Citrus Sinensis ID: 028093
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 214 | ||||||
| 297735646 | 223 | unnamed protein product [Vitis vinifera] | 0.939 | 0.901 | 0.580 | 1e-61 | |
| 225439501 | 263 | PREDICTED: uncharacterized protein LOC10 | 0.939 | 0.764 | 0.580 | 2e-61 | |
| 363808014 | 253 | uncharacterized protein LOC100799120 [Gl | 0.939 | 0.794 | 0.584 | 4e-60 | |
| 449461761 | 281 | PREDICTED: LOW QUALITY PROTEIN: BAG fami | 0.971 | 0.740 | 0.580 | 8e-60 | |
| 449524539 | 281 | PREDICTED: BAG family molecular chaperon | 0.971 | 0.740 | 0.580 | 5e-59 | |
| 356503109 | 250 | PREDICTED: uncharacterized protein LOC10 | 0.939 | 0.804 | 0.561 | 3e-57 | |
| 356521046 | 254 | PREDICTED: uncharacterized protein LOC10 | 0.929 | 0.783 | 0.561 | 4e-57 | |
| 242054875 | 259 | hypothetical protein SORBIDRAFT_03g03883 | 0.948 | 0.783 | 0.542 | 2e-53 | |
| 224055346 | 263 | predicted protein [Populus trichocarpa] | 0.939 | 0.764 | 0.514 | 5e-53 | |
| 3068705 | 269 | unknown [Arabidopsis thaliana] | 0.929 | 0.739 | 0.546 | 5e-53 |
| >gi|297735646|emb|CBI18140.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 241 bits (616), Expect = 1e-61, Method: Compositional matrix adjust.
Identities = 123/212 (58%), Positives = 157/212 (74%), Gaps = 11/212 (5%)
Query: 3 IGDLKKAISEKTGLDPQEQKVLFRGKEKEDNEHLDVSGMKDKSKVLLLEELTNKEKKPKE 62
GDLKK + ++TGL+P++Q++LFRGKE +D E L G+KD+SK+LLLEE+ +KE+K +E
Sbjct: 23 FGDLKKRLVQETGLEPKDQRLLFRGKEIDDQECLQQVGVKDRSKLLLLEEMASKERKLEE 82
Query: 63 VKDSPEKKHEYAKDSEEMRKALQAIAGVRAEVDKLSERVASLEVAVNGGTKVPSEELDTS 122
A+ S+E+ KA +A+A V+AEVDKL E+V +LE VNGGT V ++E
Sbjct: 83 -----------ARRSDEISKACKAVAEVKAEVDKLLEKVVALEATVNGGTTVENKEFVVL 131
Query: 123 AELLMKELLKLDGIEAEGEAKVQRKTEVRRVQKFHETLDNLKAINSNPFCDSSNAIKVVT 182
ELLM++LLKLDGIEAEGEAKVQR+ EVRRVQ E LD LKA NSNPF SNA+ V T
Sbjct: 132 TELLMRQLLKLDGIEAEGEAKVQRRAEVRRVQSLVEMLDTLKARNSNPFSTKSNAVSVTT 191
Query: 183 QWETFDSGMGSLNPPPLAPSSTTINQDWERFD 214
+WETF+SG+GSL PP PSST +NQDWE FD
Sbjct: 192 KWETFESGLGSLTAPPPMPSSTAVNQDWETFD 223
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|225439501|ref|XP_002271076.1| PREDICTED: uncharacterized protein LOC100243686 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|363808014|ref|NP_001242463.1| uncharacterized protein LOC100799120 [Glycine max] gi|255636230|gb|ACU18456.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449461761|ref|XP_004148610.1| PREDICTED: LOW QUALITY PROTEIN: BAG family molecular chaperone regulator 4-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449524539|ref|XP_004169279.1| PREDICTED: BAG family molecular chaperone regulator 4-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|356503109|ref|XP_003520354.1| PREDICTED: uncharacterized protein LOC100804846 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356521046|ref|XP_003529169.1| PREDICTED: uncharacterized protein LOC100789587 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|242054875|ref|XP_002456583.1| hypothetical protein SORBIDRAFT_03g038830 [Sorghum bicolor] gi|241928558|gb|EES01703.1| hypothetical protein SORBIDRAFT_03g038830 [Sorghum bicolor] | Back alignment and taxonomy information |
|---|
| >gi|224055346|ref|XP_002298491.1| predicted protein [Populus trichocarpa] gi|222845749|gb|EEE83296.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|3068705|gb|AAC14405.1| unknown [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 214 | ||||||
| TAIR|locus:2074353 | 269 | BAG4 "BCL-2-associated athanog | 0.929 | 0.739 | 0.528 | 9.2e-52 | |
| TAIR|locus:2173108 | 342 | BAG1 "BCL-2-associated athanog | 0.710 | 0.444 | 0.413 | 4e-26 | |
| TAIR|locus:2182900 | 303 | BAG3 "BCL-2-associated athanog | 0.789 | 0.557 | 0.354 | 1.1e-23 | |
| TAIR|locus:2145683 | 163 | AT5G14360 "AT5G14360" [Arabido | 0.205 | 0.269 | 0.5 | 4.2e-08 | |
| ZFIN|ZDB-GENE-050309-89 | 206 | bag1 "BCL2-associated athanoge | 0.710 | 0.737 | 0.257 | 2.2e-05 | |
| TAIR|locus:2168788 | 165 | AT5G40630 "AT5G40630" [Arabido | 0.205 | 0.266 | 0.477 | 3.6e-05 | |
| POMBASE|SPBC16G5.11c | 195 | bag101 "BAG family molecular c | 0.733 | 0.805 | 0.239 | 0.00048 |
| TAIR|locus:2074353 BAG4 "BCL-2-associated athanogene 4" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 537 (194.1 bits), Expect = 9.2e-52, P = 9.2e-52
Identities = 112/212 (52%), Positives = 146/212 (68%)
Query: 4 GDLKKAISEKTGLDPQEQKVLFRGKEKEDNEHLDVSGMKDKSKVXXXXXXXXXXXXXXXV 63
GD+KKA+ +KTGL+ E K+LFRG E++D E L +G+KD SK+ V
Sbjct: 70 GDVKKALVQKTGLEASELKILFRGVERDDAEQLQAAGVKDASKLVVV------------V 117
Query: 64 KDSPEKKHEYAKD-SEEMRKALQAIAGVRAEVDKLSERVASLEVAVNGGTKVPSEELDTS 122
+D+ ++ + ++EM KA+ A+ V EVDKLS+RV +LEVAVNGGT+V E D +
Sbjct: 118 EDTNKRVEQQPPVVTKEMEKAIAAVNAVTGEVDKLSDRVVALEVAVNGGTQVAVREFDMA 177
Query: 123 AELLMKELLKLDGIEAEGEAKVQRKTEVRRVQKFHETLDNLKAINSNPFCDSSNAIKVVT 182
AELLM++LLKLDGIEAEG+AKVQRK EVRR+Q E +D LKA SNPF D S A V T
Sbjct: 178 AELLMRQLLKLDGIEAEGDAKVQRKAEVRRIQNLQEAVDKLKARCSNPFVDQSKAAAVST 237
Query: 183 QWETFDSGMGSLNPPPLAPSSTTINQDWERFD 214
+WE+F +G+GSLNPPP A S + QDWE+FD
Sbjct: 238 EWESFGNGVGSLNPPPPASPSANVTQDWEKFD 269
|
|
| TAIR|locus:2173108 BAG1 "BCL-2-associated athanogene 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2182900 BAG3 "BCL-2-associated athanogene 3" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2145683 AT5G14360 "AT5G14360" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-050309-89 bag1 "BCL2-associated athanogene 1" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2168788 AT5G40630 "AT5G40630" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| POMBASE|SPBC16G5.11c bag101 "BAG family molecular chaperone regulator Bag101 (predicted)" [Schizosaccharomyces pombe (taxid:4896)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00001323001 | SubName- Full=Chromosome chr8 scaffold_115, whole genome shotgun sequence; (253 aa) | |||||||
(Vitis vinifera) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 214 | |||
| cd01812 | 71 | cd01812, BAG1_N, Ubiquitin-like domain of BAG1 | 1e-15 | |
| pfam02179 | 76 | pfam02179, BAG, BAG domain | 7e-09 | |
| cd01769 | 69 | cd01769, UBL, Ubiquitin-like domain of UBL | 4e-08 | |
| smart00264 | 79 | smart00264, BAG, BAG domains, present in regulator | 3e-06 | |
| pfam00240 | 69 | pfam00240, ubiquitin, Ubiquitin family | 9e-06 | |
| smart00213 | 72 | smart00213, UBQ, Ubiquitin homologues | 0.001 | |
| cd01813 | 74 | cd01813, UBP_N, UBP ubiquitin processing protease | 0.004 |
| >gnl|CDD|176407 cd01812, BAG1_N, Ubiquitin-like domain of BAG1 | Back alignment and domain information |
|---|
Score = 68.1 bits (167), Expect = 1e-15
Identities = 28/49 (57%), Positives = 43/49 (87%)
Query: 4 GDLKKAISEKTGLDPQEQKVLFRGKEKEDNEHLDVSGMKDKSKVLLLEE 52
GDLKK ++ TG++P++QK++F+GKE++D E LD+SG+KD SKV+LLE+
Sbjct: 23 GDLKKMLAPVTGVEPRDQKLIFKGKERDDAETLDMSGVKDGSKVMLLED 71
|
BAG1_N N-terminal ubiquitin-like (Ubl) domain of the BAG1 protein. This domain occurs together with the BAG domain and is closely related to the Ubl domain of a family of deubiquitinases that includes Rpn11, UBP6 (USP14), USP7 (HAUSP). Length = 71 |
| >gnl|CDD|216918 pfam02179, BAG, BAG domain | Back alignment and domain information |
|---|
| >gnl|CDD|176364 cd01769, UBL, Ubiquitin-like domain of UBL | Back alignment and domain information |
|---|
| >gnl|CDD|214591 smart00264, BAG, BAG domains, present in regulator of Hsp70 proteins | Back alignment and domain information |
|---|
| >gnl|CDD|215813 pfam00240, ubiquitin, Ubiquitin family | Back alignment and domain information |
|---|
| >gnl|CDD|214563 smart00213, UBQ, Ubiquitin homologues | Back alignment and domain information |
|---|
| >gnl|CDD|176408 cd01813, UBP_N, UBP ubiquitin processing protease | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 214 | |||
| PF02179 | 76 | BAG: BAG domain; InterPro: IPR003103 BAG domains a | 99.68 | |
| smart00264 | 79 | BAG BAG domains, present in regulator of Hsp70 pro | 99.66 | |
| KOG4361 | 344 | consensus BCL2-associated athanogene-like proteins | 99.54 | |
| cd01807 | 74 | GDX_N ubiquitin-like domain of GDX. GDX contains a | 99.53 | |
| cd01797 | 78 | NIRF_N amino-terminal ubiquitin-like domain of Np9 | 99.49 | |
| PF00240 | 69 | ubiquitin: Ubiquitin family; InterPro: IPR000626 U | 99.48 | |
| cd01793 | 74 | Fubi Fubi ubiquitin-like protein. Fubi is a ubiqui | 99.48 | |
| cd01798 | 70 | parkin_N amino-terminal ubiquitin-like of parkin p | 99.47 | |
| cd01813 | 74 | UBP_N UBP ubiquitin processing protease. The UBP ( | 99.47 | |
| cd01815 | 75 | BMSC_UbP_N Ubiquitin-like domain of BMSC-UbP. BMSC | 99.47 | |
| cd01794 | 70 | DC_UbP_C dendritic cell derived ubiquitin-like pro | 99.46 | |
| cd01812 | 71 | BAG1_N Ubiquitin-like domain of BAG1. BAG1_N N-ter | 99.46 | |
| cd01791 | 73 | Ubl5 UBL5 ubiquitin-like modifier. UBL5 (also know | 99.43 | |
| cd01796 | 71 | DDI1_N DNA damage inducible protein 1 ubiquitin-li | 99.41 | |
| cd01808 | 71 | hPLIC_N Ubiquitin-like domain of hPLIC-1 and hPLIC | 99.39 | |
| cd01810 | 74 | ISG15_repeat2 ISG15 ubiquitin-like protein, second | 99.39 | |
| cd01809 | 72 | Scythe_N Ubiquitin-like domain of Scythe protein. | 99.39 | |
| cd01804 | 78 | midnolin_N Ubiquitin-like domain of midnolin. midn | 99.38 | |
| cd01800 | 76 | SF3a120_C Ubiquitin-like domain of Mammalian splic | 99.38 | |
| cd01805 | 77 | RAD23_N Ubiquitin-like domain of RAD23. RAD23 belo | 99.37 | |
| PTZ00044 | 76 | ubiquitin; Provisional | 99.36 | |
| cd01806 | 76 | Nedd8 Nebb8-like ubiquitin protein. Nedd8 (also kn | 99.33 | |
| cd01803 | 76 | Ubiquitin Ubiquitin. Ubiquitin (includes Ubq/RPL40 | 99.32 | |
| cd01802 | 103 | AN1_N ubiquitin-like domain of AN1. AN1 (also know | 99.32 | |
| cd01792 | 80 | ISG15_repeat1 ISG15 ubiquitin-like protein, first | 99.3 | |
| cd01790 | 79 | Herp_N Homocysteine-responsive endoplasmic reticul | 99.28 | |
| cd01799 | 75 | Hoil1_N Ubiquitin-like domain of HOIL1. HOIL1_N HO | 99.18 | |
| cd01769 | 69 | UBL Ubiquitin-like domain of UBL. UBLs function by | 99.18 | |
| smart00213 | 64 | UBQ Ubiquitin homologues. Ubiquitin-mediated prote | 99.14 | |
| cd01814 | 113 | NTGP5 Ubiquitin-like NTGP5 and ATGP4. NTGP5 and AT | 99.05 | |
| cd01795 | 107 | USP48_C USP ubiquitin-specific protease. The USP ( | 99.05 | |
| cd01789 | 84 | Alp11_N Ubiquitin-like domain of Alp11 tubulin-fol | 99.02 | |
| KOG0010 | 493 | consensus Ubiquitin-like protein [Posttranslationa | 98.96 | |
| cd01763 | 87 | Sumo Small ubiquitin-related modifier (SUMO). Smal | 98.95 | |
| TIGR00601 | 378 | rad23 UV excision repair protein Rad23. All protei | 98.93 | |
| KOG0005 | 70 | consensus Ubiquitin-like protein [Cell cycle contr | 98.92 | |
| KOG0004 | 156 | consensus Ubiquitin/40S ribosomal protein S27a fus | 98.83 | |
| PF14560 | 87 | Ubiquitin_2: Ubiquitin-like domain; PDB: 1WJN_A 2K | 98.8 | |
| KOG0003 | 128 | consensus Ubiquitin/60s ribosomal protein L40 fusi | 98.63 | |
| PF11976 | 72 | Rad60-SLD: Ubiquitin-2 like Rad60 SUMO-like; Inter | 98.52 | |
| cd01801 | 77 | Tsc13_N Ubiquitin-like domain of Tsc13. Tsc13_N N- | 98.5 | |
| KOG0011 | 340 | consensus Nucleotide excision repair factor NEF2, | 98.35 | |
| KOG0001 | 75 | consensus Ubiquitin and ubiquitin-like proteins [P | 98.28 | |
| cd00196 | 69 | UBQ Ubiquitin-like proteins. Ubiquitin homologs; I | 98.24 | |
| KOG4248 | 1143 | consensus Ubiquitin-like protein, regulator of apo | 98.21 | |
| KOG1872 | 473 | consensus Ubiquitin-specific protease [Posttransla | 98.09 | |
| PF13881 | 111 | Rad60-SLD_2: Ubiquitin-2 like Rad60 SUMO-like; PDB | 98.06 | |
| PLN02560 | 308 | enoyl-CoA reductase | 97.97 | |
| cd01788 | 119 | ElonginB Ubiquitin-like domain of Elongin B. Elong | 97.65 | |
| KOG4361 | 344 | consensus BCL2-associated athanogene-like proteins | 97.59 | |
| KOG0006 | 446 | consensus E3 ubiquitin-protein ligase (Parkin prot | 97.0 | |
| PF11543 | 80 | UN_NPL4: Nuclear pore localisation protein NPL4; I | 96.46 | |
| KOG3206 | 234 | consensus Alpha-tubulin folding cofactor B [Posttr | 96.4 | |
| KOG0013 | 231 | consensus Uncharacterized conserved protein [Funct | 95.41 | |
| PF10302 | 97 | DUF2407: DUF2407 ubiquitin-like domain; InterPro: | 95.07 | |
| PF15044 | 76 | CLU_N: Mitochondrial function, CLU-N-term | 95.03 | |
| PF11470 | 65 | TUG-UBL1: GLUT4 regulating protein TUG; InterPro: | 94.59 | |
| PF08817 | 79 | YukD: WXG100 protein secretion system (Wss), prote | 94.07 | |
| KOG1769 | 99 | consensus Ubiquitin-like proteins [Posttranslation | 93.44 | |
| KOG3493 | 73 | consensus Ubiquitin-like protein [Posttranslationa | 93.23 | |
| KOG4495 | 110 | consensus RNA polymerase II transcription elongati | 92.4 | |
| KOG4583 | 391 | consensus Membrane-associated ER protein involved | 86.6 |
| >PF02179 BAG: BAG domain; InterPro: IPR003103 BAG domains are present in Bcl-2-associated athanogene 1 and silencer of death domains | Back alignment and domain information |
|---|
Probab=99.68 E-value=9.2e-17 Score=117.96 Aligned_cols=72 Identities=42% Similarity=0.595 Sum_probs=67.0
Q ss_pred HHHHHHHHHH-HHHHHHHHHHHhhCCCCCCchhhhhHHHHHHHHHHhhcccccch--hhHHHHHHHHHHHHHHHHHHHHH
Q 028093 87 IAGVRAEVDK-LSERVASLEVAVNGGTKVPSEELDTSAELLMKELLKLDGIEAEG--EAKVQRKTEVRRVQKFHETLDNL 163 (214)
Q Consensus 87 I~~i~~evd~-L~~~V~~~e~~v~~~~k~~eke~~~L~E~Lm~~LlkLD~Ie~~G--d~R~~RK~~VkrVQ~~le~LD~~ 163 (214)
|..+..+|+. |.++|..| +++..+++|.+|+|+||+.|++||+|+++| ++|.+||.+|++||++++.||.+
T Consensus 2 I~~i~~~v~~~l~~~v~~~------~~~~~~~~~~~l~E~L~~~LlkLD~I~~~g~~~iR~~RK~~v~~iq~~l~~lD~~ 75 (76)
T PF02179_consen 2 IEKIIDEVEKELQPEVEQF------DGKKDEKEYLRLSEMLMQLLLKLDSIETEGNPEIREKRKQAVKRIQQLLDKLDSL 75 (76)
T ss_dssp HHHHHHHHHHCHHHHHHHH------HHHHCCHHHHHHHHHHHHHHHHHHTCECSSSHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred HHHHHHHHHHHHHHHHHHH------hccCcHHHHHHHHHHHHHHHHHhcCcccCCCHHHHHHHHHHHHHHHHHHHHHHcc
Confidence 6677789999 99999999 666789999999999999999999999999 89999999999999999999997
Q ss_pred H
Q 028093 164 K 164 (214)
Q Consensus 164 k 164 (214)
|
T Consensus 76 k 76 (76)
T PF02179_consen 76 K 76 (76)
T ss_dssp H
T ss_pred C
Confidence 6
|
The BAG proteins are modulators of chaperone activity, they bind to HSP70/HSC70 proteins and promote substrate release. The proteins have anti-apoptotic activity and increase the anti-cell death function of BCL-2 induced by various stimuli. BAG-1 binds to the serine/threonine kinase Raf-1 or Hsc70/Hsp70 in a mutually exclusive interaction. BAG-1 promotes cell growth by binding to and stimulating Raf-1 activity. The binding of Hsp70 to BAG-1 diminishes Raf-1 signalling and inhibits subsequent events, such as DNA synthesis, as well as arrests the cell cycle. BAG-1 has been suggested to function as a molecular switch that encourages cells to proliferate in normal conditions but become quiescent under a stressful environment []. BAG-family proteins contain a single BAG domain, except for human BAG-5 which has four BAG repeats. The BAG domain is a conserved region located at the C terminus of the BAG-family proteins that binds the ATPase domain of Hsc70/Hsp70. The BAG domain is evolutionarily conserved, and BAG domain containing proteins have been described and/or proven in a variety of organisms including Mus musculus (Mouse), Xenopus spp., Drosophila spp., Bombyx mori (Silk moth), Caenorhabditis elegans, Saccharomyces cerevisiae (Baker's yeast), Schizosaccharomyces pombe (Fission yeast), and Arabidopsis thaliana (Mouse-ear cress). The BAG domain has 110-124 amino acids and is comprised of three anti-parallel alpha-helices, each approximately 30-40 amino acids in length. The first and second helices interact with the serine/threonine kinase Raf-1 and the second and third helices are the sites of the BAG domain interaction with the ATPase domain of Hsc70/Hsp70. Binding of the BAG domain to the ATPase domain is mediated by both electrostatic and hydrophobic interactions in BAG-1 and is energy requiring.; GO: 0051087 chaperone binding; PDB: 1M7K_A 1M62_A 1T7S_A 1UGO_A 1I6Z_A 3A8Y_C 1UK5_A 3FZM_B 3FZL_B 3M3Z_B .... |
| >smart00264 BAG BAG domains, present in regulator of Hsp70 proteins | Back alignment and domain information |
|---|
| >KOG4361 consensus BCL2-associated athanogene-like proteins and related BAG family chaperone regulators [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd01807 GDX_N ubiquitin-like domain of GDX | Back alignment and domain information |
|---|
| >cd01797 NIRF_N amino-terminal ubiquitin-like domain of Np95 and NIRF | Back alignment and domain information |
|---|
| >PF00240 ubiquitin: Ubiquitin family; InterPro: IPR000626 Ubiquitinylation is an ATP-dependent process that involves the action of at least three enzymes: a ubiquitin-activating enzyme (E1, IPR000011 from INTERPRO), a ubiquitin-conjugating enzyme (E2, IPR000608 from INTERPRO), and a ubiquitin ligase (E3, IPR000569 from INTERPRO, IPR003613 from INTERPRO), which work sequentially in a cascade | Back alignment and domain information |
|---|
| >cd01793 Fubi Fubi ubiquitin-like protein | Back alignment and domain information |
|---|
| >cd01798 parkin_N amino-terminal ubiquitin-like of parkin protein | Back alignment and domain information |
|---|
| >cd01813 UBP_N UBP ubiquitin processing protease | Back alignment and domain information |
|---|
| >cd01815 BMSC_UbP_N Ubiquitin-like domain of BMSC-UbP | Back alignment and domain information |
|---|
| >cd01794 DC_UbP_C dendritic cell derived ubiquitin-like protein | Back alignment and domain information |
|---|
| >cd01812 BAG1_N Ubiquitin-like domain of BAG1 | Back alignment and domain information |
|---|
| >cd01791 Ubl5 UBL5 ubiquitin-like modifier | Back alignment and domain information |
|---|
| >cd01796 DDI1_N DNA damage inducible protein 1 ubiquitin-like domain | Back alignment and domain information |
|---|
| >cd01808 hPLIC_N Ubiquitin-like domain of hPLIC-1 and hPLIC2 | Back alignment and domain information |
|---|
| >cd01810 ISG15_repeat2 ISG15 ubiquitin-like protein, second repeat of 2 | Back alignment and domain information |
|---|
| >cd01809 Scythe_N Ubiquitin-like domain of Scythe protein | Back alignment and domain information |
|---|
| >cd01804 midnolin_N Ubiquitin-like domain of midnolin | Back alignment and domain information |
|---|
| >cd01800 SF3a120_C Ubiquitin-like domain of Mammalian splicing factor SF3a_120 | Back alignment and domain information |
|---|
| >cd01805 RAD23_N Ubiquitin-like domain of RAD23 | Back alignment and domain information |
|---|
| >PTZ00044 ubiquitin; Provisional | Back alignment and domain information |
|---|
| >cd01806 Nedd8 Nebb8-like ubiquitin protein | Back alignment and domain information |
|---|
| >cd01803 Ubiquitin Ubiquitin | Back alignment and domain information |
|---|
| >cd01802 AN1_N ubiquitin-like domain of AN1 | Back alignment and domain information |
|---|
| >cd01792 ISG15_repeat1 ISG15 ubiquitin-like protein, first repeat of 2 | Back alignment and domain information |
|---|
| >cd01790 Herp_N Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain protein | Back alignment and domain information |
|---|
| >cd01799 Hoil1_N Ubiquitin-like domain of HOIL1 | Back alignment and domain information |
|---|
| >cd01769 UBL Ubiquitin-like domain of UBL | Back alignment and domain information |
|---|
| >smart00213 UBQ Ubiquitin homologues | Back alignment and domain information |
|---|
| >cd01814 NTGP5 Ubiquitin-like NTGP5 and ATGP4 | Back alignment and domain information |
|---|
| >cd01795 USP48_C USP ubiquitin-specific protease | Back alignment and domain information |
|---|
| >cd01789 Alp11_N Ubiquitin-like domain of Alp11 tubulin-folding cofactor B | Back alignment and domain information |
|---|
| >KOG0010 consensus Ubiquitin-like protein [Posttranslational modification, protein turnover, chaperones; General function prediction only] | Back alignment and domain information |
|---|
| >cd01763 Sumo Small ubiquitin-related modifier (SUMO) | Back alignment and domain information |
|---|
| >TIGR00601 rad23 UV excision repair protein Rad23 | Back alignment and domain information |
|---|
| >KOG0005 consensus Ubiquitin-like protein [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0004 consensus Ubiquitin/40S ribosomal protein S27a fusion [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF14560 Ubiquitin_2: Ubiquitin-like domain; PDB: 1WJN_A 2KJ6_A 2KJR_A 1V6E_A 1T0Y_A | Back alignment and domain information |
|---|
| >KOG0003 consensus Ubiquitin/60s ribosomal protein L40 fusion [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF11976 Rad60-SLD: Ubiquitin-2 like Rad60 SUMO-like; InterPro: IPR022617 This entry includes small ubiquitin-related modifier (SUMO) proteins | Back alignment and domain information |
|---|
| >cd01801 Tsc13_N Ubiquitin-like domain of Tsc13 | Back alignment and domain information |
|---|
| >KOG0011 consensus Nucleotide excision repair factor NEF2, RAD23 component [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0001 consensus Ubiquitin and ubiquitin-like proteins [Posttranslational modification, protein turnover, chaperones; General function prediction only] | Back alignment and domain information |
|---|
| >cd00196 UBQ Ubiquitin-like proteins | Back alignment and domain information |
|---|
| >KOG4248 consensus Ubiquitin-like protein, regulator of apoptosis [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1872 consensus Ubiquitin-specific protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13881 Rad60-SLD_2: Ubiquitin-2 like Rad60 SUMO-like; PDB: 1SE9_A 1WGH_A 2GOW_A | Back alignment and domain information |
|---|
| >PLN02560 enoyl-CoA reductase | Back alignment and domain information |
|---|
| >cd01788 ElonginB Ubiquitin-like domain of Elongin B | Back alignment and domain information |
|---|
| >KOG4361 consensus BCL2-associated athanogene-like proteins and related BAG family chaperone regulators [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0006 consensus E3 ubiquitin-protein ligase (Parkin protein) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF11543 UN_NPL4: Nuclear pore localisation protein NPL4; InterPro: IPR024682 Npl4, along with Ufd1, forms the heterodimer adaptor complex UN, which is involved in the recruitment of p97, an AAA ATPase, for tasks involving the ubiquitin pathway | Back alignment and domain information |
|---|
| >KOG3206 consensus Alpha-tubulin folding cofactor B [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0013 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF10302 DUF2407: DUF2407 ubiquitin-like domain; InterPro: IPR019413 This entry represents a family of proteins of unknown function found in fungi | Back alignment and domain information |
|---|
| >PF15044 CLU_N: Mitochondrial function, CLU-N-term | Back alignment and domain information |
|---|
| >PF11470 TUG-UBL1: GLUT4 regulating protein TUG; InterPro: IPR021569 TUG is a GLUT4 regulating protein and functions to retain membrane vesicles containing GLUT4 intracellularly | Back alignment and domain information |
|---|
| >PF08817 YukD: WXG100 protein secretion system (Wss), protein YukD; InterPro: IPR014921 YukD is a bacterial protein that adopts a ubiquitin-like fold [] | Back alignment and domain information |
|---|
| >KOG1769 consensus Ubiquitin-like proteins [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3493 consensus Ubiquitin-like protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4495 consensus RNA polymerase II transcription elongation factor Elongin/SIII, subunit elongin B [Transcription] | Back alignment and domain information |
|---|
| >KOG4583 consensus Membrane-associated ER protein involved in stress response (contains ubiquitin-like domain) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 214 | |||
| 1uk5_A | 111 | BAG-family molecular chaperone regulator-3; triple | 1e-09 | |
| 2kd0_A | 85 | LRR repeats and ubiquitin-like domain-containing p | 1e-09 | |
| 3a8y_C | 142 | BAG family molecular chaperone regulator 5; BAG do | 6e-09 | |
| 1m7k_A | 99 | Silencer of death domains; three helix bundle, cha | 1e-08 | |
| 1m62_A | 87 | BAG-family molecular chaperone regulator-4; BAG do | 2e-08 | |
| 1v86_A | 95 | DNA segment, CHR 7, wayne state university 128, ex | 2e-07 | |
| 1ugo_A | 99 | BCL2-associated athanogene 5; triple helix bundle, | 2e-07 | |
| 1wgg_A | 96 | Ubiquitin carboxyl-terminal hydrolase 14; ubiquiti | 2e-06 | |
| 1wxv_A | 92 | BAG-family molecular chaperone regulator-1; struct | 7e-05 | |
| 1wx8_A | 96 | Riken cDNA 4931431F19; ubiquitin-like domain, ubiq | 8e-05 | |
| 2bwf_A | 77 | Ubiquitin-like protein DSK2; signaling protein, UB | 2e-04 | |
| 2kan_A | 94 | Uncharacterized protein AR3433A; ubiquitin fold, a | 2e-04 | |
| 3m63_B | 101 | Ubiquitin domain-containing protein DSK2; armadill | 3e-04 | |
| 1v5t_A | 90 | 8430435I17RIK protein; hypothetical protein, ubiqu | 3e-04 | |
| 1ndd_A | 76 | NEDD8, protein (ubiquitin-like protein NEDD8); pro | 4e-04 | |
| 3m62_B | 106 | UV excision repair protein RAD23; armadillo-like r | 6e-04 | |
| 1wx7_A | 106 | Ubiquilin 3; ubiquitin-like domain, structural gen | 6e-04 | |
| 1yqb_A | 100 | Ubiquilin 3; structural genomics consortium, ubiqu | 7e-04 | |
| 4fbj_B | 88 | NEDD8; effector-HOST target complex, glutamine dea | 7e-04 | |
| 1v5o_A | 102 | 1700011N24RIK protein; hypothetical protein, ubiqu | 8e-04 |
| >1uk5_A BAG-family molecular chaperone regulator-3; triple helix bandle, CAIR-1, BIS, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: a.7.7.1 Length = 111 | Back alignment and structure |
|---|
Score = 53.2 bits (127), Expect = 1e-09
Identities = 26/115 (22%), Positives = 43/115 (37%), Gaps = 8/115 (6%)
Query: 57 EKKPKEVKDSPEKKHEYAKDSEEMRKALQAIAGVRAEVDKLSERVASLEVAVNGGTKVPS 116
P ++ + + + +V L + V S K
Sbjct: 2 SSGSSGAPAEPAAPKSGEAETPPKHPGVLKVEAILEKVQGLEQAVDSF------EGKKTD 55
Query: 117 EELDTSAELLMKELLKLDGIEAEGEAKVQ--RKTEVRRVQKFHETLDNLKAINSN 169
++ E L KELL LD ++ EG A V+ R+ VR+VQ E L+ + S+
Sbjct: 56 KKYLMIEEYLTKELLALDSVDPEGRADVRQARRDGVRKVQTILEKLEQKASGPSS 110
|
| >2kd0_A LRR repeats and ubiquitin-like domain-containing protein AT2G30105; ubiquitin-like protein, NESG, leucine-rich repeat, structural genomics; NMR {Arabidopsis thaliana} Length = 85 | Back alignment and structure |
|---|
| >3a8y_C BAG family molecular chaperone regulator 5; BAG domain, HSP70, ATPase domain, protein complex, triple helix, structural genomics, NPPSFA; 2.30A {Homo sapiens} Length = 142 | Back alignment and structure |
|---|
| >1m7k_A Silencer of death domains; three helix bundle, chaperone; NMR {Homo sapiens} SCOP: a.7.7.1 Length = 99 | Back alignment and structure |
|---|
| >1m62_A BAG-family molecular chaperone regulator-4; BAG domain, SODD, silencer of death domains, HSP70/HSC70 CO-chaperone; NMR {Homo sapiens} SCOP: a.7.7.1 Length = 87 | Back alignment and structure |
|---|
| >1v86_A DNA segment, CHR 7, wayne state university 128, expressed; ubiquitin fold, structural genomics, D7WSU128E protein; HET: DNA; NMR {Mus musculus} SCOP: d.15.1.1 Length = 95 | Back alignment and structure |
|---|
| >1ugo_A BCL2-associated athanogene 5; triple helix bundle, riken structural genomics/proteomics initiative, RSGI, structural genomics, chaperone; NMR {Mus musculus} SCOP: a.7.7.1 Length = 99 | Back alignment and structure |
|---|
| >1wgg_A Ubiquitin carboxyl-terminal hydrolase 14; ubiquitin specific protease 14, USP14, ubiquitin-like fold, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 Length = 96 | Back alignment and structure |
|---|
| >1wxv_A BAG-family molecular chaperone regulator-1; structural genomics, apoptosis, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: d.15.1.1 Length = 92 | Back alignment and structure |
|---|
| >1wx8_A Riken cDNA 4931431F19; ubiquitin-like domain, ubiquilin 1-like, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Length = 96 | Back alignment and structure |
|---|
| >2bwf_A Ubiquitin-like protein DSK2; signaling protein, UBA, signaling proteins; 1.15A {Saccharomyces cerevisiae} SCOP: d.15.1.1 PDB: 2bwe_S Length = 77 | Back alignment and structure |
|---|
| >2kan_A Uncharacterized protein AR3433A; ubiquitin fold, alpha+beta, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} Length = 94 | Back alignment and structure |
|---|
| >3m63_B Ubiquitin domain-containing protein DSK2; armadillo-like repeats, UBL conjugation pathway, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} Length = 101 | Back alignment and structure |
|---|
| >1v5t_A 8430435I17RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 PDB: 2kx3_A Length = 90 | Back alignment and structure |
|---|
| >1ndd_A NEDD8, protein (ubiquitin-like protein NEDD8); proteolysis, signaling protei; 1.60A {Homo sapiens} SCOP: d.15.1.1 PDB: 1r4m_I 1r4n_I* 1xt9_B 2ko3_A 3gzn_I* 2bkr_B 2nvu_I* 3dqv_A 1bt0_A Length = 76 | Back alignment and structure |
|---|
| >3m62_B UV excision repair protein RAD23; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} Length = 106 | Back alignment and structure |
|---|
| >1wx7_A Ubiquilin 3; ubiquitin-like domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: d.15.1.1 Length = 106 | Back alignment and structure |
|---|
| >1yqb_A Ubiquilin 3; structural genomics consortium, ubiquitin, ubiquitin-like domain, structural genomics, signaling protein SGC; 2.00A {Homo sapiens} SCOP: d.15.1.1 Length = 100 | Back alignment and structure |
|---|
| >4fbj_B NEDD8; effector-HOST target complex, glutamine deamidase, deamidati bacterial effector, cell cycle-protein binding complex; 1.60A {Homo sapiens} PDB: 4f8c_B Length = 88 | Back alignment and structure |
|---|
| >1v5o_A 1700011N24RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Length = 102 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 214 | |||
| 1m62_A | 87 | BAG-family molecular chaperone regulator-4; BAG do | 99.86 | |
| 1uk5_A | 111 | BAG-family molecular chaperone regulator-3; triple | 99.85 | |
| 1m7k_A | 99 | Silencer of death domains; three helix bundle, cha | 99.84 | |
| 3a8y_C | 142 | BAG family molecular chaperone regulator 5; BAG do | 99.83 | |
| 1ugo_A | 99 | BCL2-associated athanogene 5; triple helix bundle, | 99.83 | |
| 1i6z_A | 135 | BAG-family molecular chaperone regulator-1; triple | 99.69 | |
| 1hx1_B | 114 | BAG-1, BAG-family molecular chaperone regulator-1; | 99.59 | |
| 1t7s_A | 137 | BAG-1 cochaperone; structural genomics, PSI, prote | 99.58 | |
| 1wgg_A | 96 | Ubiquitin carboxyl-terminal hydrolase 14; ubiquiti | 99.55 | |
| 1wju_A | 100 | NEDD8 ultimate buster-1; ubiquitin-like domain, st | 99.54 | |
| 2bwf_A | 77 | Ubiquitin-like protein DSK2; signaling protein, UB | 99.53 | |
| 2kk8_A | 84 | Uncharacterized protein AT4G05270; solution arabid | 99.51 | |
| 1wxv_A | 92 | BAG-family molecular chaperone regulator-1; struct | 99.51 | |
| 2kd0_A | 85 | LRR repeats and ubiquitin-like domain-containing p | 99.51 | |
| 3phx_B | 79 | Ubiquitin-like protein ISG15; OTU domain, DE-ubiqu | 99.51 | |
| 1v5t_A | 90 | 8430435I17RIK protein; hypothetical protein, ubiqu | 99.51 | |
| 2lxa_A | 87 | Ubiquitin-like protein MDY2; ubiquitin-like domain | 99.51 | |
| 2faz_A | 78 | Ubiquitin-like containing PHD and ring finger DOM | 99.48 | |
| 2dzi_A | 81 | Ubiquitin-like protein 4A; GDX, structural genomic | 99.48 | |
| 3v6c_B | 91 | Ubiquitin; structural genomics, structural genomic | 99.47 | |
| 2wyq_A | 85 | HHR23A, UV excision repair protein RAD23 homolog A | 99.47 | |
| 3plu_A | 93 | Ubiquitin-like modifier HUB1; ubiquitin-like, HUB- | 99.46 | |
| 1v86_A | 95 | DNA segment, CHR 7, wayne state university 128, ex | 99.46 | |
| 4eew_A | 88 | Large proline-rich protein BAG6; ubiquitin-like fo | 99.45 | |
| 1ndd_A | 76 | NEDD8, protein (ubiquitin-like protein NEDD8); pro | 99.45 | |
| 3m62_B | 106 | UV excision repair protein RAD23; armadillo-like r | 99.45 | |
| 4fbj_B | 88 | NEDD8; effector-HOST target complex, glutamine dea | 99.45 | |
| 3dbh_I | 88 | NEDD8; cell cycle, activating enzyme, apoptosis, m | 99.45 | |
| 4b6w_A | 86 | Tubulin-specific chaperone; CAP-Gly, ubiquitin-lik | 99.45 | |
| 4a20_A | 98 | Ubiquitin-like protein MDY2; protein binding, GET- | 99.45 | |
| 3m63_B | 101 | Ubiquitin domain-containing protein DSK2; armadill | 99.44 | |
| 2kan_A | 94 | Uncharacterized protein AR3433A; ubiquitin fold, a | 99.44 | |
| 2hj8_A | 88 | Interferon-induced 17 kDa protein; HR2873B, human | 99.44 | |
| 3a9j_A | 76 | Ubiquitin; protein complex, cytoplasm, isopeptide | 99.44 | |
| 1uel_A | 95 | HHR23B, UV excision repair protein RAD23 homolog B | 99.43 | |
| 2klc_A | 101 | Ubiquilin-1; ubiquitin-like, structural genomics, | 99.43 | |
| 4dwf_A | 90 | HLA-B-associated transcript 3; ubiquitin-like doma | 99.43 | |
| 1wgd_A | 93 | Homocysteine-responsive endoplasmic reticulum- res | 99.43 | |
| 3n3k_B | 85 | Ubiquitin; hydrolase, protease, thiol protease, DU | 99.43 | |
| 1wy8_A | 89 | NP95-like ring finger protein, isoform A; ubiquiti | 99.42 | |
| 3mtn_B | 85 | UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquit | 99.42 | |
| 1wh3_A | 87 | 59 kDa 2'-5'-oligoadenylate synthetase like protei | 99.42 | |
| 1sif_A | 88 | Ubiquitin; hydrophobic mutants, folding, stability | 99.41 | |
| 1x1m_A | 107 | Ubiquitin-like protein SB132; structural genomics, | 99.41 | |
| 4hcn_B | 98 | Polyubiquitin, ubiquitin; ubiquitin/NEDD8 deamidas | 99.41 | |
| 1wx8_A | 96 | Riken cDNA 4931431F19; ubiquitin-like domain, ubiq | 99.41 | |
| 1wx7_A | 106 | Ubiquilin 3; ubiquitin-like domain, structural gen | 99.4 | |
| 3k9o_B | 96 | Ubiquitin, UBB+1; E2-25K, complex structure, ATP-b | 99.4 | |
| 1yqb_A | 100 | Ubiquilin 3; structural genomics consortium, ubiqu | 99.4 | |
| 1uh6_A | 100 | Ubiquitin-like 5; beta-grAsp fold, structural geno | 99.4 | |
| 1ttn_A | 106 | DC-UBP, dendritic cell-derived ubiquitin-like prot | 99.4 | |
| 2l7r_A | 93 | Ubiquitin-like protein FUBI; structural genomics, | 99.39 | |
| 2daf_A | 118 | FLJ35834 protein; hypothetical protein FLJ35834, u | 99.39 | |
| 2uyz_B | 79 | Small ubiquitin-related modifier 1; sumoylation, c | 99.38 | |
| 1v5o_A | 102 | 1700011N24RIK protein; hypothetical protein, ubiqu | 99.38 | |
| 1yx5_B | 98 | Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo s | 99.37 | |
| 1we6_A | 111 | Splicing factor, putative; structural genomics, ub | 99.35 | |
| 3b1l_X | 76 | E3 ubiquitin-protein ligase parkin; proteasome, AL | 99.04 | |
| 1j8c_A | 125 | Ubiquitin-like protein hplic-2; ubiquitin-like dom | 99.35 | |
| 4ajy_B | 118 | Transcription elongation factor B polypeptide 2; E | 99.35 | |
| 2kjr_A | 95 | CG11242; UBL, ubiquitin, ubiquitin-like, structura | 99.34 | |
| 2kj6_A | 97 | Tubulin folding cofactor B; methods development, N | 99.34 | |
| 3vdz_A | 111 | Ubiquitin-40S ribosomal protein S27A; gadolinium, | 99.34 | |
| 2kdb_A | 99 | Homocysteine-responsive endoplasmic reticulum- res | 99.34 | |
| 2kdi_A | 114 | Ubiquitin, vacuolar protein sorting-associated pro | 99.33 | |
| 1wyw_B | 97 | Ubiquitin-like protein SMT3C; hydrolase; 2.10A {Ho | 99.33 | |
| 2fnj_B | 118 | Transcription elongation factor B polypeptide 2; b | 99.33 | |
| 1we7_A | 115 | SF3A1 protein; structural genomics, ubiquitin-like | 99.33 | |
| 2ojr_A | 111 | Ubiquitin; lanthide-binding TAG, terbium, TB, SAD | 99.31 | |
| 4dbg_A | 105 | Ranbp-type and C3HC4-type zinc finger-containing; | 99.31 | |
| 1v6e_A | 95 | Cytoskeleton-associated protein 1; tubulin-specifi | 99.29 | |
| 3rt3_B | 159 | Ubiquitin-like protein ISG15; ubiquitin-like domai | 99.28 | |
| 3l0w_B | 169 | Monoubiquitinated proliferating cell nuclear antig | 99.28 | |
| 3shq_A | 320 | UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila | 99.26 | |
| 3b08_A | 152 | Polyubiquitin-C, ubiquitin; protein complex, signa | 99.25 | |
| 3b08_A | 152 | Polyubiquitin-C, ubiquitin; protein complex, signa | 99.24 | |
| 2dzm_A | 100 | FAS-associated factor 1; ubiquitin-like domain, HF | 99.23 | |
| 1wgh_A | 116 | Ubiquitin-like 3, HCG-1 protein; ubiquitin-like fo | 99.23 | |
| 3u30_A | 172 | Ubiquitin, linear DI-ubiquitin; immune system; 2.4 | 99.22 | |
| 3u5e_m | 128 | 60S ribosomal protein L40; translation, ribosome, | 99.22 | |
| 3rt3_B | 159 | Ubiquitin-like protein ISG15; ubiquitin-like domai | 99.22 | |
| 1wia_A | 95 | Hypothetical ubiquitin-like protein (riken cDNA 20 | 99.21 | |
| 3q3f_A | 189 | Ribonuclease/ubiquitin chimeric protein; domain SW | 99.2 | |
| 1se9_A | 126 | Ubiquitin family; ubiquitin-like, cell-free, wheat | 99.19 | |
| 1t0y_A | 122 | Tubulin folding cofactor B; ubiquitin-like, cytosk | 99.18 | |
| 1v2y_A | 105 | 3300001G02RIK protein; hypothetical protein, ubiqu | 99.18 | |
| 2gow_A | 125 | HCG-1 protein, ubiquitin-like protein 3; BC059385, | 99.15 | |
| 2dzj_A | 88 | Synaptic glycoprotein SC2; ubiquitin-like fold, st | 99.14 | |
| 3u5c_f | 152 | 40S ribosomal protein S31; translation, ribosome, | 99.14 | |
| 1wf9_A | 107 | NPL4 family protein; beta-grAsp fold like domain, | 99.11 | |
| 2kzr_A | 86 | Ubiquitin thioesterase OTU1; structural genomics, | 99.06 | |
| 1oqy_A | 368 | HHR23A, UV excision repair protein RAD23 homolog A | 99.0 | |
| 1wjn_A | 97 | Tubulin-folding protein TBCE; ubiquitin-like domai | 98.98 | |
| 2xzm_9 | 189 | RPS31E; ribosome, translation; 3.93A {Tetrahymena | 98.72 | |
| 1wm3_A | 72 | Ubiquitin-like protein SMT3B; ubiquitin fold, half | 98.69 | |
| 2io1_B | 94 | Small ubiquitin-related modifier 3 precursor; SUMO | 98.69 | |
| 3a4r_A | 79 | Nfatc2-interacting protein; ubiquitin fold, coiled | 98.68 | |
| 2io0_B | 91 | Small ubiquitin-related modifier 2 precursor; SUMO | 98.55 | |
| 2d07_B | 93 | Ubiquitin-like protein SMT3B; hydrolase; 2.10A {Ho | 98.51 | |
| 1wz0_A | 104 | Ubiquitin-like protein SMT3B; SUMO-2, ubiquitin-li | 98.47 | |
| 2d9d_A | 89 | BAG family molecular chaperone regulator 5; triple | 98.41 | |
| 2k8h_A | 110 | Small ubiquitin protein; SUMO, post-translational | 98.4 | |
| 2eke_C | 106 | Ubiquitin-like protein SMT3; UBC9, SUMO binding mo | 98.35 | |
| 4efo_A | 94 | Serine/threonine-protein kinase TBK1; ubiquitin li | 97.97 | |
| 3kyd_D | 115 | Small ubiquitin-related modifier 1; SUMO, thioeste | 97.91 | |
| 3pge_A | 200 | SUMO-modified proliferating cell nuclear antigen; | 97.82 | |
| 2pjh_A | 80 | Protein NPL4, nuclear protein localization protein | 97.55 | |
| 3tix_A | 207 | Ubiquitin-like protein SMT3, RNA-induced transcri | 97.54 | |
| 3goe_A | 82 | DNA repair protein RAD60; SUMO-like domain, sumoyl | 97.12 | |
| 3v7o_A | 227 | Minor nucleoprotein VP30; ssgcid, seattle structur | 97.12 | |
| 2jxx_A | 97 | Nfatc2-interacting protein; nuclear factor of acti | 96.91 | |
| 3uf8_A | 209 | Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- | 96.42 | |
| 3ix6_A | 360 | TS, tsase, thymidylate synthase; niaid, ssgcid, se | 96.17 | |
| 4da1_A | 389 | Protein phosphatase 1K, mitochondrial; metal-ION-a | 95.93 | |
| 2l76_A | 95 | Nfatc2-interacting protein; ubiquitin-like domain, | 95.7 | |
| 2bps_A | 81 | YUKD protein; ubiquitin-like protein, ubiquitin; 2 | 95.18 | |
| 2al3_A | 90 | TUG long isoform; TUG UBL1 insulin, endocytosis/ex | 95.14 | |
| 2kc2_A | 128 | Talin-1, F1; FERM, adhesion, cell membrane, cell p | 95.01 | |
| 3qx1_A | 84 | FAS-associated factor 1; UBX, protein binding, P97 | 91.72 | |
| 4a3p_A | 217 | Ubiquitin carboxyl-terminal hydrolase 15; 1.40A {H | 89.45 | |
| 3jyu_A | 231 | Ubiquitin carboxyl-terminal hydrolase; domain in u | 88.99 | |
| 2kvr_A | 130 | Ubiquitin carboxyl-terminal hydrolase 7; USP7, ubi | 85.71 | |
| 3onh_A | 127 | Ubiquitin-activating enzyme E1-like; ligase, SUMO | 80.76 |
| >1m62_A BAG-family molecular chaperone regulator-4; BAG domain, SODD, silencer of death domains, HSP70/HSC70 CO-chaperone; NMR {Homo sapiens} SCOP: a.7.7.1 | Back alignment and structure |
|---|
Probab=99.86 E-value=1.1e-21 Score=147.64 Aligned_cols=75 Identities=29% Similarity=0.399 Sum_probs=70.6
Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHhhCCCCCCchhhhhHHHHHHHHHHhhcccccch--hhHHHHHHHHHHHHHHHHHH
Q 028093 83 ALQAIAGVRAEVDKLSERVASLEVAVNGGTKVPSEELDTSAELLMKELLKLDGIEAEG--EAKVQRKTEVRRVQKFHETL 160 (214)
Q Consensus 83 a~~aI~~i~~evd~L~~~V~~~e~~v~~~~k~~eke~~~L~E~Lm~~LlkLD~Ie~~G--d~R~~RK~~VkrVQ~~le~L 160 (214)
++++|+.|+.+|++|+++|..|+ +++.|++|.+|+|+||++||+||+|+++| ++|++||.+|++||++|+.|
T Consensus 9 a~~~I~~I~~ev~~L~~~V~~f~------g~~~dkey~~L~E~L~k~LLkLD~Ie~eG~~~~R~~RK~~Vk~iQ~~l~~L 82 (87)
T 1m62_A 9 SIKKIIHVLEKVQYLEQEVEEFV------GKKTDKAYWLLEEMLTKELLELDSVETGGQDSVRQARKEAVCKIQAILEKL 82 (87)
T ss_dssp THHHHHHHHHHHHHHHHHHHHCC------CCTTSHHHHHHHHHHHHHHHHHTTCCCSSCHHHHHHHHHHHHHHHHHHHHH
T ss_pred HHHHHHHHHHHHHHHHHHHHHHh------CCcchHHHHHHHHHHHHHHHHHCCcCcCCcHHHHHHHHHHHHHHHHHHHHH
Confidence 56899999999999999999993 56899999999999999999999999999 49999999999999999999
Q ss_pred HHH
Q 028093 161 DNL 163 (214)
Q Consensus 161 D~~ 163 (214)
|..
T Consensus 83 D~k 85 (87)
T 1m62_A 83 EKK 85 (87)
T ss_dssp HHH
T ss_pred Hhc
Confidence 984
|
| >1uk5_A BAG-family molecular chaperone regulator-3; triple helix bandle, CAIR-1, BIS, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: a.7.7.1 | Back alignment and structure |
|---|
| >1m7k_A Silencer of death domains; three helix bundle, chaperone; NMR {Homo sapiens} SCOP: a.7.7.1 | Back alignment and structure |
|---|
| >3a8y_C BAG family molecular chaperone regulator 5; BAG domain, HSP70, ATPase domain, protein complex, triple helix, structural genomics, NPPSFA; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1ugo_A BCL2-associated athanogene 5; triple helix bundle, riken structural genomics/proteomics initiative, RSGI, structural genomics, chaperone; NMR {Mus musculus} SCOP: a.7.7.1 | Back alignment and structure |
|---|
| >1i6z_A BAG-family molecular chaperone regulator-1; triple helix bundle; NMR {Mus musculus} SCOP: a.7.7.1 | Back alignment and structure |
|---|
| >1hx1_B BAG-1, BAG-family molecular chaperone regulator-1; protein-protein complex, apoptosis, protein folding, molecul chaperone; 1.90A {Homo sapiens} SCOP: a.7.7.1 PDB: 3fzf_B* 3fzh_B* 3fzk_B* 3fzl_B* 3fzm_B* 3ldq_B* 3m3z_B* | Back alignment and structure |
|---|
| >1t7s_A BAG-1 cochaperone; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.80A {Caenorhabditis elegans} SCOP: a.7.7.1 | Back alignment and structure |
|---|
| >1wgg_A Ubiquitin carboxyl-terminal hydrolase 14; ubiquitin specific protease 14, USP14, ubiquitin-like fold, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1wju_A NEDD8 ultimate buster-1; ubiquitin-like domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2bwf_A Ubiquitin-like protein DSK2; signaling protein, UBA, signaling proteins; 1.15A {Saccharomyces cerevisiae} SCOP: d.15.1.1 PDB: 2bwe_S | Back alignment and structure |
|---|
| >2kk8_A Uncharacterized protein AT4G05270; solution arabidopsis thaliana, uncharacterized putative protein, NESG, structural genomics; NMR {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1wxv_A BAG-family molecular chaperone regulator-1; structural genomics, apoptosis, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2kd0_A LRR repeats and ubiquitin-like domain-containing protein AT2G30105; ubiquitin-like protein, NESG, leucine-rich repeat, structural genomics; NMR {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3phx_B Ubiquitin-like protein ISG15; OTU domain, DE-ubiquitinase, DE-isgylase, hydrolase-protein complex; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1v5t_A 8430435I17RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 PDB: 2kx3_A | Back alignment and structure |
|---|
| >2lxa_A Ubiquitin-like protein MDY2; ubiquitin-like domain, protein-protein interaction, SGT2 BIN domain, GET pathway, protein binding; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2faz_A Ubiquitin-like containing PHD and ring finger DOM protein 1; cell cycle, DNA damage, DNA repair, DNA-binding, ligase, Met binding, nuclear protein; 2.00A {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2dzi_A Ubiquitin-like protein 4A; GDX, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3v6c_B Ubiquitin; structural genomics, structural genomics consortium, SGC, UB protease, hydrolase-signaling protein complex; 1.70A {Homo sapiens} PDB: 3v6e_B | Back alignment and structure |
|---|
| >2wyq_A HHR23A, UV excision repair protein RAD23 homolog A; DNA binding protein, DNA excision repair, proteasomal degrad polyubiquitin; 1.65A {Homo sapiens} PDB: 1p98_A 1p9d_U 1p1a_A | Back alignment and structure |
|---|
| >3plu_A Ubiquitin-like modifier HUB1; ubiquitin-like, HUB-1, SNU66, peptide binding protein; 1.40A {Saccharomyces cerevisiae} PDB: 3plv_A 1m94_A 1p0r_A | Back alignment and structure |
|---|
| >1v86_A DNA segment, CHR 7, wayne state university 128, expressed; ubiquitin fold, structural genomics, D7WSU128E protein; HET: DNA; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >4eew_A Large proline-rich protein BAG6; ubiquitin-like fold, GP78-binding, chaperone; 1.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1ndd_A NEDD8, protein (ubiquitin-like protein NEDD8); proteolysis, signaling protei; 1.60A {Homo sapiens} SCOP: d.15.1.1 PDB: 1r4m_I 1r4n_I* 1xt9_B 2ko3_A 3gzn_I* 2bkr_B 2nvu_I* 3dqv_A 1bt0_A | Back alignment and structure |
|---|
| >3m62_B UV excision repair protein RAD23; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4fbj_B NEDD8; effector-HOST target complex, glutamine deamidase, deamidati bacterial effector, cell cycle-protein binding complex; 1.60A {Homo sapiens} PDB: 4f8c_B | Back alignment and structure |
|---|
| >3dbh_I NEDD8; cell cycle, activating enzyme, apoptosis, membrane, UBL conjugation pathway, ATP-binding, ligase, nucleotide- binding, polymorphism; 2.85A {Homo sapiens} SCOP: d.15.1.1 PDB: 3dbr_I 3dbl_I | Back alignment and structure |
|---|
| >4b6w_A Tubulin-specific chaperone; CAP-Gly, ubiquitin-like; HET: MSE; 2.35A {Trypanosoma brucei brucei strain 927} | Back alignment and structure |
|---|
| >4a20_A Ubiquitin-like protein MDY2; protein binding, GET-pathway, tail-anchored proteins; 1.78A {Saccharomyces cerevisiae} PDB: 2lxc_A 4goc_A | Back alignment and structure |
|---|
| >3m63_B Ubiquitin domain-containing protein DSK2; armadillo-like repeats, UBL conjugation pathway, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2kan_A Uncharacterized protein AR3433A; ubiquitin fold, alpha+beta, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2hj8_A Interferon-induced 17 kDa protein; HR2873B, human ISG15, structure, northeast structural genomics consortium, protein structure initiative, NESG; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3a9j_A Ubiquitin; protein complex, cytoplasm, isopeptide bond, metal-binding, zinc; 1.18A {Mus musculus} PDB: 3a1q_B 2znv_B 3a9k_A 3h7p_A 3jsv_A 3dvg_Y 3dvn_Y 3nob_A 2o6v_D* 3jw0_X 3jvz_X 3nhe_B* 1aar_A 1d3z_A 1f9j_A 1fxt_B 1g6j_A 1nbf_C 1cmx_B 1q5w_B ... | Back alignment and structure |
|---|
| >1uel_A HHR23B, UV excision repair protein RAD23 homolog B; UBL, UIM, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2klc_A Ubiquilin-1; ubiquitin-like, structural genomics, PSI-2, protein structur initiative, northeast structural genomics consortium, NESG; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4dwf_A HLA-B-associated transcript 3; ubiquitin-like domain, BAT3 protein, PF00240, structural GEN joint center for structural genomics, JCSG; 1.80A {Homo sapiens} PDB: 1wx9_A | Back alignment and structure |
|---|
| >1wgd_A Homocysteine-responsive endoplasmic reticulum- resident ubiquitin-like domain member...; ENDPLASMIC reticulum stress, UBL domain; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >3n3k_B Ubiquitin; hydrolase, protease, thiol protease, DUB, zinc ribbon, inhibitor, ubiqu acetylation, cytoplasm, isopeptide bond, nucleus; 2.60A {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1wy8_A NP95-like ring finger protein, isoform A; ubiquitin-like domain, NP95/ICBP90-like ring finger (NIRF), ubiquitin ligase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >3mtn_B UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquitin-specific protease activity, hydrolase, ubiquitin B structural genomics consortium, SGC; 2.70A {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1wh3_A 59 kDa 2'-5'-oligoadenylate synthetase like protein; P59 OASL, ubiquitin family, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1sif_A Ubiquitin; hydrophobic mutants, folding, stability, structural protein; 2.18A {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1x1m_A Ubiquitin-like protein SB132; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >4hcn_B Polyubiquitin, ubiquitin; ubiquitin/NEDD8 deamidase, NEDD8, protein binding; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1wx8_A Riken cDNA 4931431F19; ubiquitin-like domain, ubiquilin 1-like, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1wx7_A Ubiquilin 3; ubiquitin-like domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >3k9o_B Ubiquitin, UBB+1; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 2k25_A 2kx0_A | Back alignment and structure |
|---|
| >1yqb_A Ubiquilin 3; structural genomics consortium, ubiquitin, ubiquitin-like domain, structural genomics, signaling protein SGC; 2.00A {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1uh6_A Ubiquitin-like 5; beta-grAsp fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1ttn_A DC-UBP, dendritic cell-derived ubiquitin-like protein; ubiquitin-like domain, solution structure, signaling protein; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2l7r_A Ubiquitin-like protein FUBI; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2daf_A FLJ35834 protein; hypothetical protein FLJ35834, ubiquitin-like domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2uyz_B Small ubiquitin-related modifier 1; sumoylation, cell division, nuclear protein, ubiquitin-like modifier, UBL conjugation pathway; 1.4A {Homo sapiens} SCOP: d.15.1.1 PDB: 2vrr_B 2iy0_B 2iy1_B 2g4d_B 2las_A 2io2_B 1z5s_B 3uip_B* 1tgz_B* 2bf8_B | Back alignment and structure |
|---|
| >1v5o_A 1700011N24RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1yx5_B Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo sapiens} SCOP: d.15.1.1 PDB: 1yx6_B | Back alignment and structure |
|---|
| >1we6_A Splicing factor, putative; structural genomics, ubiquitin-like domain, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >3b1l_X E3 ubiquitin-protein ligase parkin; proteasome, ALFA-beta-protein; 1.85A {Mus musculus} PDB: 1mg8_A 2zeq_A 2knb_A 1iyf_A | Back alignment and structure |
|---|
| >1j8c_A Ubiquitin-like protein hplic-2; ubiquitin-like domain, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >4ajy_B Transcription elongation factor B polypeptide 2; E3 ubiquitin ligase, transcription factor, hypoxic signaling transcription; 1.73A {Homo sapiens} PDB: 1lqb_A 1vcb_A 2c9w_B 2izv_B 2jz3_B 2xai_C 3dcg_A 3zrc_A* 3zrf_A 3ztc_A* 3ztd_A* 3zun_A* 1lm8_B 4b95_A* 2fnj_B 4b9k_A* 4awj_A* | Back alignment and structure |
|---|
| >2kjr_A CG11242; UBL, ubiquitin, ubiquitin-like, structural genomics, PSI-2, protein structure initiative; NMR {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2kj6_A Tubulin folding cofactor B; methods development, NESG, solution PSI-2, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3vdz_A Ubiquitin-40S ribosomal protein S27A; gadolinium, MRI contrast agent, peptide-based contrast agent lanthanide binding TAG; 2.40A {Synthetic construct} PDB: 2ojr_A | Back alignment and structure |
|---|
| >2kdb_A Homocysteine-responsive endoplasmic reticulum- resident ubiquitin-like domain member...; UBL domain, membrane, polymorphism, transmembrane; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kdi_A Ubiquitin, vacuolar protein sorting-associated protein 27 fusion protein; ubiquitin interacting motif, UIM, protein domain interface; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1wyw_B Ubiquitin-like protein SMT3C; hydrolase; 2.10A {Homo sapiens} SCOP: d.15.1.1 PDB: 1y8r_C* 2asq_A 2pe6_B 1a5r_A 2kqs_A 3kyc_D* 3rzw_C | Back alignment and structure |
|---|
| >2fnj_B Transcription elongation factor B polypeptide 2; beta-sandwich, lectin-like, SPRY, protein transport/signaling protein complex; 1.80A {Mus musculus} SCOP: d.15.1.1 PDB: 1lm8_B 1lqb_A 1vcb_A 2c9w_B 2izv_B 2jz3_B 2xai_C 3dcg_A 3zrc_A* 3zrf_A | Back alignment and structure |
|---|
| >1we7_A SF3A1 protein; structural genomics, ubiquitin-like domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: d.15.1.1 PDB: 1zkh_A | Back alignment and structure |
|---|
| >2ojr_A Ubiquitin; lanthide-binding TAG, terbium, TB, SAD phasing, protein binding; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >4dbg_A Ranbp-type and C3HC4-type zinc finger-containing; ubiquitin fold, ubiquitination, ligase; 2.71A {Homo sapiens} PDB: 2lgy_A | Back alignment and structure |
|---|
| >1v6e_A Cytoskeleton-associated protein 1; tubulin-specific chaperone B, tubulin folding cofactor B, microtubule, ubiquitin-like fold, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >3rt3_B Ubiquitin-like protein ISG15; ubiquitin-like domain, isgylation, antiviral protein-viral P complex; 2.01A {Homo sapiens} PDB: 3sdl_C 3r66_C 3pse_B 1z2m_A | Back alignment and structure |
|---|
| >3l0w_B Monoubiquitinated proliferating cell nuclear antigen, proliferating cell nuclear antigen; replication, DNA damage, DNA repair; 2.80A {Saccharomyces cerevisiae} PDB: 3l10_B | Back alignment and structure |
|---|
| >3shq_A UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3b08_A Polyubiquitin-C, ubiquitin; protein complex, signaling protein-metal binding protein COM; HET: TRE; 1.70A {Homo sapiens} PDB: 2w9n_A* 3b0a_A* 3axc_A 2zvn_A 2zvo_A 2y5b_B | Back alignment and structure |
|---|
| >3b08_A Polyubiquitin-C, ubiquitin; protein complex, signaling protein-metal binding protein COM; HET: TRE; 1.70A {Homo sapiens} PDB: 2w9n_A* 3b0a_A* 3axc_A 2zvn_A 2zvo_A 2y5b_B | Back alignment and structure |
|---|
| >2dzm_A FAS-associated factor 1; ubiquitin-like domain, HFAF1, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wgh_A Ubiquitin-like 3, HCG-1 protein; ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >3u30_A Ubiquitin, linear DI-ubiquitin; immune system; 2.43A {Homo sapiens} | Back alignment and structure |
|---|
| >3u5e_m 60S ribosomal protein L40; translation, ribosome, ribosomal R ribosomal protein, STM1, eukaryotic ribosome; 3.00A {Saccharomyces cerevisiae} PDB: 3u5i_m 4b6a_m 4a18_K 4a19_K 4a1b_K 4a1d_K 4adx_5 3izc_p 3izs_p 3iz5_p 3izr_p | Back alignment and structure |
|---|
| >3rt3_B Ubiquitin-like protein ISG15; ubiquitin-like domain, isgylation, antiviral protein-viral P complex; 2.01A {Homo sapiens} PDB: 3sdl_C 3r66_C 3pse_B 1z2m_A | Back alignment and structure |
|---|
| >1wia_A Hypothetical ubiquitin-like protein (riken cDNA 2010008E23); 'structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >3q3f_A Ribonuclease/ubiquitin chimeric protein; domain SWAP, oligomerization, ubiquitin insertion, hydrolase binding; 2.17A {Bacillus amyloliquefaciens} | Back alignment and structure |
|---|
| >1se9_A Ubiquitin family; ubiquitin-like, cell-free, wheat GERM, structural genomics, protein structure initiative, CESG; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1t0y_A Tubulin folding cofactor B; ubiquitin-like, cytoskeleton, microtubule, CESG, structural genomics, protein structure initiative, PSI; NMR {Caenorhabditis elegans} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1v2y_A 3300001G02RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2gow_A HCG-1 protein, ubiquitin-like protein 3; BC059385, structural genomics, protein structure initiative, PSI; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dzj_A Synaptic glycoprotein SC2; ubiquitin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3u5c_f 40S ribosomal protein S31; translation, ribosome, ribosomal, ribosomal R ribosomal protein, eukaryotic ribosome, RNA-protein C; 3.00A {Saccharomyces cerevisiae} PDB: 3u5g_f | Back alignment and structure |
|---|
| >1wf9_A NPL4 family protein; beta-grAsp fold like domain, hypothetical protein, structural genomics, NPPSFA; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2kzr_A Ubiquitin thioesterase OTU1; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative, hydrolase; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1oqy_A HHR23A, UV excision repair protein RAD23 homolog A; DNA repair, proteasome-mediated degradation, protein- protein interaction, replication; NMR {Homo sapiens} SCOP: a.5.2.1 a.5.2.1 a.189.1.1 d.15.1.1 PDB: 1qze_A 1tp4_A | Back alignment and structure |
|---|
| >1wjn_A Tubulin-folding protein TBCE; ubiquitin-like domain, progressive motor neuropathy, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2xzm_9 RPS31E; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_9 | Back alignment and structure |
|---|
| >1wm3_A Ubiquitin-like protein SMT3B; ubiquitin fold, half-open barrel, two helices, protein transport; 1.20A {Homo sapiens} SCOP: d.15.1.1 PDB: 1wm2_A 3uin_B 3uio_B 2ckh_B | Back alignment and structure |
|---|
| >2io1_B Small ubiquitin-related modifier 3 precursor; SUMO, SENP, ULP, complex, protein binding, hydrolase; 2.60A {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >3a4r_A Nfatc2-interacting protein; ubiquitin fold, coiled coil, cytoplasm, methylation, nucleus, transcription; 1.00A {Mus musculus} PDB: 3a4s_C 3rd2_A | Back alignment and structure |
|---|
| >2io0_B Small ubiquitin-related modifier 2 precursor; SUMO, SENP, ULP, complex, protein binding, hydrolase; 2.30A {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2d07_B Ubiquitin-like protein SMT3B; hydrolase; 2.10A {Homo sapiens} SCOP: d.15.1.1 PDB: 2rpq_A 2awt_A 2io3_B 2iyd_B 1u4a_A 2k1f_A | Back alignment and structure |
|---|
| >1wz0_A Ubiquitin-like protein SMT3B; SUMO-2, ubiquitin-like molecule, structural genomics, sentrin2, NPPFSA; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2d9d_A BAG family molecular chaperone regulator 5; triple helix bundle, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2k8h_A Small ubiquitin protein; SUMO, post-translational modifier, signaling protein; NMR {Trypanosoma brucei} | Back alignment and structure |
|---|
| >2eke_C Ubiquitin-like protein SMT3; UBC9, SUMO binding motif, SBM, ligase/protein binding complex; 1.90A {Saccharomyces cerevisiae} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >4efo_A Serine/threonine-protein kinase TBK1; ubiquitin like domain, transferase; 1.77A {Homo sapiens} | Back alignment and structure |
|---|
| >3kyd_D Small ubiquitin-related modifier 1; SUMO, thioester, adenylation, inhibitor, TETR intermediate, ligase, nucleus, phosphoprotein; HET: VMX; 2.61A {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >3pge_A SUMO-modified proliferating cell nuclear antigen; DNA replication, DNA binding protein; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2pjh_A Protein NPL4, nuclear protein localization protein 4 homolog; UFD1, NPL4, AAA, protein binding, transport protein; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3tix_A Ubiquitin-like protein SMT3, RNA-induced transcri silencing complex protein TAS3; PIN, rossmann fold, SPOC, alpha-helical hairpin, heterochrom silencing, RITS, RNAI, argonaute; 2.90A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3goe_A DNA repair protein RAD60; SUMO-like domain, sumoylation, SUMO, genome stability, DNA damage, DNA recombination, nucleus; HET: DNA; 0.97A {Schizosaccharomyces pombe} PDB: 3rcz_A* | Back alignment and structure |
|---|
| >3v7o_A Minor nucleoprotein VP30; ssgcid, seattle structural genomics center for infectious disease, SMT, transcription; 2.25A {Reston ebolavirus} | Back alignment and structure |
|---|
| >2jxx_A Nfatc2-interacting protein; nuclear factor of activated T-cells, cytoplasmic 2- interacting protein, ubiquitin like homologue; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3uf8_A Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- isomerase; ssgcid, seattle structural genomics center for in disease; HET: FK5; 1.50A {Burkholderia pseudomallei} PDB: 4ggq_C* 3vaw_A* 3uqa_A* 4g50_A* 4fn2_A* 3uqb_A* 4giv_A* 1euv_B 3v60_A 3v61_A 3v62_A* | Back alignment and structure |
|---|
| >3ix6_A TS, tsase, thymidylate synthase; niaid, ssgcid, seattle structural center for infectious DISE brucellosis, orchitis, epididymitis, mastitis; 2.20A {Brucella melitensis} | Back alignment and structure |
|---|
| >4da1_A Protein phosphatase 1K, mitochondrial; metal-ION-assisted catalysis, dehydrogenase phosphatase, hydrolase; 2.38A {Homo sapiens} PDB: 3qht_A 1l2n_A | Back alignment and structure |
|---|
| >2l76_A Nfatc2-interacting protein; ubiquitin-like domain, structural genomics, PSI-biology, Pro structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2bps_A YUKD protein; ubiquitin-like protein, ubiquitin; 2.7A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2al3_A TUG long isoform; TUG UBL1 insulin, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: d.15.1.2 | Back alignment and structure |
|---|
| >2kc2_A Talin-1, F1; FERM, adhesion, cell membrane, cell projection, cytoplasm, cytoskeleton, membrane, phosphoprotein, structural protein; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3qx1_A FAS-associated factor 1; UBX, protein binding, P97 binding; 1.60A {Homo sapiens} PDB: 3qwz_B* 3qc8_B 3qca_A 3qq8_B 3r3m_B 1h8c_A | Back alignment and structure |
|---|
| >4a3p_A Ubiquitin carboxyl-terminal hydrolase 15; 1.40A {Homo sapiens} PDB: 4a3o_A 3pv1_A 3ppa_A* 3t9l_A 3lmn_A | Back alignment and structure |
|---|
| >3jyu_A Ubiquitin carboxyl-terminal hydrolase; domain in ubiquitin-specific peptidases (DUSP), proto- oncogene, ubiquitin-fold, UBL, protease, thioesterase; HET: 1PS; 2.37A {Mus musculus} | Back alignment and structure |
|---|
| >2kvr_A Ubiquitin carboxyl-terminal hydrolase 7; USP7, ubiquitin-like domain, UBL, ubiquitin specific protease, HOST-virus interaction, nucleus, protease; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3onh_A Ubiquitin-activating enzyme E1-like; ligase, SUMO conjugation, UBC9; 1.60A {Saccharomyces cerevisiae} PDB: 3ong_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 214 | ||||
| d1ugoa_ | 99 | a.7.7.1 (A:) BAG-family molecular chaperone regula | 9e-14 | |
| d1uk5a_ | 111 | a.7.7.1 (A:) BAG-family molecular chaperone regula | 7e-13 | |
| d1m7ka_ | 81 | a.7.7.1 (A:) Silencer of death domains, Sodd (Bag4 | 6e-12 | |
| d1wxva1 | 81 | d.15.1.1 (A:7-87) Bag-family molecular chaperone r | 2e-06 | |
| d2bwfa1 | 73 | d.15.1.1 (A:2-74) DSK2 {Baker's yeast (Saccharomyc | 3e-06 | |
| d1zkha1 | 86 | d.15.1.1 (A:1-86) Splicing factor 3 subunit 1, C-t | 1e-04 | |
| d1euvb_ | 79 | d.15.1.1 (B:) SUMO-1 (smt3 homologue) {Baker's yea | 5e-04 | |
| d2faza1 | 76 | d.15.1.1 (A:1-76) Ubiquitin-like PHD and RING fing | 6e-04 | |
| d1v5ta_ | 90 | d.15.1.1 (A:) 8430435i17rik protein {Mouse (Mus mu | 8e-04 | |
| d1oqya4 | 77 | d.15.1.1 (A:1-77) Ubiquitin-like domain of Rad23 h | 0.001 | |
| d1bt0a_ | 73 | d.15.1.1 (A:) Rub1 {Mouse-ear cress (Arabidopsis t | 0.001 | |
| d1wx9a1 | 73 | d.15.1.1 (A:8-80) Large proline-rich protein BAT3 | 0.002 |
| >d1ugoa_ a.7.7.1 (A:) BAG-family molecular chaperone regulator-5, BAG-5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Spectrin repeat-like superfamily: BAG domain family: BAG domain domain: BAG-family molecular chaperone regulator-5, BAG-5 species: Mouse (Mus musculus) [TaxId: 10090]
Score = 62.5 bits (152), Expect = 9e-14
Identities = 13/82 (15%), Positives = 34/82 (41%), Gaps = 8/82 (9%)
Query: 82 KALQAIAGVRAEVDKLSERVASLEVAVNGGTKVPSEELDTSAELLMKELLKLDGIEAEGE 141
++ + ++ EV + +V + +L K+L ++D ++ EG+
Sbjct: 15 PSISRLQEIQREVKAIEPQVVGFS------GLSDDKNYKRLERILTKQLFEIDSVDTEGK 68
Query: 142 AKVQ--RKTEVRRVQKFHETLD 161
+Q RK + ++ + L+
Sbjct: 69 GDIQQARKRAAQETERLLKELE 90
|
| >d1uk5a_ a.7.7.1 (A:) BAG-family molecular chaperone regulator-3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 111 | Back information, alignment and structure |
|---|
| >d1m7ka_ a.7.7.1 (A:) Silencer of death domains, Sodd (Bag4) {Human (Homo sapiens) [TaxId: 9606]} Length = 81 | Back information, alignment and structure |
|---|
| >d1wxva1 d.15.1.1 (A:7-87) Bag-family molecular chaperone regulator-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 81 | Back information, alignment and structure |
|---|
| >d2bwfa1 d.15.1.1 (A:2-74) DSK2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 73 | Back information, alignment and structure |
|---|
| >d1zkha1 d.15.1.1 (A:1-86) Splicing factor 3 subunit 1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 86 | Back information, alignment and structure |
|---|
| >d1euvb_ d.15.1.1 (B:) SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomyces cerevisiae), smt3 [TaxId: 4932]} Length = 79 | Back information, alignment and structure |
|---|
| >d2faza1 d.15.1.1 (A:1-76) Ubiquitin-like PHD and RING finger domain-containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 | Back information, alignment and structure |
|---|
| >d1v5ta_ d.15.1.1 (A:) 8430435i17rik protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 90 | Back information, alignment and structure |
|---|
| >d1oqya4 d.15.1.1 (A:1-77) Ubiquitin-like domain of Rad23 homolog A (Hhr23a) {Human (Homo sapiens) [TaxId: 9606]} Length = 77 | Back information, alignment and structure |
|---|
| >d1bt0a_ d.15.1.1 (A:) Rub1 {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 73 | Back information, alignment and structure |
|---|
| >d1wx9a1 d.15.1.1 (A:8-80) Large proline-rich protein BAT3 {Human (Homo sapiens) [TaxId: 9606]} Length = 73 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 214 | |||
| d1m7ka_ | 81 | Silencer of death domains, Sodd (Bag4) {Human (Hom | 99.81 | |
| d1ugoa_ | 99 | BAG-family molecular chaperone regulator-5, BAG-5 | 99.8 | |
| d1uk5a_ | 111 | BAG-family molecular chaperone regulator-3 {Mouse | 99.8 | |
| d1wxva1 | 81 | Bag-family molecular chaperone regulator-1 {Human | 99.61 | |
| d1wgga_ | 96 | Ubiquitin carboxyl-terminal hydrolase 14 {Mouse (M | 99.58 | |
| d2bwfa1 | 73 | DSK2 {Baker's yeast (Saccharomyces cerevisiae) [Ta | 99.58 | |
| d1yqba1 | 84 | Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} | 99.57 | |
| d1t7sa_ | 129 | BAG-family molecular chaperon regulator-1, BAG1 {N | 99.56 | |
| d2zeqa1 | 78 | Ubiquitin-like domain of parkin {Mouse (Mus muscul | 99.56 | |
| d1wy8a1 | 76 | Ubiquitin-like PHD and RING finger domain-containi | 99.55 | |
| d1z2ma1 | 76 | Interferon-induced 15 kDa protein {Human (Homo sap | 99.54 | |
| d2faza1 | 76 | Ubiquitin-like PHD and RING finger domain-containi | 99.53 | |
| d1bt0a_ | 73 | Rub1 {Mouse-ear cress (Arabidopsis thaliana) [TaxI | 99.53 | |
| d1wx8a1 | 83 | 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090] | 99.53 | |
| d1z2ma2 | 76 | Interferon-induced 15 kDa protein {Human (Homo sap | 99.53 | |
| d1v5ta_ | 90 | 8430435i17rik protein {Mouse (Mus musculus) [TaxId | 99.51 | |
| d1wh3a_ | 87 | 2'-5'-oligoadenylate synthetase-like protein, OASL | 99.51 | |
| d1m94a_ | 73 | Ubiquitin-like modifier protein hub1 {Baker's yeas | 99.51 | |
| d1hx1b_ | 112 | BAG-family molecular chaperon regulator-1, BAG1 {H | 99.51 | |
| d1ogwa_ | 76 | Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} | 99.51 | |
| d1j8ca_ | 103 | Ubiquitin-like N-terminal domain of PLIC-2 {Human | 99.5 | |
| d1ttna1 | 80 | Dendritic cell-derived ubiquitin-like protein {Hum | 99.49 | |
| d1oqya4 | 77 | Ubiquitin-like domain of Rad23 homolog A (Hhr23a) | 99.47 | |
| d1zkha1 | 86 | Splicing factor 3 subunit 1, C-terminal domain {Hu | 99.47 | |
| d1wx9a1 | 73 | Large proline-rich protein BAT3 {Human (Homo sapie | 99.47 | |
| d1v86a_ | 95 | hypothetical D7wsu128e protein {Mouse (Mus musculu | 99.45 | |
| d1uh6a_ | 100 | Ubiquitin-like protein 5, ubl5 {Mouse (Mus musculu | 99.43 | |
| d1wjua_ | 100 | NEDD8 ultimate buster-1, NUB1 {Human (Homo sapiens | 99.42 | |
| d1v5oa_ | 102 | 1700011n24rik protein {Mouse (Mus musculus) [TaxId | 99.41 | |
| d1uela_ | 95 | Ubiquitin-like domain of Rad23 homolog B (Hhr23B) | 99.41 | |
| d1we6a_ | 111 | Splicing factor 3 subunit 1, C-terminal domain {Th | 99.4 | |
| d1se9a_ | 101 | Hypothetical protein At3g01050 {Thale cress (Arabi | 99.36 | |
| d1wgha_ | 116 | Ubiquitin-like protein 3, Ubl3 {Mouse (Mus musculu | 99.34 | |
| d1x1ma1 | 94 | Ubiquitin-like protein 7 {Mouse (Mus musculus) [Ta | 99.33 | |
| d1v6ea_ | 95 | Ubiquitin-like domain of tubulin folding cofactor | 99.31 | |
| d1t0ya_ | 90 | Ubiquitin-like domain of tubulin folding cofactor | 99.26 | |
| d1wiaa_ | 95 | Ubiquitin-like protein bab25500 (2010008E23Rik) {M | 99.21 | |
| d1wgda_ | 93 | Homocysteine-responsive endoplasmic reticulum-resi | 99.2 | |
| d1v2ya_ | 105 | Ubiquitin-like protein 3300001g02rik {Mouse (Mus m | 99.19 | |
| d1wjna_ | 97 | Tubulin-folding protein TbcE {Mouse (Mus musculus) | 99.15 | |
| d2c9wb1 | 103 | Elongin B {Human (Homo sapiens) [TaxId: 9606]} | 99.14 | |
| d1euvb_ | 79 | SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomy | 98.98 | |
| d2uyzb1 | 77 | SUMO-1 (smt3 homologue) {Human (Homo sapiens) [Tax | 98.65 | |
| d1wf9a1 | 94 | NPL4-like protein 1 {Thale cress (Arabidopsis thal | 97.9 | |
| d1wm3a_ | 72 | SUMO-2 {Human (Homo sapiens) [TaxId: 9606]} | 97.41 | |
| d2al3a1 | 76 | Tether containing UBX domain for GLUT4 (Tug) {Mous | 94.68 |
| >d1m7ka_ a.7.7.1 (A:) Silencer of death domains, Sodd (Bag4) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Spectrin repeat-like superfamily: BAG domain family: BAG domain domain: Silencer of death domains, Sodd (Bag4) species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.81 E-value=4.8e-20 Score=135.31 Aligned_cols=74 Identities=30% Similarity=0.408 Sum_probs=69.6
Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHhhCCCCCCchhhhhHHHHHHHHHHhhcccccch--hhHHHHHHHHHHHHHHHHHH
Q 028093 83 ALQAIAGVRAEVDKLSERVASLEVAVNGGTKVPSEELDTSAELLMKELLKLDGIEAEG--EAKVQRKTEVRRVQKFHETL 160 (214)
Q Consensus 83 a~~aI~~i~~evd~L~~~V~~~e~~v~~~~k~~eke~~~L~E~Lm~~LlkLD~Ie~~G--d~R~~RK~~VkrVQ~~le~L 160 (214)
+.++|..|..+|+.|..+|..| +++..+++|..|+|+||++||+||+|+++| ++|.+||.+|++||++++.|
T Consensus 4 ~~~~I~~i~~~v~~l~~~V~~f------~g~~~dke~~~L~E~L~~~llkLD~Ie~~G~~~vR~~RK~~vk~vq~~l~~L 77 (81)
T d1m7ka_ 4 SIKKIIHVLEKVQYLEQEVEEF------VGKKTDKAYWLLEEMLTKELLELDSVETGGQDSVRQARKEAVCKIQAILEKL 77 (81)
T ss_dssp SHHHHHHHHHHHHHHHHHHHHC------CSCTTSHHHHHHHHHHHHHHHHHTTCCCSSCHHHHHHHHHHHHHHHHHHHHH
T ss_pred HHHHHHHHHHHHHHHHHHHHHH------cCCcccHHHHHHHHHHHHHHHHhCCcccCCcHHHHHHHHHHHHHHHHHHHHH
Confidence 3578899999999999999999 678899999999999999999999999999 69999999999999999999
Q ss_pred HH
Q 028093 161 DN 162 (214)
Q Consensus 161 D~ 162 (214)
|.
T Consensus 78 D~ 79 (81)
T d1m7ka_ 78 EK 79 (81)
T ss_dssp HH
T ss_pred hc
Confidence 97
|
| >d1ugoa_ a.7.7.1 (A:) BAG-family molecular chaperone regulator-5, BAG-5 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1uk5a_ a.7.7.1 (A:) BAG-family molecular chaperone regulator-3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wxva1 d.15.1.1 (A:7-87) Bag-family molecular chaperone regulator-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wgga_ d.15.1.1 (A:) Ubiquitin carboxyl-terminal hydrolase 14 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2bwfa1 d.15.1.1 (A:2-74) DSK2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1yqba1 d.15.1.1 (A:15-98) Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t7sa_ a.7.7.1 (A:) BAG-family molecular chaperon regulator-1, BAG1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d2zeqa1 d.15.1.1 (A:1-78) Ubiquitin-like domain of parkin {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wy8a1 d.15.1.1 (A:8-83) Ubiquitin-like PHD and RING finger domain-containing protein 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z2ma1 d.15.1.1 (A:3-78) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2faza1 d.15.1.1 (A:1-76) Ubiquitin-like PHD and RING finger domain-containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bt0a_ d.15.1.1 (A:) Rub1 {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1wx8a1 d.15.1.1 (A:8-90) 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1z2ma2 d.15.1.1 (A:79-154) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v5ta_ d.15.1.1 (A:) 8430435i17rik protein {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wh3a_ d.15.1.1 (A:) 2'-5'-oligoadenylate synthetase-like protein, OASL {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m94a_ d.15.1.1 (A:) Ubiquitin-like modifier protein hub1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1hx1b_ a.7.7.1 (B:) BAG-family molecular chaperon regulator-1, BAG1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ogwa_ d.15.1.1 (A:) Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j8ca_ d.15.1.1 (A:) Ubiquitin-like N-terminal domain of PLIC-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ttna1 d.15.1.1 (A:21-100) Dendritic cell-derived ubiquitin-like protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oqya4 d.15.1.1 (A:1-77) Ubiquitin-like domain of Rad23 homolog A (Hhr23a) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zkha1 d.15.1.1 (A:1-86) Splicing factor 3 subunit 1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wx9a1 d.15.1.1 (A:8-80) Large proline-rich protein BAT3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v86a_ d.15.1.1 (A:) hypothetical D7wsu128e protein {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1uh6a_ d.15.1.1 (A:) Ubiquitin-like protein 5, ubl5 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wjua_ d.15.1.1 (A:) NEDD8 ultimate buster-1, NUB1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v5oa_ d.15.1.1 (A:) 1700011n24rik protein {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1uela_ d.15.1.1 (A:) Ubiquitin-like domain of Rad23 homolog B (Hhr23B) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1we6a_ d.15.1.1 (A:) Splicing factor 3 subunit 1, C-terminal domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1se9a_ d.15.1.1 (A:) Hypothetical protein At3g01050 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1wgha_ d.15.1.1 (A:) Ubiquitin-like protein 3, Ubl3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x1ma1 d.15.1.1 (A:8-101) Ubiquitin-like protein 7 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1v6ea_ d.15.1.1 (A:) Ubiquitin-like domain of tubulin folding cofactor B {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1t0ya_ d.15.1.1 (A:) Ubiquitin-like domain of tubulin folding cofactor B {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1wiaa_ d.15.1.1 (A:) Ubiquitin-like protein bab25500 (2010008E23Rik) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wgda_ d.15.1.1 (A:) Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein, HERPUD1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v2ya_ d.15.1.1 (A:) Ubiquitin-like protein 3300001g02rik {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wjna_ d.15.1.1 (A:) Tubulin-folding protein TbcE {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2c9wb1 d.15.1.1 (B:2-104) Elongin B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1euvb_ d.15.1.1 (B:) SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomyces cerevisiae), smt3 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2uyzb1 d.15.1.1 (B:20-96) SUMO-1 (smt3 homologue) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wf9a1 d.15.1.1 (A:8-101) NPL4-like protein 1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1wm3a_ d.15.1.1 (A:) SUMO-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2al3a1 d.15.1.2 (A:10-85) Tether containing UBX domain for GLUT4 (Tug) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|