Citrus Sinensis ID: 028156


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210---
MPSLCATLLQNLEEFMNKDEQLGKQEPEGRIACSLLSGSLSMALCYIQRVFRSGLLHPQPRILCLQGSPDGPEQYVAIMNAIFSAQRSMVPIDSCYLGAQNSAFLQQASYITGGVHHKPQQLDGLFQYLLTIFGTDLHSRNFLQLPKPVGVDFRASCFCHKNTIDMGYICSVCLSIYCKHLKKCSTCGSVFGQAQTQSDEPSATNRKRKTTDA
cccHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHccccccccccEEEEEEccccccHHHHHHHHHHHHHHHccEEEEEEEEcccccHHHHHHHHHcccEEEccccccHHHHHHHHHHcccccccccccccccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccc
ccHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHccccccccEEEEEEcccccHHHHHHHHHHHHHHHHccccEEEEEEcccccHHHHHHHHHcccEEEccccHHHHHHHHHHHHcccHHHHHHccccccccccEEEEEEccccEEEEEEEEcEEEEEEccccccccccccEEcccccccccccccccccccccc
MPSLCATLLQNLEEFMNkdeqlgkqepegriacSLLSGSLSMALCYIQRVfrsgllhpqprilclqgspdgpeQYVAIMNAIFSAqrsmvpidscylgaqnsafLQQASyitggvhhkpqqlDGLFQYLLTIFGtdlhsrnflqlpkpvgvdfrascfchkntidmgyICSVCLSIYCkhlkkcstcgsvfgqaqtqsdepsatnrkrkttda
MPSLCATLLQNLEEFMNKDEQLGKQEPEGRIACSLLSGSLSMALCYIQRVFRSGLLHPQPRILCLQGSPDGPEQYVAIMNAIFSAQRSMVPIDSCYLGAQNSAFLQQASYITGGVHHKPQQLDGLFQYLLTIFGTDLHSRNFLQLPKPVGVDFRASCFCHKNTIDMGYICSVCLSIYCKHLKKCSTCGSVfgqaqtqsdepsatnrkrkttda
MPSLCATLLQNLEEFMNKDEQLGKQEPEGRIACSLLSGSLSMALCYIQRVFRSGLLHPQPRILCLQGSPDGPEQYVAIMNAIFSAQRSMVPIDSCYLGAQNSAFLQQASYITGGVHHKPQQLDGLFQYLLTIFGTDLHSRNFLQLPKPVGVDFRASCFCHKNTIDMGYICSVCLSIYCKHLKKCSTCGSVFGQAQTQSDEPSATNRKRKTTDA
*****************************RIACSLLSGSLSMALCYIQRVFRSGLLHPQPRILCLQGSPDGPEQYVAIMNAIFSAQRSMVPIDSCYLGAQNSAFLQQASYITGGVHHKPQQLDGLFQYLLTIFGTDLHSRNFLQLPKPVGVDFRASCFCHKNTIDMGYICSVCLSIYCKHLKKCSTCGSVFG*********************
**SLCATLLQNLEEFM********************SGSLSMALCYIQRVFRS**LHPQPRILCLQGSPDGPEQYVAIMNAIFSAQRSMVPIDSCYLGAQNSAFLQQASYITGGVHHKPQQLDGLFQYLLTIFGTDLHS***********VDFRASCFCHKNTIDMGYICSVCLSIYCKHLKKCSTCGSVFG*********************
MPSLCATLLQNLEEFMNKDEQLGKQEPEGRIACSLLSGSLSMALCYIQRVFRSGLLHPQPRILCLQGSPDGPEQYVAIMNAIFSAQRSMVPIDSCYLGAQNSAFLQQASYITGGVHHKPQQLDGLFQYLLTIFGTDLHSRNFLQLPKPVGVDFRASCFCHKNTIDMGYICSVCLSIYCKHLKKCSTCGSVF**********************
MPSLCATLLQNLEEFMNKDEQLGK*****RIACSLLSGSLSMALCYIQRVFRSGLLHPQPRILCLQGSPDGPEQYVAIMNAIFSAQRSMVPIDSCYLGAQNSAFLQQASYITGGVHHKPQQLDGLFQYLLTIFGTDLHSRNFLQLPKPVGVDFRASCFCHKNTIDMGYICSVCLSIYCKHLKKCSTCGSVFGQA*******************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPSLCATLLQNLEEFMNKDEQLGKQEPEGRIACSLLSGSLSMALCYIQRVFRSGLLHPQPRILCLQGSPDGPEQYVAIMNAIFSAQRSMVPIDSCYLGAQNSAFLQQASYITGGVHHKPQQLDGLFQYLLTIFGTDLHSRNFLQLPKPVGVDFRASCFCHKNTIDMGYICSVCLSIYCKHLKKCSTCGSVFGQAQTQSDEPSATNRKRKTTDA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query213 2.2.26 [Sep-21-2011]
Q86IB5372 General transcription fac yes no 0.704 0.403 0.523 1e-37
Q05B56309 General transcription fac yes no 0.793 0.546 0.453 5e-36
Q13889308 General transcription fac yes no 0.793 0.548 0.447 2e-35
Q8VD76309 General transcription fac yes no 0.793 0.546 0.441 3e-35
Q561R7309 General transcription fac yes no 0.793 0.546 0.436 1e-34
O74366297 RNA polymerase II transcr yes no 0.812 0.582 0.375 1e-29
Q6BL86387 RNA polymerase II transcr yes no 0.661 0.364 0.398 9e-23
Q6CD24340 RNA polymerase II transcr yes no 0.751 0.470 0.378 3e-22
Q12004338 RNA polymerase II transcr yes no 0.863 0.544 0.343 4e-20
Q6CVX9337 RNA polymerase II transcr yes no 0.830 0.525 0.362 1e-19
>sp|Q86IB5|TF2H3_DICDI General transcription factor IIH subunit 3 OS=Dictyostelium discoideum GN=gtf2h3 PE=3 SV=1 Back     alignment and function desciption
 Score =  155 bits (393), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 79/151 (52%), Positives = 102/151 (67%), Gaps = 1/151 (0%)

Query: 42  MALCYIQRVFRSGLLHPQPRILCLQGSPDGPEQYVAIMNAIFSAQRSMVPIDSCYLGAQN 101
           +ALCYI R+ R      +PRIL    SPD   QY+++MN IFS+Q+  +P+DSC L   +
Sbjct: 196 IALCYINRIKRETPT-IKPRILVFNISPDVSSQYISVMNCIFSSQKQSIPVDSCILSQSD 254

Query: 102 SAFLQQASYITGGVHHKPQQLDGLFQYLLTIFGTDLHSRNFLQLPKPVGVDFRASCFCHK 161
           S FLQQAS++T G++ KPQ+ + L QYLLT F  D  SR  L  P    VD+RASCFCHK
Sbjct: 255 STFLQQASHLTSGIYLKPQKQELLSQYLLTTFLLDTLSRKSLAYPTLKSVDYRASCFCHK 314

Query: 162 NTIDMGYICSVCLSIYCKHLKKCSTCGSVFG 192
             +D+GY+CSVCLSI+C H   CSTCG+ F 
Sbjct: 315 RIVDIGYVCSVCLSIFCGHSSSCSTCGTKFS 345




Component of the core-TFIIH basal transcription factor involved in nucleotide excision repair (NER) of DNA and, when complexed to CAK, in RNA transcription by RNA polymerase II.
Dictyostelium discoideum (taxid: 44689)
>sp|Q05B56|TF2H3_BOVIN General transcription factor IIH subunit 3 OS=Bos taurus GN=GTF2H3 PE=2 SV=1 Back     alignment and function description
>sp|Q13889|TF2H3_HUMAN General transcription factor IIH subunit 3 OS=Homo sapiens GN=GTF2H3 PE=1 SV=2 Back     alignment and function description
>sp|Q8VD76|TF2H3_MOUSE General transcription factor IIH subunit 3 OS=Mus musculus GN=Gtf2h3 PE=1 SV=1 Back     alignment and function description
>sp|Q561R7|TF2H3_RAT General transcription factor IIH subunit 3 OS=Rattus norvegicus GN=Gtf2h3 PE=2 SV=1 Back     alignment and function description
>sp|O74366|TFB4_SCHPO RNA polymerase II transcription factor B subunit 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tfb4 PE=1 SV=1 Back     alignment and function description
>sp|Q6BL86|TFB4_DEBHA RNA polymerase II transcription factor B subunit 4 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=TFB4 PE=3 SV=2 Back     alignment and function description
>sp|Q6CD24|TFB4_YARLI RNA polymerase II transcription factor B subunit 4 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=TFB4 PE=3 SV=1 Back     alignment and function description
>sp|Q12004|TFB4_YEAST RNA polymerase II transcription factor B subunit 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TFB4 PE=1 SV=1 Back     alignment and function description
>sp|Q6CVX9|TFB4_KLULA RNA polymerase II transcription factor B subunit 4 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TFB4 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query213
18394597301 transcription initiation factor TFIIH su 0.976 0.691 0.785 1e-93
297850232301 hypothetical protein ARALYDRAFT_472054 [ 0.976 0.691 0.776 8e-93
225459534297 PREDICTED: general transcription factor 0.985 0.707 0.816 1e-90
224084866289 predicted protein [Populus trichocarpa] 0.990 0.730 0.793 9e-90
449470273295 PREDICTED: general transcription factor 0.985 0.711 0.783 2e-88
357461529 340 General transcription factor IIH subunit 0.971 0.608 0.594 1e-78
356509424294 PREDICTED: general transcription factor 0.967 0.700 0.720 1e-78
363806998294 uncharacterized protein LOC100776751 [Gl 0.967 0.700 0.710 2e-77
294464556306 unknown [Picea sitchensis] 0.915 0.637 0.69 5e-77
357146071290 PREDICTED: general transcription factor 0.901 0.662 0.700 7e-76
>gi|18394597|ref|NP_564050.1| transcription initiation factor TFIIH subunit H3 [Arabidopsis thaliana] gi|21537277|gb|AAM61618.1| unknown [Arabidopsis thaliana] gi|92856638|gb|ABE77412.1| At1g18340 [Arabidopsis thaliana] gi|332191584|gb|AEE29705.1| transcription initiation factor TFIIH subunit H3 [Arabidopsis thaliana] Back     alignment and taxonomy information
 Score =  347 bits (891), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 165/210 (78%), Positives = 185/210 (88%), Gaps = 2/210 (0%)

Query: 1   MPSLCATLLQNLEEFMNKDEQLGKQE-PEGRIACSLLSGSLSMALCYIQRVFRSGLLHPQ 59
           MP++  +LL+ LEEF+ KDE+L K+E  E RI   LLSGSLSMALCYIQRVFRSG LHPQ
Sbjct: 89  MPAIFGSLLKKLEEFVTKDEELSKEEVSEDRIPSCLLSGSLSMALCYIQRVFRSGHLHPQ 148

Query: 60  PRILCLQGSPDGPEQYVAIMNAIFSAQRSMVPIDSCYLGAQNSAFLQQASYITGGVHHKP 119
           PRILCLQGSPDGPEQYVA+MN+IFSAQR MVPIDSCY+G QNSAFLQQASYITGGVHH P
Sbjct: 149 PRILCLQGSPDGPEQYVAVMNSIFSAQRLMVPIDSCYIGVQNSAFLQQASYITGGVHHTP 208

Query: 120 QQLDGLFQYLLTIFGTDLHSRNFLQLPKPVGVDFRASCFCHKNTIDMGYICSVCLSIYCK 179
           +QLDGLFQYL TIF TDLHSR F+QLPKP+GVDFRASCFCHK TIDMGYICSVCLSI+C+
Sbjct: 209 KQLDGLFQYLTTIFATDLHSRGFVQLPKPIGVDFRASCFCHKKTIDMGYICSVCLSIFCE 268

Query: 180 HLKKCSTCGSVFGQAQTQSDEPSATNRKRK 209
           H KKCSTCGSVFGQ++   D  SA+++KRK
Sbjct: 269 HHKKCSTCGSVFGQSKLD-DASSASDKKRK 297




Source: Arabidopsis thaliana

Species: Arabidopsis thaliana

Genus: Arabidopsis

Family: Brassicaceae

Order: Brassicales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|297850232|ref|XP_002892997.1| hypothetical protein ARALYDRAFT_472054 [Arabidopsis lyrata subsp. lyrata] gi|297338839|gb|EFH69256.1| hypothetical protein ARALYDRAFT_472054 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|225459534|ref|XP_002284465.1| PREDICTED: general transcription factor IIH subunit 3 [Vitis vinifera] gi|302141830|emb|CBI19033.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224084866|ref|XP_002307429.1| predicted protein [Populus trichocarpa] gi|222856878|gb|EEE94425.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449470273|ref|XP_004152842.1| PREDICTED: general transcription factor IIH subunit 3-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|357461529|ref|XP_003601046.1| General transcription factor IIH subunit [Medicago truncatula] gi|355490094|gb|AES71297.1| General transcription factor IIH subunit [Medicago truncatula] Back     alignment and taxonomy information
>gi|356509424|ref|XP_003523449.1| PREDICTED: general transcription factor IIH subunit 3-like [Glycine max] Back     alignment and taxonomy information
>gi|363806998|ref|NP_001242062.1| uncharacterized protein LOC100776751 [Glycine max] gi|255647869|gb|ACU24393.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|294464556|gb|ADE77788.1| unknown [Picea sitchensis] Back     alignment and taxonomy information
>gi|357146071|ref|XP_003573866.1| PREDICTED: general transcription factor IIH subunit 3-like [Brachypodium distachyon] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query213
TAIR|locus:2014124301 AT1G18340 [Arabidopsis thalian 0.976 0.691 0.785 4.1e-88
DICTYBASE|DDB_G0275517372 gtf2h3 "general transcription 0.751 0.430 0.521 4.6e-41
UNIPROTKB|G3X6N2305 GTF2H3 "General transcription 0.784 0.547 0.458 8.3e-35
UNIPROTKB|Q05B56309 GTF2H3 "General transcription 0.784 0.540 0.458 8.3e-35
FB|FBgn0031309299 Tfb4 "Tfb4" [Drosophila melano 0.906 0.645 0.437 1.1e-34
UNIPROTKB|F1RFL7309 GTF2H3 "Uncharacterized protei 0.784 0.540 0.452 1.1e-34
UNIPROTKB|F1NGC7301 GTF2H3 "Uncharacterized protei 0.826 0.584 0.421 1.7e-34
UNIPROTKB|B4DNZ6267 GTF2H3 "cDNA FLJ53013, highly 0.830 0.662 0.430 1.7e-34
UNIPROTKB|Q13889308 GTF2H3 "General transcription 0.830 0.574 0.430 1.7e-34
MGI|MGI:1277143309 Gtf2h3 "general transcription 0.784 0.540 0.447 3.6e-34
TAIR|locus:2014124 AT1G18340 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 880 (314.8 bits), Expect = 4.1e-88, P = 4.1e-88
 Identities = 165/210 (78%), Positives = 185/210 (88%)

Query:     1 MPSLCATLLQNLEEFMNKDEQLGKQE-PEGRIACSLLSGSLSMALCYIQRVFRSGLLHPQ 59
             MP++  +LL+ LEEF+ KDE+L K+E  E RI   LLSGSLSMALCYIQRVFRSG LHPQ
Sbjct:    89 MPAIFGSLLKKLEEFVTKDEELSKEEVSEDRIPSCLLSGSLSMALCYIQRVFRSGHLHPQ 148

Query:    60 PRILCLQGSPDGPEQYVAIMNAIFSAQRSMVPIDSCYLGAQNSAFLQQASYITGGVHHKP 119
             PRILCLQGSPDGPEQYVA+MN+IFSAQR MVPIDSCY+G QNSAFLQQASYITGGVHH P
Sbjct:   149 PRILCLQGSPDGPEQYVAVMNSIFSAQRLMVPIDSCYIGVQNSAFLQQASYITGGVHHTP 208

Query:   120 QQLDGLFQYLLTIFGTDLHSRNFLQLPKPVGVDFRASCFCHKNTIDMGYICSVCLSIYCK 179
             +QLDGLFQYL TIF TDLHSR F+QLPKP+GVDFRASCFCHK TIDMGYICSVCLSI+C+
Sbjct:   209 KQLDGLFQYLTTIFATDLHSRGFVQLPKPIGVDFRASCFCHKKTIDMGYICSVCLSIFCE 268

Query:   180 HLKKCSTCGSVFGQAQTQSDEPSATNRKRK 209
             H KKCSTCGSVFGQ++   D  SA+++KRK
Sbjct:   269 HHKKCSTCGSVFGQSKLD-DASSASDKKRK 297




GO:0000439 "core TFIIH complex" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
GO:0006281 "DNA repair" evidence=IEA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA
GO:0000394 "RNA splicing, via endonucleolytic cleavage and ligation" evidence=RCA
GO:0006366 "transcription from RNA polymerase II promoter" evidence=RCA
DICTYBASE|DDB_G0275517 gtf2h3 "general transcription factor IIH, polypeptide 3" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|G3X6N2 GTF2H3 "General transcription factor IIH subunit 3" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q05B56 GTF2H3 "General transcription factor IIH subunit 3" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
FB|FBgn0031309 Tfb4 "Tfb4" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|F1RFL7 GTF2H3 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1NGC7 GTF2H3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|B4DNZ6 GTF2H3 "cDNA FLJ53013, highly similar to TFIIH basal transcription factor complex p34 subunit" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q13889 GTF2H3 "General transcription factor IIH subunit 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1277143 Gtf2h3 "general transcription factor IIH, polypeptide 3" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
AT1G18340
basal transcription factor complex subunit-related; basal transcription factor complex subunit-related; FUNCTIONS IN- general RNA polymerase II transcription factor activity; INVOLVED IN- DNA repair, regulation of transcription, DNA-dependent; LOCATED IN- core TFIIH complex; EXPRESSED IN- 17 plant structures; EXPRESSED DURING- 9 growth stages; CONTAINS InterPro DOMAIN/s- Transcription factor Tfb4 (InterPro-IPR004600); Has 258 Blast hits to 253 proteins in 126 species- Archae - 0; Bacteria - 0; Metazoa - 105; Fungi - 95; Plants - 19; Viruses - 0; Other Eukaryotes - 39 (source- NCBI BLink). (301 aa)
(Arabidopsis thaliana)
Predicted Functional Partners:
UVH6
UVH6 (ULTRAVIOLET HYPERSENSITIVE 6); ATP binding / ATP-dependent DNA helicase/ ATP-dependent he [...] (758 aa)
    0.998
AT4G17020
transcription factor-related; transcription factor-related; FUNCTIONS IN- RNA polymerase II tra [...] (462 aa)
     0.991
AT1G55750
transcription factor-related; transcription factor-related; LOCATED IN- cellular_component unkn [...] (591 aa)
      0.981
GTF2H2
GTF2H2 (GENERAL TRANSCRIPTION FACTOR IIH 2); general RNA polymerase II transcription factor; Me [...] (421 aa)
    0.972
CYCH;1
CYCH;1 (CYCLIN H;1); cyclin-dependent protein kinase/ protein binding / protein kinase; core ce [...] (336 aa)
    0.970
SPT42
SPT42 (SPT4 HOMOLOG 2); positive transcription elongation factor/ zinc ion binding; SPT4 HOMOLO [...] (116 aa)
      0.958
CAK4
CAK4 (CDK-ACTIVATING KINASE 4); kinase/ protein binding / protein serine/threonine kinase; CDK- [...] (348 aa)
      0.954
TFIIA-S
transcription initiation factor IIA gamma chain / TFIIA-gamma (TFIIA-S); transcription initiati [...] (106 aa)
      0.953
NRPB1
NRPB1 (RNA POLYMERASE II LARGE SUBUNIT); DNA binding / DNA-directed RNA polymerase; Encodes the [...] (1840 aa)
      0.944
TAF13
TAF13 (TBP-ASSOCIATED FACTOR 13); DNA binding / RNA polymerase II transcription factor; TBP-ASS [...] (126 aa)
      0.943

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query213
pfam03850270 pfam03850, Tfb4, Transcription factor Tfb4 1e-91
TIGR00627279 TIGR00627, tfb4, transcription factor tfb4 1e-47
COG5242296 COG5242, TFB4, RNA polymerase II transcription ini 7e-40
>gnl|CDD|217761 pfam03850, Tfb4, Transcription factor Tfb4 Back     alignment and domain information
 Score =  269 bits (690), Expect = 1e-91
 Identities = 91/184 (49%), Positives = 119/184 (64%), Gaps = 7/184 (3%)

Query: 7   TLLQNLEEFMNKDEQLGKQEPEGRIACSLLSGSLSMALCYIQRVFRSG--LLHPQPRILC 64
           T+L+ L + ++   +            S L+G+LS+ALCYI RV R        + RIL 
Sbjct: 92  TVLEELRKLLSSTSKDEDATET-----STLAGALSLALCYINRVSRLDTAGTSLKSRILV 146

Query: 65  LQGSPDGPEQYVAIMNAIFSAQRSMVPIDSCYLGAQNSAFLQQASYITGGVHHKPQQLDG 124
           L GSPD   QY+ IMN+IF+AQ+  +PID C LG ++S+FLQQA+ ITGGV+    + DG
Sbjct: 147 LSGSPDSASQYIPIMNSIFAAQKLKIPIDVCKLGGEDSSFLQQAADITGGVYLHVTEPDG 206

Query: 125 LFQYLLTIFGTDLHSRNFLQLPKPVGVDFRASCFCHKNTIDMGYICSVCLSIYCKHLKKC 184
           L QYLLT F  D  SR+ L LP P  VDFRASCFCH+  +D+GY+CSVCLSI+C+    C
Sbjct: 207 LLQYLLTAFLPDPSSRSHLVLPTPSSVDFRASCFCHRKVVDIGYVCSVCLSIFCEIPPIC 266

Query: 185 STCG 188
            TCG
Sbjct: 267 PTCG 270


This family appears to be distantly related to the VWA domain. Length = 270

>gnl|CDD|233059 TIGR00627, tfb4, transcription factor tfb4 Back     alignment and domain information
>gnl|CDD|227567 COG5242, TFB4, RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB4 [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 213
PF03850276 Tfb4: Transcription factor Tfb4; InterPro: IPR0046 100.0
TIGR00627279 tfb4 transcription factor tfb4. This family is bas 100.0
KOG2487314 consensus RNA polymerase II transcription initiati 100.0
COG5242296 TFB4 RNA polymerase II transcription initiation/nu 100.0
KOG2807378 consensus RNA polymerase II transcription initiati 100.0
COG5151421 SSL1 RNA polymerase II transcription initiation/nu 99.93
PF04056193 Ssl1: Ssl1-like; InterPro: IPR007198 Ssl1-like pro 99.85
cd01453183 vWA_transcription_factor_IIH_type Transcription fa 99.17
TIGR00622112 ssl1 transcription factor ssl1. This family is bas 98.62
cd01452187 VWA_26S_proteasome_subunit 26S proteasome plays a 98.19
cd01467180 vWA_BatA_type VWA BatA type: Von Willebrand factor 98.06
cd01455191 vWA_F11C1-5a_type Von Willebrand factor type A (vW 97.97
cd01461171 vWA_interalpha_trypsin_inhibitor vWA_interalpha tr 97.95
cd01465170 vWA_subgroup VWA subgroup: Von Willebrand factor t 97.91
PRK13685326 hypothetical protein; Provisional 97.84
PF13519172 VWA_2: von Willebrand factor type A domain; PDB: 3 97.8
TIGR03436296 acidobact_VWFA VWFA-related Acidobacterial domain. 97.59
cd01466155 vWA_C3HC4_type VWA C3HC4-type: Von Willebrand fact 97.57
cd01456206 vWA_ywmD_type VWA ywmD type:Von Willebrand factor 97.51
cd01451178 vWA_Magnesium_chelatase Magnesium chelatase: Mg-ch 97.43
smart00327177 VWA von Willebrand factor (vWF) type A domain. VWA 97.04
TIGR00868 863 hCaCC calcium-activated chloride channel protein 1 97.04
PF13768155 VWA_3: von Willebrand factor type A domain 96.95
cd01463190 vWA_VGCC_like VWA Voltage gated Calcium channel li 96.93
cd01470198 vWA_complement_factors Complement factors B and C2 96.74
cd01480186 vWA_collagen_alpha_1-VI-type VWA_collagen alpha(VI 96.68
cd01474185 vWA_ATR ATR (Anthrax Toxin Receptor): Anthrax toxi 96.62
cd01472164 vWA_collagen von Willebrand factor (vWF) type A do 96.43
cd00198161 vWFA Von Willebrand factor type A (vWA) domain was 96.33
cd01450161 vWFA_subfamily_ECM Von Willebrand factor type A (v 96.19
TIGR03788596 marine_srt_targ marine proteobacterial sortase tar 95.86
PF04811243 Sec23_trunk: Sec23/Sec24 trunk domain; InterPro: I 95.67
cd01482164 vWA_collagen_alphaI-XII-like Collagen: The extrace 95.56
cd01477193 vWA_F09G8-8_type VWA F09G8.8 type: Von Willebrand 95.01
PTZ00441 576 sporozoite surface protein 2 (SSP2); Provisional 94.82
cd01473192 vWA_CTRP CTRP for CS protein-TRAP-related protein: 94.68
PRK13406584 bchD magnesium chelatase subunit D; Provisional 94.67
PF09538108 FYDLN_acid: Protein of unknown function (FYDLN_aci 94.18
KOG2884259 consensus 26S proteasome regulatory complex, subun 94.02
PRK12496164 hypothetical protein; Provisional 93.96
cd01475224 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, 93.74
cd0072934 rubredoxin_SM Rubredoxin, Small Modular nonheme ir 93.53
cd01468239 trunk_domain trunk domain. COPII-coated vesicles c 93.44
TIGR02442633 Cob-chelat-sub cobaltochelatase subunit. A number 92.92
cd01469177 vWA_integrins_alpha_subunit Integrins are a class 92.91
cd01479244 Sec24-like Sec24-like: Protein and membrane traffi 92.62
COG5148243 RPN10 26S proteasome regulatory complex, subunit R 92.56
cd0035033 rubredoxin_like Rubredoxin_like; nonheme iron bind 91.9
cd01471186 vWA_micronemal_protein Micronemal proteins: The To 91.63
COG1592166 Rubrerythrin [Energy production and conversion] 91.08
TIGR02031589 BchD-ChlD magnesium chelatase ATPase subunit D. Th 90.76
cd01458218 vWA_ku Ku70/Ku80 N-terminal domain. The Ku78 heter 89.85
TIGR00373158 conserved hypothetical protein TIGR00373. This fam 89.15
PF0519136 ADK_lid: Adenylate kinase, active site lid; InterP 88.85
cd01464176 vWA_subfamily VWA subfamily: Von Willebrand factor 88.67
TIGR02300129 FYDLN_acid conserved hypothetical protein TIGR0230 88.55
PRK06266178 transcription initiation factor E subunit alpha; V 88.01
PF1057126 UPF0547: Uncharacterised protein family UPF0547; I 87.31
PRK0039846 rpoP DNA-directed RNA polymerase subunit P; Provis 87.14
cd01478267 Sec23-like Sec23-like: Protein and membrane traffi 85.64
cd01462152 VWA_YIEM_type VWA YIEM type: Von Willebrand factor 85.6
COG4867652 Uncharacterized protein with a von Willebrand fact 85.3
cd01476163 VWA_integrin_invertebrates VWA_integrin (invertebr 84.9
cd01454174 vWA_norD_type norD type: Denitrifying bacteria con 84.49
PF00092178 VWA: von Willebrand factor type A domain; InterPro 83.49
PF1324826 zf-ribbon_3: zinc-ribbon domain 83.27
PLN00162 761 transport protein sec23; Provisional 82.56
cd0073050 rubredoxin Rubredoxin; nonheme iron binding domain 82.51
PF1324023 zinc_ribbon_2: zinc-ribbon domain 81.28
>PF03850 Tfb4: Transcription factor Tfb4; InterPro: IPR004600 Members of this family are part of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair Back     alignment and domain information
Probab=100.00  E-value=9e-59  Score=409.64  Aligned_cols=179  Identities=51%  Similarity=0.925  Sum_probs=164.8

Q ss_pred             HHHHHHHHHHHHhhhhccCCCCCCCcccccchHhHHHHHHHHHhhhhhcCC---CCCCcEEEE-EecCCCCCcchhhHHH
Q 028156            5 CATLLQNLEEFMNKDEQLGKQEPEGRIACSLLSGSLSMALCYIQRVFRSGL---LHPQPRILC-LQGSPDGPEQYVAIMN   80 (213)
Q Consensus         5 ~~~i~~~l~~l~~~~~~~~~~~~~~~~~~s~L~~aLs~ALc~inr~~~~~~---~~~~~rILi-is~S~d~~~qyi~imn   80 (213)
                      -+.|.++++++++++.+.+..     +.++.|+|||++|||||||+.++..   ..+++|||| +++|+|.+.||+++||
T Consensus        92 ~~~v~~~l~~l~~~~~~~~~~-----~~~s~LagALS~ALCyINR~~~~~~~~~~~~~~RILv~~s~s~d~~~QYi~~MN  166 (276)
T PF03850_consen   92 DETVLEELKKLMSETSESSDS-----TTSSLLAGALSMALCYINRISRESPSGGTSLKSRILVIVSGSPDSSSQYIPLMN  166 (276)
T ss_pred             HHHHHHHHHHHHhhccccccc-----ccchhhHHHHHHHHHHHhhhhhcccCCCCCcCccEEEEEecCCCccHHHHHHHH
Confidence            355889999999886655432     2238999999999999999987654   489999999 8999999999999999


Q ss_pred             HHHHHHhCCeeeeEEEcCCcChHHHHHHHHhhCCeeeccCCcchHHHHHHHHcCCCchhhcccCCCCCCCCCCceeeeec
Q 028156           81 AIFSAQRSMVPIDSCYLGAQNSAFLQQASYITGGVHHKPQQLDGLFQYLLTIFGTDLHSRNFLQLPKPVGVDFRASCFCH  160 (213)
Q Consensus        81 ~if~aqk~~I~Idv~~L~~~e~~iLqq~~~~TgG~Y~~~~~~~~l~~~Ll~~~~p~~~~r~~l~~P~~~~vd~~a~C~CH  160 (213)
                      +||+|||++|+||||.|+..++.|||||||+|||+|+.+.++++|+||||++|+|++.+|+.+.+|.+..|||||+||||
T Consensus       167 ~iFaAqk~~v~IDv~~L~~~~s~fLqQa~d~T~G~y~~~~~~~~l~q~L~~~fl~~~~~R~~l~~p~~~~vd~ra~Cfch  246 (276)
T PF03850_consen  167 CIFAAQKQKVPIDVCKLGGKDSTFLQQASDITGGIYLKVSKPEGLLQYLLTAFLPDPSSRSFLILPTQSSVDFRASCFCH  246 (276)
T ss_pred             HHHHHhcCCceeEEEEecCCchHHHHHHHHHhCceeeccCccccHHHHHHHhhcCCHHHHhhccCCCCCCCCcceeeeec
Confidence            99999999999999999755999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cCcccceeEcCCCCccccCCC--Ccccccc
Q 028156          161 KNTIDMGYICSVCLSIYCKHL--KKCSTCG  188 (213)
Q Consensus       161 ~~~v~~GyvCp~Clsi~C~~p--~~C~~C~  188 (213)
                      ++++|+|||||+||||||++|  .+|+|||
T Consensus       247 ~k~vd~g~vCsvCLsIfc~~p~~~~C~tC~  276 (276)
T PF03850_consen  247 RKVVDIGYVCSVCLSIFCEFPDGGICPTCG  276 (276)
T ss_pred             CCcccceeEchhhhhhhhCCCCCCCCCCCC
Confidence            999999999999999999997  3999997



The core-TFIIH basal transcription factor complex has six subunits, this is the p34 subunit.; GO: 0006281 DNA repair, 0006355 regulation of transcription, DNA-dependent, 0000439 core TFIIH complex

>TIGR00627 tfb4 transcription factor tfb4 Back     alignment and domain information
>KOG2487 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB4 [Transcription; Replication, recombination and repair] Back     alignment and domain information
>COG5242 TFB4 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB4 [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG2807 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription; Replication, recombination and repair] Back     alignment and domain information
>COG5151 SSL1 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PF04056 Ssl1: Ssl1-like; InterPro: IPR007198 Ssl1-like proteins are 40 kDa subunits of the transcription factor II H complex Back     alignment and domain information
>cd01453 vWA_transcription_factor_IIH_type Transcription factors IIH type: TFIIH is a multiprotein complex that is one of the five general transcription factors that binds RNA polymerase II holoenzyme Back     alignment and domain information
>TIGR00622 ssl1 transcription factor ssl1 Back     alignment and domain information
>cd01452 VWA_26S_proteasome_subunit 26S proteasome plays a major role in eukaryotic protein breakdown, especially for ubiquitin-tagged proteins Back     alignment and domain information
>cd01467 vWA_BatA_type VWA BatA type: Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) Back     alignment and domain information
>cd01455 vWA_F11C1-5a_type Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) Back     alignment and domain information
>cd01461 vWA_interalpha_trypsin_inhibitor vWA_interalpha trypsin inhibitor (ITI): ITI is a glycoprotein composed of three polypeptides- two heavy chains and one light chain (bikunin) Back     alignment and domain information
>cd01465 vWA_subgroup VWA subgroup: Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) Back     alignment and domain information
>PRK13685 hypothetical protein; Provisional Back     alignment and domain information
>PF13519 VWA_2: von Willebrand factor type A domain; PDB: 3IBS_B 3RAG_B 2X5N_A Back     alignment and domain information
>TIGR03436 acidobact_VWFA VWFA-related Acidobacterial domain Back     alignment and domain information
>cd01466 vWA_C3HC4_type VWA C3HC4-type: Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) Back     alignment and domain information
>cd01456 vWA_ywmD_type VWA ywmD type:Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) Back     alignment and domain information
>cd01451 vWA_Magnesium_chelatase Magnesium chelatase: Mg-chelatase catalyses the insertion of Mg into protoporphyrin IX (Proto) Back     alignment and domain information
>smart00327 VWA von Willebrand factor (vWF) type A domain Back     alignment and domain information
>TIGR00868 hCaCC calcium-activated chloride channel protein 1 Back     alignment and domain information
>PF13768 VWA_3: von Willebrand factor type A domain Back     alignment and domain information
>cd01463 vWA_VGCC_like VWA Voltage gated Calcium channel like: Voltage-gated calcium channels are a complex of five proteins: alpha 1, beta 1, gamma, alpha 2 and delta Back     alignment and domain information
>cd01470 vWA_complement_factors Complement factors B and C2 are two critical proteases for complement activation Back     alignment and domain information
>cd01480 vWA_collagen_alpha_1-VI-type VWA_collagen alpha(VI) type: The extracellular matrix represents a complex alloy of variable members of diverse protein families defining structural integrity and various physiological functions Back     alignment and domain information
>cd01474 vWA_ATR ATR (Anthrax Toxin Receptor): Anthrax toxin is a key virulence factor for Bacillus anthracis, the causative agent of anthrax Back     alignment and domain information
>cd01472 vWA_collagen von Willebrand factor (vWF) type A domain; equivalent to the I-domain of integrins Back     alignment and domain information
>cd00198 vWFA Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) Back     alignment and domain information
>cd01450 vWFA_subfamily_ECM Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) Back     alignment and domain information
>TIGR03788 marine_srt_targ marine proteobacterial sortase target protein Back     alignment and domain information
>PF04811 Sec23_trunk: Sec23/Sec24 trunk domain; InterPro: IPR006896 COPII (coat protein complex II)-coated vesicles carry proteins from the endoplasmic reticulum (ER) to the Golgi complex [] Back     alignment and domain information
>cd01482 vWA_collagen_alphaI-XII-like Collagen: The extracellular matrix represents a complex alloy of variable members of diverse protein families defining structural integrity and various physiological functions Back     alignment and domain information
>cd01477 vWA_F09G8-8_type VWA F09G8 Back     alignment and domain information
>PTZ00441 sporozoite surface protein 2 (SSP2); Provisional Back     alignment and domain information
>cd01473 vWA_CTRP CTRP for CS protein-TRAP-related protein: Adhesion of Plasmodium to host cells is an important phenomenon in parasite invasion and in malaria associated pathology Back     alignment and domain information
>PRK13406 bchD magnesium chelatase subunit D; Provisional Back     alignment and domain information
>PF09538 FYDLN_acid: Protein of unknown function (FYDLN_acid); InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues Back     alignment and domain information
>KOG2884 consensus 26S proteasome regulatory complex, subunit RPN10/PSMD4 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK12496 hypothetical protein; Provisional Back     alignment and domain information
>cd01475 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, extracellular matrix molecules mediate cell-matrix and matrix-matrix interactions thereby providing tissue integrity Back     alignment and domain information
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase Back     alignment and domain information
>cd01468 trunk_domain trunk domain Back     alignment and domain information
>TIGR02442 Cob-chelat-sub cobaltochelatase subunit Back     alignment and domain information
>cd01469 vWA_integrins_alpha_subunit Integrins are a class of adhesion receptors that link the extracellular matrix to the cytoskeleton and cooperate with growth factor receptors to promote celll survival, cell cycle progression and cell migration Back     alignment and domain information
>cd01479 Sec24-like Sec24-like: Protein and membrane traffic in eukaryotes is mediated by at least in part by the budding and fusion of intracellular transport vesicles that selectively carry cargo proteins and lipids from donor to acceptor organelles Back     alignment and domain information
>COG5148 RPN10 26S proteasome regulatory complex, subunit RPN10/PSMD4 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center Back     alignment and domain information
>cd01471 vWA_micronemal_protein Micronemal proteins: The Toxoplasma lytic cycle begins when the parasite actively invades a target cell Back     alignment and domain information
>COG1592 Rubrerythrin [Energy production and conversion] Back     alignment and domain information
>TIGR02031 BchD-ChlD magnesium chelatase ATPase subunit D Back     alignment and domain information
>cd01458 vWA_ku Ku70/Ku80 N-terminal domain Back     alignment and domain information
>TIGR00373 conserved hypothetical protein TIGR00373 Back     alignment and domain information
>PF05191 ADK_lid: Adenylate kinase, active site lid; InterPro: IPR007862 Adenylate kinases (ADK; 2 Back     alignment and domain information
>cd01464 vWA_subfamily VWA subfamily: Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) Back     alignment and domain information
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300 Back     alignment and domain information
>PRK06266 transcription initiation factor E subunit alpha; Validated Back     alignment and domain information
>PF10571 UPF0547: Uncharacterised protein family UPF0547; InterPro: IPR018886 This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines Back     alignment and domain information
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional Back     alignment and domain information
>cd01478 Sec23-like Sec23-like: Protein and membrane traffic in eukaryotes is mediated by at least in part by the budding and fusion of intracellular transport vesicles that selectively carry cargo proteins and lipids from donor to acceptor organelles Back     alignment and domain information
>cd01462 VWA_YIEM_type VWA YIEM type: Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) Back     alignment and domain information
>COG4867 Uncharacterized protein with a von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>cd01476 VWA_integrin_invertebrates VWA_integrin (invertebrates): Integrins are a family of cell surface receptors that have diverse functions in cell-cell and cell-extracellular matrix interactions Back     alignment and domain information
>cd01454 vWA_norD_type norD type: Denitrifying bacteria contain both membrane bound and periplasmic nitrate reductases Back     alignment and domain information
>PF00092 VWA: von Willebrand factor type A domain; InterPro: IPR002035 The von Willebrand factor is a large multimeric glycoprotein found in blood plasma Back     alignment and domain information
>PF13248 zf-ribbon_3: zinc-ribbon domain Back     alignment and domain information
>PLN00162 transport protein sec23; Provisional Back     alignment and domain information
>cd00730 rubredoxin Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center Back     alignment and domain information
>PF13240 zinc_ribbon_2: zinc-ribbon domain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query213
1shu_X182 Anthrax toxin receptor 2; alpha/beta rossmann fold 98.08
3ibs_A218 Conserved hypothetical protein BATB; structural ge 98.05
2x5n_A192 SPRPN10, 26S proteasome regulatory subunit RPN10; 97.7
4b4t_W268 RPN10, 26S proteasome regulatory subunit RPN10; hy 97.62
4fx5_A 464 VON willebrand factor type A; structural genomics, 97.59
1n3y_A198 Integrin alpha-X; alpha/beta rossmann fold, cell a 97.54
1q0p_A223 Complement factor B; VON willebrand factor, MAC-1, 97.27
3rag_A242 Uncharacterized protein; structural genomics, PSI- 97.2
1ijb_A202 VON willebrand factor; dinucleotide-binding fold, 97.11
2b2x_A223 Integrin alpha-1; computational design, antibody-a 97.06
4hqf_A281 Thrombospondin-related anonymous protein, trap; ma 96.91
3n2n_F185 Anthrax toxin receptor 1; rossmann fold; 1.80A {Ho 96.87
1atz_A189 VON willebrand factor; collagen-binding, hemostasi 96.71
1pt6_A213 Integrin alpha-1; cell adhesion; 1.87A {Homo sapie 96.7
1v7p_C200 Integrin alpha-2; snake venom, C-type lectin, anta 96.67
1mf7_A194 Integrin alpha M; cell adhesion; 1.25A {Homo sapie 96.52
1rrk_A 497 Complement factor B; BB, hydrolase; 2.00A {Homo sa 96.44
4hqo_A266 Sporozoite surface protein 2; malaria, gliding mot 96.4
2odp_A 509 Complement C2; C3/C5 convertase, complement serin 96.05
3hrz_D 741 Complement factor B; serine protease, glycosilated 95.92
2x31_A189 Magnesium-chelatase 60 kDa subunit; ligase, bacter 94.03
3k6s_A 1095 Integrin alpha-X; cell receptor, adhesion molecule 92.93
1jey_B 565 KU80; double-strand DNA break repair, non-homologo 92.49
6rxn_A46 Rubredoxin; electron transfer(iron-sulfur protein) 92.32
2lcq_A165 Putative toxin VAPC6; PIN domain, Zn ribbon domain 92.32
2nut_A 769 Protein transport protein SEC23A; human copii SEC2 91.64
3pwf_A170 Rubrerythrin; non heme iron peroxidases, oxidative 91.27
2xgg_A178 Microneme protein 2; A/I domain, cell adhesion, hy 90.73
3zqk_A199 VON willebrand factor; blood clotting, adamts-13, 90.2
1lko_A191 Rubrerythrin all-iron(II) form; reduced form, DIIR 89.81
1mjn_A179 Integrin alpha-L; rossmann fold, immune system; 1. 89.68
1pcx_A 810 Protein transport protein SEC24; 2.50A {Saccharomy 89.26
2v3b_B55 Rubredoxin 2, rubredoxin; alkane degradation, iron 89.23
2kn9_A81 Rubredoxin; metalloprotein, ssgcid, structural gen 88.51
3eh2_A 766 Protein transport protein SEC24C; copii-coat prote 88.47
3efo_B 770 SEC24 related gene family, member D; copii, coat p 88.0
1yk4_A52 Rubredoxin, RD; electron transport; 0.69A {Pyrococ 87.49
1m2o_A 768 SEC23, protein transport protein SEC23, SEC23P; zi 87.4
4rxn_A54 Rubredoxin; electron transfer(iron-sulfur protein) 87.31
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 87.27
1e8j_A52 Rubredoxin; iron-sulfur-protein, zinc-substitution 86.25
1yuz_A202 Nigerythrin; rubrythrin, rubredoxin, hemerythrin, 86.24
1dx8_A70 Rubredoxin; electron transport, zinc-substitution; 85.91
3eh1_A 751 Protein transport protein SEC24B; copii coat prote 85.85
1s24_A87 Rubredoxin 2; electron transport; NMR {Pseudomonas 84.97
>1shu_X Anthrax toxin receptor 2; alpha/beta rossmann fold, membrane protein; 1.50A {Homo sapiens} SCOP: c.62.1.1 PDB: 1tzn_a 1sht_X 1t6b_Y* Back     alignment and structure
Probab=98.08  E-value=5.2e-05  Score=59.60  Aligned_cols=96  Identities=11%  Similarity=-0.040  Sum_probs=70.6

Q ss_pred             ccchHhHHHHHHHHHhhhhhcCCCCCCcEEEEEecCCCCCcchhhHHHHHHHHHhCCeeeeEEEcCCcChHHHHHHHHhh
Q 028156           33 CSLLSGSLSMALCYIQRVFRSGLLHPQPRILCLQGSPDGPEQYVAIMNAIFSAQRSMVPIDSCYLGAQNSAFLQQASYIT  112 (213)
Q Consensus        33 ~s~L~~aLs~ALc~inr~~~~~~~~~~~rILiis~S~d~~~qyi~imn~if~aqk~~I~Idv~~L~~~e~~iLqq~~~~T  112 (213)
                      .+.+..||..|+..+.+..+   ....+.|++|+-..+.......+...+..+++.+|+|.++++|..+...|++++..|
T Consensus        81 ~T~~~~al~~a~~~l~~~~~---~~~~~~iiliTDG~~~~~~~~~~~~~~~~~~~~~i~i~~igvg~~~~~~L~~ia~~~  157 (182)
T 1shu_X           81 ETYIHEGLKLANEQIQKAGG---LKTSSIIIALTDGKLDGLVPSYAEKEAKISRSLGASVYCVGVLDFEQAQLERIADSK  157 (182)
T ss_dssp             CCCHHHHHHHHHHHHHHHTG---GGSCEEEEEEECCCCCTTHHHHHHHHHHHHHHTTCEEEEEECSSCCHHHHHHHSSSG
T ss_pred             CchHHHHHHHHHHHHHhccC---CCCCeEEEEECCCCcCCCCchhHHHHHHHHHhCCCEEEEEeCCcCCHHHHHHHhCCC
Confidence            56789999999998876521   134456666663332322223345677888999999999999877899999999999


Q ss_pred             CCeeeccCCcchHHHHHHH
Q 028156          113 GGVHHKPQQLDGLFQYLLT  131 (213)
Q Consensus       113 gG~Y~~~~~~~~l~~~Ll~  131 (213)
                      ||.|.+..+.+.|.+.+-.
T Consensus       158 ~~~~~~~~~~~~L~~~~~~  176 (182)
T 1shu_X          158 EQVFPVKGGFQALKGIINS  176 (182)
T ss_dssp             GGEEESSSTTHHHHHHHHH
T ss_pred             CceEEccCCHHHHHHHHHH
Confidence            9999998787777666543



>3ibs_A Conserved hypothetical protein BATB; structural genomics, protein structure, midwest center for S genomics, MCSG, PSI-2; HET: MSE; 2.10A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2x5n_A SPRPN10, 26S proteasome regulatory subunit RPN10; nuclear protein, nucleus, ubiquitin; 1.30A {Schizosaccharomyces pombe} Back     alignment and structure
>4b4t_W RPN10, 26S proteasome regulatory subunit RPN10; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4fx5_A VON willebrand factor type A; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, blood clotting; HET: MSE; 1.73A {Catenulispora acidiphila} Back     alignment and structure
>1n3y_A Integrin alpha-X; alpha/beta rossmann fold, cell adhesion; 1.65A {Homo sapiens} SCOP: c.62.1.1 Back     alignment and structure
>1q0p_A Complement factor B; VON willebrand factor, MAC-1, I domain, A domain, hydrolase; 1.80A {Homo sapiens} SCOP: c.62.1.1 Back     alignment and structure
>3rag_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tructural genomics; 1.80A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>1ijb_A VON willebrand factor; dinucleotide-binding fold, blood clotting; 1.80A {Homo sapiens} SCOP: c.62.1.1 PDB: 1ijk_A 1auq_A 1u0n_A 3hxo_A 1uex_C 3hxq_A 1sq0_A 1m10_A 1fns_A 1oak_A 1u0o_C Back     alignment and structure
>2b2x_A Integrin alpha-1; computational design, antibody-antigen complex, immune syste; 2.20A {Rattus norvegicus} SCOP: c.62.1.1 Back     alignment and structure
>4hqf_A Thrombospondin-related anonymous protein, trap; malaria, parasite motility, I domain, TSR domain, receptor O sporozoite, vaccine target; 2.20A {Plasmodium falciparum} PDB: 4hqk_A 2bbx_A Back     alignment and structure
>3n2n_F Anthrax toxin receptor 1; rossmann fold; 1.80A {Homo sapiens} SCOP: c.62.1.1 Back     alignment and structure
>1atz_A VON willebrand factor; collagen-binding, hemostasis, dinucleotide binding fold; 1.80A {Homo sapiens} SCOP: c.62.1.1 PDB: 4dmu_B 2adf_A 1fe8_A 1ao3_A Back     alignment and structure
>1pt6_A Integrin alpha-1; cell adhesion; 1.87A {Homo sapiens} SCOP: c.62.1.1 PDB: 4a0q_A 1qcy_A 1qc5_A 1qc5_B 1ck4_A 1mhp_A Back     alignment and structure
>1v7p_C Integrin alpha-2; snake venom, C-type lectin, antagonist, cell adhes glycoprotein, toxin-cell adhesion complex; HET: NAG; 1.90A {Homo sapiens} SCOP: c.62.1.1 PDB: 1aox_A 1dzi_A Back     alignment and structure
>1mf7_A Integrin alpha M; cell adhesion; 1.25A {Homo sapiens} SCOP: c.62.1.1 PDB: 1na5_A 1jlm_A 1ido_A 1m1u_A 3q3g_G 1n9z_A 1bhq_1 1bho_1 1idn_1 3qa3_G Back     alignment and structure
>1rrk_A Complement factor B; BB, hydrolase; 2.00A {Homo sapiens} SCOP: b.47.1.2 c.62.1.1 PDB: 1rs0_A* 1rtk_A* 2win_I* 1dle_A Back     alignment and structure
>4hqo_A Sporozoite surface protein 2; malaria, gliding motility, VWA domain, TSR domain, extensibl ribbon, receptor on sporozoite, vaccine target; HET: FUC BGC; 2.19A {Plasmodium vivax} PDB: 4hql_A* 4hqn_A* Back     alignment and structure
>2odp_A Complement C2; C3/C5 convertase, complement serin protease, human complement system, glycoprotein, SP, VWFA,; HET: NAG; 1.90A {Homo sapiens} PDB: 2odq_A* 2i6q_A* 2i6s_A* Back     alignment and structure
>3hrz_D Complement factor B; serine protease, glycosilated, multi-domain, complement SYST convertase, complement alternate pathway; HET: NAG P6G; 2.20A {Homo sapiens} PDB: 2xwj_I* 3hs0_D* 2ok5_A* 2xwb_F* Back     alignment and structure
>2x31_A Magnesium-chelatase 60 kDa subunit; ligase, bacteriochlorophyll biosynthesis, photosynthesis; 7.50A {Rhodobacter capsulatus} Back     alignment and structure
>3k6s_A Integrin alpha-X; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_A* 3k72_A* Back     alignment and structure
>1jey_B KU80; double-strand DNA break repair, non-homologous END-joining, protein/nucleic acid complex, alpha/beta domain, beta barrel; HET: DNA; 2.50A {Homo sapiens} SCOP: b.131.1.2 c.62.1.4 PDB: 1jeq_B* Back     alignment and structure
>6rxn_A Rubredoxin; electron transfer(iron-sulfur protein); 1.50A {Desulfovibrio desulfuricans} SCOP: g.41.5.1 Back     alignment and structure
>2lcq_A Putative toxin VAPC6; PIN domain, Zn ribbon domain, ribosome biogenesis, metal BIN protein; NMR {Pyrococcus horikoshii} Back     alignment and structure
>2nut_A Protein transport protein SEC23A; human copii SEC23/24 complexed with SEC22, protein transport; 2.30A {Homo sapiens} PDB: 2nup_A 3egd_A 3eg9_A 3egx_A 3efo_A Back     alignment and structure
>3pwf_A Rubrerythrin; non heme iron peroxidases, oxidative stress, oxidoreductase; 1.64A {Pyrococcus furiosus} PDB: 3mps_A 3pza_A 3qvd_A 1nnq_A 2hr5_A Back     alignment and structure
>2xgg_A Microneme protein 2; A/I domain, cell adhesion, hydrolase; 2.05A {Toxoplasma gondii} Back     alignment and structure
>3zqk_A VON willebrand factor; blood clotting, adamts-13, force sensor, VON willebrand DISE domain, haemostasis; HET: NAG; 1.70A {Homo sapiens} PDB: 3ppv_A 3ppx_A 3ppw_A 3ppy_A 3gxb_A* Back     alignment and structure
>1lko_A Rubrerythrin all-iron(II) form; reduced form, DIIRON, four-helix bundle, rubre like, electron transport; 1.63A {Desulfovibrio vulgaris} SCOP: a.25.1.1 g.41.5.1 PDB: 1dvb_A 1jyb_A 1b71_A 1lkm_A 1lkp_A 1qyb_A 1s2z_A 1s30_A 1ryt_A Back     alignment and structure
>1mjn_A Integrin alpha-L; rossmann fold, immune system; 1.30A {Homo sapiens} SCOP: c.62.1.1 PDB: 3hi6_A 1mq8_B* 3eoa_I 3eob_I 1rd4_A* 1lfa_A 1zon_A 1zoo_A 1zop_A 1dgq_A 1xdd_A* 1xdg_A* 1xuo_A* 3e2m_A* 3bqn_B* 1cqp_A* 3bqm_B* 2ica_A* 2o7n_A* 3m6f_A* ... Back     alignment and structure
>1pcx_A Protein transport protein SEC24; 2.50A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 PDB: 1pd0_A 1pd1_A Back     alignment and structure
>2v3b_B Rubredoxin 2, rubredoxin; alkane degradation, iron-sulfur protein, oxidoreductase, ELE transfer, electron transport, FAD, NAD, iron; HET: FAD; 2.45A {Pseudomonas aeruginosa} Back     alignment and structure
>2kn9_A Rubredoxin; metalloprotein, ssgcid, structural genomics, seattle structural genomics center for infectious electron transport, iron; NMR {Mycobacterium tuberculosis} Back     alignment and structure
>3eh2_A Protein transport protein SEC24C; copii-coat protein, vesicle transport, cytoplasm, endoplasmic reticulum, ER-golgi transport, golgi apparatus; 2.35A {Homo sapiens} Back     alignment and structure
>3efo_B SEC24 related gene family, member D; copii, coat protein, transport signal, disease mutation, endoplasmic reticulum, ER-golgi transport, golgi apparatus, membrane; 2.70A {Homo sapiens} PDB: 3eg9_B Back     alignment and structure
>1yk4_A Rubredoxin, RD; electron transport; 0.69A {Pyrococcus abyssi} PDB: 2pya_A 1yk5_A 1bq8_A 1bq9_A* 3kyu_A 3kyv_A 3kyw_A 3kyx_A 3kyy_A 3ryg_A 3rz6_A 3rzt_A 3ss2_A 1brf_A 1caa_A 1cad_A 1vcx_A 1zrp_A 1iu5_A 1iu6_A ... Back     alignment and structure
>1m2o_A SEC23, protein transport protein SEC23, SEC23P; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 PDB: 1m2v_A 2qtv_A* Back     alignment and structure
>4rxn_A Rubredoxin; electron transfer(iron-sulfur protein); 1.20A {Clostridium pasteurianum} SCOP: g.41.5.1 PDB: 5rxn_A 1bfy_A 1fhh_A 1fhm_A 1irn_A 1iro_A 1r0f_A 1r0g_A 1r0h_A 1r0i_A 1r0j_A 1t9q_A 1c09_A 1b2j_A 1b13_A 1smm_A 1smu_A 1smw_A 1be7_A 1t9o_A ... Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Back     alignment and structure
>1e8j_A Rubredoxin; iron-sulfur-protein, zinc-substitution, thermostability; NMR {Desulfovibrio gigas} SCOP: g.41.5.1 PDB: 1rdg_A 2dsx_A 1spw_A Back     alignment and structure
>1yuz_A Nigerythrin; rubrythrin, rubredoxin, hemerythrin, electron transfer, DIIR center, oxidoreductase; 1.40A {Desulfovibrio vulgaris subsp} SCOP: a.25.1.1 g.41.5.1 PDB: 1yv1_A 1yux_A Back     alignment and structure
>1dx8_A Rubredoxin; electron transport, zinc-substitution; NMR {Guillardia theta} SCOP: g.41.5.1 PDB: 1h7v_A Back     alignment and structure
>3eh1_A Protein transport protein SEC24B; copii coat protein, vesicle transport, transport signal sequence, cytoplasm, endoplasmic reticulum; 1.80A {Homo sapiens} PDB: 2nut_B 2nup_B 3egd_B 3egx_B Back     alignment and structure
>1s24_A Rubredoxin 2; electron transport; NMR {Pseudomonas oleovorans} SCOP: g.41.5.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query213
d1shux_181 Capillary morphogenesis protein 2 domain {Human (H 96.92
d1atza_184 von Willebrand factor A3 domain, vWA3 {Human (Homo 95.47
d2qtva3271 Sec23 {Baker's yeast (Saccharomyces cerevisiae) [T 95.43
d1pd0a3252 Sec24 {Baker's yeast (Saccharomyces cerevisiae) [T 95.09
d1ijba_202 von Willebrand factor A1 domain, vWA1 {Human (Homo 94.52
d1yuza236 Nigerythrin, C-terminal domain {Desulfovibrio vulg 94.04
d1nnqa237 Rubrerythrin, C-terminal domain {Archaeon Pyrococc 93.64
d1jeyb2236 Ku80 subunit N-terminal domain {Human (Homo sapien 91.84
d1q0pa_209 Complement factor B domain {Human (Homo sapiens) [ 91.56
d1n3ya_189 Integrin alpha-x beta2 {Human (Homo sapiens) [TaxI 91.55
d2ak3a237 Microbial and mitochondrial ADK, insert "zinc fing 90.83
d1pt6a_192 Integrin alpha1-beta1 {Human (Homo sapiens) [TaxId 90.29
d1mf7a_194 Integrin alpha M (CR3, CD11b/CD18, Mac-1 alpha sub 89.12
d1jeya2220 Ku70 subunit N-terminal domain {Human (Homo sapien 88.78
d1zina235 Microbial and mitochondrial ADK, insert "zinc fing 87.07
d1lkoa244 Rubrerythrin, C-terminal domain {Desulfovibrio vul 86.85
d1akya238 Microbial and mitochondrial ADK, insert "zinc fing 86.26
d1s3ga235 Microbial and mitochondrial ADK, insert "zinc fing 84.81
d1e4va235 Microbial and mitochondrial ADK, insert "zinc fing 84.62
d1vd4a_62 Transcription initiation factor TFIIE-alpha {Human 84.32
d6rxna_45 Rubredoxin {Desulfovibrio desulfuricans, strain 27 82.42
d1v7pc_193 Integrin alpha2-beta1 {Human (Homo sapiens) [TaxId 81.58
>d1shux_ c.62.1.1 (X:) Capillary morphogenesis protein 2 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: vWA-like
superfamily: vWA-like
family: Integrin A (or I) domain
domain: Capillary morphogenesis protein 2 domain
species: Human (Homo sapiens) [TaxId: 9606]
Probab=96.92  E-value=0.0087  Score=45.29  Aligned_cols=94  Identities=12%  Similarity=-0.036  Sum_probs=66.5

Q ss_pred             ccchHhHHHHHHHHHhhhhhcCCCCCCcEEEEEecCCCCCcchhhHHHHHHHHHhCCeeeeEEEcCCcChHHHHHHHHhh
Q 028156           33 CSLLSGSLSMALCYIQRVFRSGLLHPQPRILCLQGSPDGPEQYVAIMNAIFSAQRSMVPIDSCYLGAQNSAFLQQASYIT  112 (213)
Q Consensus        33 ~s~L~~aLs~ALc~inr~~~~~~~~~~~rILiis~S~d~~~qyi~imn~if~aqk~~I~Idv~~L~~~e~~iLqq~~~~T  112 (213)
                      .+.+..||..|...+.+..+   ....+.|++|+-+.....+.-.+......+++.+|+|-+++++..+...|+++++.-
T Consensus        80 ~t~~~~al~~~~~~~~~~~~---~~~~~~ivliTDG~~~~~~~~~~~~~~~~~k~~gv~v~~vgig~~~~~~L~~ia~~~  156 (181)
T d1shux_          80 ETYIHEGLKLANEQIQKAGG---LKTSSIIIALTDGKLDGLVPSYAEKEAKISRSLGASVYCVGVLDFEQAQLERIADSK  156 (181)
T ss_dssp             CCCHHHHHHHHHHHHHHHTG---GGSCEEEEEEECCCCCTTHHHHHHHHHHHHHHTTCEEEEEECSSCCHHHHHHHSSSG
T ss_pred             cchHHHHHHHHHHHhhhccc---CCCceEEEEecCCCCCCCccHHHHHHHHHHHHCCCEEEEEEeCccCHHHHHHHhCCC
Confidence            35688888888887776432   233445666664433333444456677889999999999999877889999999888


Q ss_pred             CCeeeccCCcchHHHHH
Q 028156          113 GGVHHKPQQLDGLFQYL  129 (213)
Q Consensus       113 gG~Y~~~~~~~~l~~~L  129 (213)
                      ++.|.+..+.+.|.+..
T Consensus       157 ~~~~~~~~~~~~L~~~~  173 (181)
T d1shux_         157 EQVFPVKGGFQALKGII  173 (181)
T ss_dssp             GGEEESSSTTHHHHHHH
T ss_pred             CceEEecCCHHHHHHHH
Confidence            88888765555555444



>d1atza_ c.62.1.1 (A:) von Willebrand factor A3 domain, vWA3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qtva3 c.62.1.2 (A:120-390) Sec23 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pd0a3 c.62.1.2 (A:301-552) Sec24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ijba_ c.62.1.1 (A:) von Willebrand factor A1 domain, vWA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yuza2 g.41.5.1 (A:167-202) Nigerythrin, C-terminal domain {Desulfovibrio vulgaris [TaxId: 881]} Back     information, alignment and structure
>d1nnqa2 g.41.5.1 (A:135-171) Rubrerythrin, C-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1jeyb2 c.62.1.4 (B:6-241) Ku80 subunit N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q0pa_ c.62.1.1 (A:) Complement factor B domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n3ya_ c.62.1.1 (A:) Integrin alpha-x beta2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ak3a2 g.41.2.1 (A:125-161) Microbial and mitochondrial ADK, insert "zinc finger" domain {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1pt6a_ c.62.1.1 (A:) Integrin alpha1-beta1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mf7a_ c.62.1.1 (A:) Integrin alpha M (CR3, CD11b/CD18, Mac-1 alpha subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jeya2 c.62.1.3 (A:34-253) Ku70 subunit N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zina2 g.41.2.1 (A:126-160) Microbial and mitochondrial ADK, insert "zinc finger" domain {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1lkoa2 g.41.5.1 (A:148-191) Rubrerythrin, C-terminal domain {Desulfovibrio vulgaris [TaxId: 881]} Back     information, alignment and structure
>d1akya2 g.41.2.1 (A:131-168) Microbial and mitochondrial ADK, insert "zinc finger" domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s3ga2 g.41.2.1 (A:126-160) Microbial and mitochondrial ADK, insert "zinc finger" domain {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1e4va2 g.41.2.1 (A:122-156) Microbial and mitochondrial ADK, insert "zinc finger" domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d6rxna_ g.41.5.1 (A:) Rubredoxin {Desulfovibrio desulfuricans, strain 27774 [TaxId: 876]} Back     information, alignment and structure
>d1v7pc_ c.62.1.1 (C:) Integrin alpha2-beta1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure