIVCLCIQLRALGI- 53

Query: 186 LINLLVPISLQVLVNDCGKYPPAGFQCPA 214
              L +  +LQ+++N CG+  P+   CP 
Sbjct: 54  ---LNLNRNLQLILNSCGRSYPSNATCPR 79


>3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937 Back     alignment and structure
>3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937 Back     alignment and structure
>3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937 Back     alignment and structure
>3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937 Back     alignment and structure
>3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937 Back     alignment and structure
>3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937 Back     alignment and structure
>3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937 Back     alignment and structure
>3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937 Back     alignment and structure
>3nwa_A GB, GB-1, GB1, envelope glycoprotein B; coiled-coil, membrane fusion, viral P glycoprotein B, HSV-1, membrane; HET: NAG; 2.26A {Human herpesvirus 1} PDB: 3nwf_A* 3nw8_A* 3nwd_A* Length = 703 Back     alignment and structure
>3nwa_A GB, GB-1, GB1, envelope glycoprotein B; coiled-coil, membrane fusion, viral P glycoprotein B, HSV-1, membrane; HET: NAG; 2.26A {Human herpesvirus 1} PDB: 3nwf_A* 3nw8_A* 3nwd_A* Length = 703 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>3iox_A AGI/II, PA; alpha helix, PPII helix, supersandwich fold, surface adhesin WALL, peptidoglycan-anchor, cell adhesion; HET: PMS; 1.80A {Streptococcus mutans} PDB: 3ipk_A* 1jmm_A Length = 497 Back     alignment and structure
>3iox_A AGI/II, PA; alpha helix, PPII helix, supersandwich fold, surface adhesin WALL, peptidoglycan-anchor, cell adhesion; HET: PMS; 1.80A {Streptococcus mutans} PDB: 3ipk_A* 1jmm_A Length = 497 Back     alignment and structure
>3iox_A AGI/II, PA; alpha helix, PPII helix, supersandwich fold, surface adhesin WALL, peptidoglycan-anchor, cell adhesion; HET: PMS; 1.80A {Streptococcus mutans} PDB: 3ipk_A* 1jmm_A Length = 497 Back     alignment and structure
>3iox_A AGI/II, PA; alpha helix, PPII helix, supersandwich fold, surface adhesin WALL, peptidoglycan-anchor, cell adhesion; HET: PMS; 1.80A {Streptococcus mutans} PDB: 3ipk_A* 1jmm_A Length = 497 Back     alignment and structure
>3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 Back     alignment and structure
>3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 Back     alignment and structure
>3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 Back     alignment and structure
>3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 Back     alignment and structure
>3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 Back     alignment and structure
>3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 Back     alignment and structure
>1pk8_A RAT synapsin I; ATP binding, ATP grAsp, calcium (II) ION, membrane protein; HET: ATP; 2.10A {Rattus norvegicus} SCOP: c.30.1.5 d.142.1.3 PDB: 1px2_A* Length = 422 Back     alignment and structure
>1pk8_A RAT synapsin I; ATP binding, ATP grAsp, calcium (II) ION, membrane protein; HET: ATP; 2.10A {Rattus norvegicus} SCOP: c.30.1.5 d.142.1.3 PDB: 1px2_A* Length = 422 Back     alignment and structure
>1pk8_A RAT synapsin I; ATP binding, ATP grAsp, calcium (II) ION, membrane protein; HET: ATP; 2.10A {Rattus norvegicus} SCOP: c.30.1.5 d.142.1.3 PDB: 1px2_A* Length = 422 Back     alignment and structure
>3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 Back     alignment and structure
>3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 Back     alignment and structure
>3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 Back     alignment and structure
>3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Length = 535 Back     alignment and structure
>3dva_I Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; oxidoreductase, multienzyme complex; HET: TPW; 2.35A {Bacillus stearothermophilus} PDB: 3dv0_I* 3duf_I* 1b5s_A 1lab_A 1lac_A 1w3d_A Length = 428 Back     alignment and structure
>3dva_I Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; oxidoreductase, multienzyme complex; HET: TPW; 2.35A {Bacillus stearothermophilus} PDB: 3dv0_I* 3duf_I* 1b5s_A 1lab_A 1lac_A 1w3d_A Length = 428 Back     alignment and structure
>3dva_I Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; oxidoreductase, multienzyme complex; HET: TPW; 2.35A {Bacillus stearothermophilus} PDB: 3dv0_I* 3duf_I* 1b5s_A 1lab_A 1lac_A 1w3d_A Length = 428 Back     alignment and structure
>2z73_A Rhodopsin; visual pigment, GQ-type, G-protein coupled receptor, chromophore, glycoprotein, lipoprotein, membrane, palmitate phosphorylation; HET: BOG RET PLM TWT PC1; 2.50A {Todarodes pacificus} PDB: 3aym_A* 3ayn_A* 2ziy_A* Length = 448 Back     alignment and structure
>2yew_A Capsid protein, coat protein; alphavirus, molecular dynamics; 5.00A {Barmah forest virus} Length = 253 Back     alignment and structure
>2yew_A Capsid protein, coat protein; alphavirus, molecular dynamics; 5.00A {Barmah forest virus} Length = 253 Back     alignment and structure
>2yew_A Capsid protein, coat protein; alphavirus, molecular dynamics; 5.00A {Barmah forest virus} Length = 253 Back     alignment and structure
>2yew_A Capsid protein, coat protein; alphavirus, molecular dynamics; 5.00A {Barmah forest virus} Length = 253 Back     alignment and structure
>2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* Length = 1878 Back     alignment and structure
>2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* Length = 1878 Back     alignment and structure
>2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* Length = 1878 Back     alignment and structure
>2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* Length = 1878 Back     alignment and structure
>2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* Length = 1878 Back     alignment and structure
>2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* Length = 1878 Back     alignment and structure
>2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* Length = 1878 Back     alignment and structure
>2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* Length = 1878 Back     alignment and structure
>2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* Length = 1887 Back     alignment and structure
>2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* Length = 1887 Back     alignment and structure
>2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* Length = 1887 Back     alignment and structure
>2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* Length = 1887 Back     alignment and structure
>2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* Length = 1887 Back     alignment and structure
>2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* Length = 1887 Back     alignment and structure
>2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* Length = 1887 Back     alignment and structure
>2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* Length = 1887 Back     alignment and structure
>2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* Length = 1887 Back     alignment and structure
>2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* Length = 1887 Back     alignment and structure
>2iut_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- cell division, DNA translocation, KOPS, membrane; HET: DNA SAP; 2.25A {Pseudomonas aeruginosa} PDB: 2iuu_A* Length = 574 Back     alignment and structure
>2iut_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- cell division, DNA translocation, KOPS, membrane; HET: DNA SAP; 2.25A {Pseudomonas aeruginosa} PDB: 2iuu_A* Length = 574 Back     alignment and structure
>1x9d_A Endoplasmic reticulum mannosyl-oligosaccharide 1, 2-alpha-mannosidase; substrate analogue, glycosyl hydrolase; HET: SMD; 1.41A {Homo sapiens} SCOP: a.102.2.1 PDB: 1fo3_A* 1fo2_A* 1fmi_A Length = 538 Back     alignment and structure
>1x9d_A Endoplasmic reticulum mannosyl-oligosaccharide 1, 2-alpha-mannosidase; substrate analogue, glycosyl hydrolase; HET: SMD; 1.41A {Homo sapiens} SCOP: a.102.2.1 PDB: 1fo3_A* 1fo2_A* 1fmi_A Length = 538 Back     alignment and structure
>1x9d_A Endoplasmic reticulum mannosyl-oligosaccharide 1, 2-alpha-mannosidase; substrate analogue, glycosyl hydrolase; HET: SMD; 1.41A {Homo sapiens} SCOP: a.102.2.1 PDB: 1fo3_A* 1fo2_A* 1fmi_A Length = 538 Back     alignment and structure
>1x9d_A Endoplasmic reticulum mannosyl-oligosaccharide 1, 2-alpha-mannosidase; substrate analogue, glycosyl hydrolase; HET: SMD; 1.41A {Homo sapiens} SCOP: a.102.2.1 PDB: 1fo3_A* 1fo2_A* 1fmi_A Length = 538 Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Length = 681 Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Length = 681 Back     alignment and structure
>2wvr_C DNA replication factor CDT1; DNA replication license, DNA replication inhibitor, phosphoprotein, UBL conjugation, DNA-binding, polymorphism; HET: DNA; 3.30A {Homo sapiens} PDB: 2klo_A* Length = 546 Back     alignment and structure
>2wvr_C DNA replication factor CDT1; DNA replication license, DNA replication inhibitor, phosphoprotein, UBL conjugation, DNA-binding, polymorphism; HET: DNA; 3.30A {Homo sapiens} PDB: 2klo_A* Length = 546 Back     alignment and structure
>2wvr_C DNA replication factor CDT1; DNA replication license, DNA replication inhibitor, phosphoprotein, UBL conjugation, DNA-binding, polymorphism; HET: DNA; 3.30A {Homo sapiens} PDB: 2klo_A* Length = 546 Back     alignment and structure
>3tx7_B Nuclear receptor subfamily 5 group A member 2; LRH-1, beta-catenin, armadillo repeat, nuclear receptor LIGA binding domain, protein binding; HET: P6L; 2.76A {Homo sapiens} Length = 352 Back     alignment and structure
>3a58_A Exocyst complex component SEC3; protein complex, PH domain, GTPase, membrane traffic, coiled coil, exocytosis, phosphoprotein; HET: GNP; 2.60A {Saccharomyces cerevisiae} Length = 320 Back     alignment and structure
>3a58_A Exocyst complex component SEC3; protein complex, PH domain, GTPase, membrane traffic, coiled coil, exocytosis, phosphoprotein; HET: GNP; 2.60A {Saccharomyces cerevisiae} Length = 320 Back     alignment and structure
>3a58_A Exocyst complex component SEC3; protein complex, PH domain, GTPase, membrane traffic, coiled coil, exocytosis, phosphoprotein; HET: GNP; 2.60A {Saccharomyces cerevisiae} Length = 320 Back     alignment and structure
>2wd6_A Agglutinin receptor; cell adhesion, secreted, V-region, cell WALL, AG I/II protei surface adhesin, peptidoglycan-anchor; 2.30A {Streptococcus gordonii} Length = 349 Back     alignment and structure
>2wd6_A Agglutinin receptor; cell adhesion, secreted, V-region, cell WALL, AG I/II protei surface adhesin, peptidoglycan-anchor; 2.30A {Streptococcus gordonii} Length = 349 Back     alignment and structure
>2wd6_A Agglutinin receptor; cell adhesion, secreted, V-region, cell WALL, AG I/II protei surface adhesin, peptidoglycan-anchor; 2.30A {Streptococcus gordonii} Length = 349 Back     alignment and structure
>2es4_D Lipase chaperone; protein-protein complex, steric chaperone, triacylglycerol hydrolase, all alpha helix protein, A/B hydrolase fold; 1.85A {Burkholderia glumae} SCOP: a.137.15.1 Length = 332 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>2vg3_A Undecaprenyl pyrophosphate synthetase; transferase, cell WALL biogenesis/degradation, cell cycle, P transferase; HET: GPP; 1.8A {Mycobacterium tuberculosis} PDB: 2vg2_A* 2vg4_A Length = 284 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query214
1hyp_A80 Hydrophobic protein from soybean; hydrophobic SEED 99.96
1l6h_A69 LTP2, non-specific lipid transfer protein; NSLTP2, 96.26
1n89_A67 Lipid transfer protein; lipid transport; HET: PGM; 96.17
2rkn_A77 DIR1 protein, AT5G48485; LTP, defense signaling pr 95.62
2ljo_A93 Non-specific lipid-transfer protein 2; lipid trans 94.16
1siy_A91 LTP 1, NS-LTP1, nonspecific lipid-transfer protein 93.63
2alg_A92 Non-specific lipid transfer protein; LTP, NS-LTP, 93.09
1bwo_A90 NS-LTP1, nonspecific lipid-transfer protein; wheat 92.84
1afh_A93 Maize nonspecific lipid transfer protein; lipid-bi 92.72
1t12_A91 LTP 1, nonspecific lipid-transfer protein 1; cyste 91.33
>1hyp_A Hydrophobic protein from soybean; hydrophobic SEED protein; 1.80A {Glycine max} SCOP: a.52.1.1 Back     alignment and structure
Probab=99.96  E-value=2.6e-30  Score=194.46  Aligned_cols=75  Identities=43%  Similarity=1.021  Sum_probs=67.1

Q ss_pred             CCCCCccccCccccccccccccccccCCCCCCCCchhhhccccccchhhhhHHHhhhhccccccccchhhHHHhhhcCCC
Q 028062          126 QQTCPIDALKLGACVDVLGGLIHIGLGDSAKEKCCPLLQGLADLDAAVCLCTAIRLKALNLINLLVPISLQVLVNDCGKY  205 (214)
Q Consensus       126 ~~tCP~DaLKLgvCanVLgGLv~~~lG~P~~~pCCpLI~GLaDldAAvCLCtAIKAnVLGlInlniPi~L~lLLN~CGK~  205 (214)
                      .++||    |||+|+|||||++    |  .+++||++|+||+|+|||+|||||||  +|| | +|++++|++|+|.|||+
T Consensus         5 ~~~CP----kLgvCanvL~g~~----~--~~~~CC~Ll~GL~dleAAvCLCtaik--~Lg-i-lnlpv~L~llln~Cgk~   70 (80)
T 1hyp_A            5 RPSCP----DLSICLNILGGSL----G--TVDDCCALIGGLGDIEAIVCLCIQLR--ALG-I-LNLNRNLQLILNSCGRS   70 (80)
T ss_dssp             -CCSC----CCGGGGGGGGTCC----T--THHHHHHHHHTSCHHHHHHHHHHHHH--HHT-C-SCHHHHHHHHHHHTTCS
T ss_pred             CCCCC----chhHHHHHhCcCC----C--CCCccchhhhCcchhhhhhhhhhhcc--ccc-e-eecChhHHHHHHHhCCc
Confidence            46799    8999999998653    2  56789999999999999999999999  499 7 89999999999999999


Q ss_pred             CCCCCcCCC
Q 028062          206 PPAGFQCPA  214 (214)
Q Consensus       206 ~P~GF~C~~  214 (214)
                      +|+||+|+.
T Consensus        71 ~P~gF~C~~   79 (80)
T 1hyp_A           71 YPSNATCPR   79 (80)
T ss_dssp             SCCCCCCSC
T ss_pred             CcCCCCCCC
Confidence            999999974



>1l6h_A LTP2, non-specific lipid transfer protein; NSLTP2, plant LTP, lipid transport; NMR {Oryza sativa} SCOP: a.52.1.1 Back     alignment and structure
>1n89_A Lipid transfer protein; lipid transport; HET: PGM; NMR {Triticum turgidum subsp} SCOP: a.52.1.1 PDB: 1tuk_A* Back     alignment and structure
>2rkn_A DIR1 protein, AT5G48485; LTP, defense signaling protein, signaling protein, lipid TRA; HET: LP3; 1.60A {Arabidopsis thaliana} Back     alignment and structure
>2ljo_A Non-specific lipid-transfer protein 2; lipid transport; NMR {Lens culinaris} Back     alignment and structure
>1siy_A LTP 1, NS-LTP1, nonspecific lipid-transfer protein 1; alpha helix, lipid binding protein; NMR {Vigna radiata var} Back     alignment and structure
>2alg_A Non-specific lipid transfer protein; LTP, NS-LTP, FOOD allergen, lipid transport; HET: DAO P6G; 2.30A {Prunus persica} PDB: 2b5s_A* Back     alignment and structure
>1bwo_A NS-LTP1, nonspecific lipid-transfer protein; wheat, lipid binding, crystallography; HET: LPC; 2.10A {Triticum aestivum} SCOP: a.52.1.1 PDB: 1cz2_A* 1gh1_A 1be2_A* 1jtb_A* 1lip_A 1mid_A* 3cee_A* 3gsh_A* Back     alignment and structure
>1afh_A Maize nonspecific lipid transfer protein; lipid-binding protein, molecular modeling,; NMR {Zea mays} SCOP: a.52.1.1 PDB: 1fk0_A* 1fk1_A* 1fk2_A* 1fk3_A* 1fk4_A* 1fk5_A* 1fk6_A* 1fk7_A* 1mzl_A 1mzm_A* 1bv2_A 1rzl_A* 1uva_A* 1uvb_A* 1uvc_A* Back     alignment and structure
>1t12_A LTP 1, nonspecific lipid-transfer protein 1; cystein rich protein, lipid transport; NMR {Nicotiana tabacum} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 214
d1hypa_75 a.52.1.1 (A:) Soybean hydrophobic protein {Soybean 4e-23
d1hbxg_155 a.4.5.21 (G:) Serum response factor accessory prot 5e-04
>d1hypa_ a.52.1.1 (A:) Soybean hydrophobic protein {Soybean (Glycine max) [TaxId: 3847]} Length = 75 Back     information, alignment and structure

class: All alpha proteins
fold: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin
superfamily: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin
family: Plant lipid-transfer and hydrophobic proteins
domain: Soybean hydrophobic protein
species: Soybean (Glycine max) [TaxId: 3847]
 Score = 86.3 bits (214), Expect = 4e-23
 Identities = 28/87 (32%), Positives = 46/87 (52%), Gaps = 14/87 (16%)

Query: 128 TCPIDALKLGACVDVLGGLIHIGLGDSAKEKCCPLLQGLADLDAAVCLCTAIRLKALNLI 187
           +CP     L  C+++LGG +         + CC L+ GL D++A VCLC  +R   +   
Sbjct: 2   SCP----DLSICLNILGGSLG------TVDDCCALIGGLGDIEAIVCLCIQLRALGI--- 48

Query: 188 NLLVPISLQVLVNDCGKYPPAGFQCPA 214
            L +  +LQ+++N CG+  P+   CP 
Sbjct: 49  -LNLNRNLQLILNSCGRSYPSNATCPR 74


>d1hbxg_ a.4.5.21 (G:) Serum response factor accessory protein 1a, SAP-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 155 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query214
d1hypa_75 Soybean hydrophobic protein {Soybean (Glycine max) 99.96
d1fk5a_93 Plant non-specific lipid-transfer protein (ns-LTP, 95.3
d1mida_91 Plant non-specific lipid-transfer protein (ns-LTP, 93.88
d1tuka167 Non-specific lipid-transfer protein homologue (ns- 91.9
d1l6ha_69 Non-specific lipid-transfer protein homologue (ns- 89.49
>d1hypa_ a.52.1.1 (A:) Soybean hydrophobic protein {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
class: All alpha proteins
fold: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin
superfamily: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin
family: Plant lipid-transfer and hydrophobic proteins
domain: Soybean hydrophobic protein
species: Soybean (Glycine max) [TaxId: 3847]
Probab=99.96  E-value=9.4e-31  Score=193.16  Aligned_cols=74  Identities=39%  Similarity=0.949  Sum_probs=66.2

Q ss_pred             CCCCccccCccccccccccccccccCCCCCCCCchhhhccccccchhhhhHHHhhhhccccccccchhhHHHhhhcCCCC
Q 028062          127 QTCPIDALKLGACVDVLGGLIHIGLGDSAKEKCCPLLQGLADLDAAVCLCTAIRLKALNLINLLVPISLQVLVNDCGKYP  206 (214)
Q Consensus       127 ~tCP~DaLKLgvCanVLgGLv~~~lG~P~~~pCCpLI~GLaDldAAvCLCtAIKAnVLGlInlniPi~L~lLLN~CGK~~  206 (214)
                      .+||    |||+|+|||||+++      ..++||++|+||+|+|||+||||||||+  | | +|+||+|++|+|.|||++
T Consensus         1 PtCP----Klg~C~nvLg~~~~------~~~~CC~Ll~GL~dleAAvCLCtaika~--~-l-lnvpv~l~llln~Cgk~~   66 (75)
T d1hypa_           1 PSCP----DLSICLNILGGSLG------TVDDCCALIGGLGDIEAIVCLCIQLRAL--G-I-LNLNRNLQLILNSCGRSY   66 (75)
T ss_dssp             CCSC----CCGGGGGGGGTCCT------THHHHHHHHHTSCHHHHHHHHHHHHHHH--T-C-SCHHHHHHHHHHHTTCSS
T ss_pred             CCCC----chhhHHHHhcCccC------CCCCcchHHhhHHHHHHHHHHHHHHHHh--h-h-ccccchHHHHHHHcCCcC
Confidence            3799    89999999997753      4578999999999999999999999995  4 3 678899999999999999


Q ss_pred             CCCCcCCC
Q 028062          207 PAGFQCPA  214 (214)
Q Consensus       207 P~GF~C~~  214 (214)
                      |+||+|++
T Consensus        67 P~gF~CP~   74 (75)
T d1hypa_          67 PSNATCPR   74 (75)
T ss_dssp             CCCCCCSC
T ss_pred             cCCCcCCC
Confidence            99999975



>d1fk5a_ a.52.1.1 (A:) Plant non-specific lipid-transfer protein (ns-LTP, ns-LTP1) {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1mida_ a.52.1.1 (A:) Plant non-specific lipid-transfer protein (ns-LTP, ns-LTP1) {Barley (Hordeum vulgare) [TaxId: 4513]} Back     information, alignment and structure
>d1tuka1 a.52.1.1 (A:1-67) Non-specific lipid-transfer protein homologue (ns-LTP2) {Triticum turgidum [TaxId: 4571]} Back     information, alignment and structure
>d1l6ha_ a.52.1.1 (A:) Non-specific lipid-transfer protein homologue (ns-LTP2) {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure