Citrus Sinensis ID: 028191


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210--
MDISLWLKLLFAVELALIFSHTEKYPDEPPLLNVKSLRGIQAGDLKILKEKLEQEASENLGMAMIYTLVTSAKEWLSERYSQDAGIDNTGEEELEKDEVIVPHGEPVTVETFLAWRERFEAELALERAKLMPESALTAPKEKKLTGRQWFESGRATAVSQKGAVTVNEVSDDEDDEDIDFDDDDFEDDEVDMLEHYLAEKSDSSTHSSRQPS
cccccccEEcccEEEEEEEEcccccccccccEEEEccccccHHHHHHHHHHHHHHHHHccccEEEHHHHHHHHHHHHHHHHccccccccHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHcccccccccccccccccccccccccccccccccccccHHHHHccccccccccccccccccc
ccHHHHHHHHHEEEEEEEEEccccccccccEEEEEccccccHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHcccccccccccccEEccccccHHHHHHccccccccccHHHHHHHHHHHHccccccccccccc
MDISLWLKLLFAVELALIFShtekypdeppllnvkslrgiqaGDLKILKEKLEQEASENLGMAMIYTLVTSAKEWLSErysqdagidntgeeelekdevivphgepvtvETFLAWRERFEAELALERAKLmpesaltapkekkltgrqwfesgratAVSQKGavtvnevsddeddedidfddddfedDEVDMLEHYLAeksdssthssrqps
MDISLWLKLLFAVELALIFSHtekypdeppllnVKSLRGIQAGDLKILKEKLEQEASENLGMAMIYTLVTSAKEWLSERYSQDAGIDNTGeeelekdevivphgepvtVETFLAWRERFEAELALERAKlmpesaltapkekkltgrqwfesgratavsqkgavtvnevsddeddedidFDDDDFEDDEVDMLEHYlaeksdssthssrqps
MDISLWLKLLFAVELALIFSHTEKYPDEPPLLNVKSLRGIQAGDLKILKEKLEQEASENLGMAMIYTLVTSAKEWLSERYSQDAGIDNTGEEELEKDEVIVPHGEPVTVETFlawrerfeaelaleraklMPESALTAPKEKKLTGRQWFESGRATAVSQKGAVTVNEVSddeddedidfddddfeddevdMLEHYLAEKSDSSTHSSRQPS
**ISLWLKLLFAVELALIFSHTEKYPDEPPLLNVKSLRGIQAGDLKILKEKL*****ENLGMAMIYTLVTSAKEWLSERY*****************EVIVPHGEPVTVETFLAWRERFEAELALE**************************************************************************************
****LWLKLLFAVELALIFSHTEKYPDEPPLLNVKSLRGIQAGDLKILKEKLEQEASENLGMAMIYTLVTSAKEWLSER***************************VTVETFLAWRERF*****************************WFESGRATAVSQKGAVTVNEVSDDEDDEDIDFDDDDFEDDEVDMLE******************
MDISLWLKLLFAVELALIFSHTEKYPDEPPLLNVKSLRGIQAGDLKILKEKLEQEASENLGMAMIYTLVTSAKEWLSERYSQDAGIDNTGEEELEKDEVIVPHGEPVTVETFLAWRERFEAELALERAKLMPESALTAPKEKKLTGRQWFESGRATAVSQKGAVTVNEVSDDEDDEDIDFDDDDFEDDEVDMLEHYLA**************
*DISLWLKLLFAVELALIFSHTEKYPDEPPLLNVKSLRGIQAGDLKILKEKLEQEASENLGMAMIYTLVTSAKEWLSERYSQDAGIDNTGEEELEKDEVIVPHGEPVTVETFLAWRERFEAELALERAKLMPESAL***********************************************DFEDDEVDMLEHYLAEK************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDISLWLKLLFAVELALIFSHTEKYPDEPPLLNVKSLRGIQAGDLKILKEKLEQEASENLGMAMIYTLVTSAKEWLSERYSQDAGIDNTGEEELEKDEVIVPHGEPVTVETFLAWRERFEAELALERAKLMPESALTAPKEKKLTGRQWFESGRATAVSQKGAVTVNEVSDDEDDEDIDFDDDDFEDDEVDMLEHYLAEKSDSSTHSSRQPS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query212 2.2.26 [Sep-21-2011]
Q9CQK7243 RWD domain-containing pro yes no 0.655 0.572 0.386 5e-17
Q99ND9243 RWD domain-containing pro yes no 0.655 0.572 0.386 5e-17
Q9H446243 RWD domain-containing pro yes no 0.655 0.572 0.386 1e-16
O94721215 RWD domain-containing pro yes no 0.646 0.637 0.312 1e-08
Q03768265 Protein GIR2 OS=Saccharom yes no 0.424 0.339 0.383 4e-07
>sp|Q9CQK7|RWDD1_MOUSE RWD domain-containing protein 1 OS=Mus musculus GN=Rwdd1 PE=1 SV=1 Back     alignment and function desciption
 Score = 87.8 bits (216), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 56/145 (38%), Positives = 84/145 (57%), Gaps = 6/145 (4%)

Query: 12  AVELALIFSHTEKYPDEPPLLNVKSLRGIQAGDLKILKEKLEQEASENLGMAMIYTLVTS 71
            V+  L F+++EKYPDE PL  + S   ++  D+  + + L  +A ENLGM MI+TLVT+
Sbjct: 47  TVQTTLKFTYSEKYPDETPLYEIFSQENLEDNDVSDILKLLALQAEENLGMVMIFTLVTA 106

Query: 72  AKEWLSERYSQ----DAGIDNTGEEELEKDEVIVPHGEPVTVETFLAWRERFEAELALER 127
            +E L+E   Q            E+E E+ E  + HG PVT+E FL+W+ +F+AEL   +
Sbjct: 107 VQEKLNEIVDQIKTRREEEKKQKEKEAEEAEKKLFHGTPVTIENFLSWKAKFDAELLEIK 166

Query: 128 AKLMPESALTAPKEKKLTGRQWFES 152
            K M E       + KL+G+Q FE+
Sbjct: 167 KKRMKEEEQAG--KNKLSGKQLFET 189




Protects DRG2 from proteolytic degradation.
Mus musculus (taxid: 10090)
>sp|Q99ND9|RWDD1_RAT RWD domain-containing protein 1 OS=Rattus norvegicus GN=Rwdd1 PE=2 SV=1 Back     alignment and function description
>sp|Q9H446|RWDD1_HUMAN RWD domain-containing protein 1 OS=Homo sapiens GN=RWDD1 PE=1 SV=1 Back     alignment and function description
>sp|O94721|YCF9_SCHPO RWD domain-containing protein C1393.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1393.09c PE=4 SV=1 Back     alignment and function description
>sp|Q03768|GIR2_YEAST Protein GIR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GIR2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query212
255549664253 rwd domain-containing protein, putative 0.910 0.762 0.823 4e-75
224128650252 predicted protein [Populus trichocarpa] 0.905 0.761 0.828 5e-74
225442349255 PREDICTED: RWD domain-containing protein 0.919 0.764 0.853 4e-73
297743115246 unnamed protein product [Vitis vinifera] 0.919 0.792 0.853 4e-73
224059188252 predicted protein [Populus trichocarpa] 0.915 0.769 0.79 3e-69
77999283254 RWD domain-containing protein [Solanum t 0.900 0.751 0.718 5e-67
363807786253 uncharacterized protein LOC100813322 [Gl 0.915 0.766 0.703 4e-66
449447836255 PREDICTED: RWD domain-containing protein 0.938 0.780 0.719 6e-66
356526049253 PREDICTED: RWD domain-containing protein 0.919 0.770 0.685 8e-66
15218023252 ubiquitin-conjugating enzyme-like protei 0.905 0.761 0.737 1e-62
>gi|255549664|ref|XP_002515883.1| rwd domain-containing protein, putative [Ricinus communis] gi|223544788|gb|EEF46303.1| rwd domain-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  286 bits (732), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 163/198 (82%), Positives = 180/198 (90%), Gaps = 5/198 (2%)

Query: 13  VELALIFSHTEKYPDEPPLLNVKSLRGIQAGDLKILKEKLEQEASENLGMAMIYTLVTSA 72
           V+LALIFSHTEKYPDEPPLL+VKS+RGIQ GDLK+LKEKLE+EASENLGMAM+YTLVTSA
Sbjct: 59  VQLALIFSHTEKYPDEPPLLSVKSIRGIQVGDLKVLKEKLEEEASENLGMAMVYTLVTSA 118

Query: 73  KEWLSERYSQDAGIDNTGEEELEKDEVIVPHGEPVTVETFLAWRERFEAELALERAKLMP 132
           KEWLSE+Y QDA  +   +EE  KDEVIVPHGEPVT++TFLAWRERFEAELALERAKLMP
Sbjct: 119 KEWLSEKYGQDASNETIEDEEAAKDEVIVPHGEPVTIDTFLAWRERFEAELALERAKLMP 178

Query: 133 ESALTAPKEKKLTGRQWFESGRATAVSQKGAVTVNEVSDDEDDEDIDFDDDDFEDDEVDM 192
           ES LTAPKEKK++GRQWFESGRA     KGA TVNE SD+ED+E+IDFDDDDFEDDE DM
Sbjct: 179 ESVLTAPKEKKISGRQWFESGRA-----KGAATVNEESDEEDEEEIDFDDDDFEDDEEDM 233

Query: 193 LEHYLAEKSDSSTHSSRQ 210
           LEHYLAEKSDSSTHSSR+
Sbjct: 234 LEHYLAEKSDSSTHSSRR 251




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224128650|ref|XP_002329056.1| predicted protein [Populus trichocarpa] gi|222839727|gb|EEE78050.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225442349|ref|XP_002281163.1| PREDICTED: RWD domain-containing protein 1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|297743115|emb|CBI35982.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224059188|ref|XP_002299758.1| predicted protein [Populus trichocarpa] gi|222847016|gb|EEE84563.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|77999283|gb|ABB16988.1| RWD domain-containing protein [Solanum tuberosum] Back     alignment and taxonomy information
>gi|363807786|ref|NP_001241922.1| uncharacterized protein LOC100813322 [Glycine max] gi|255641328|gb|ACU20941.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|449447836|ref|XP_004141673.1| PREDICTED: RWD domain-containing protein 1-like [Cucumis sativus] gi|449480599|ref|XP_004155941.1| PREDICTED: RWD domain-containing protein 1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356526049|ref|XP_003531632.1| PREDICTED: RWD domain-containing protein 1-like [Glycine max] Back     alignment and taxonomy information
>gi|15218023|ref|NP_175584.1| ubiquitin-conjugating enzyme-like protein [Arabidopsis thaliana] gi|12321663|gb|AAG50865.1|AC025294_3 unknown protein [Arabidopsis thaliana] gi|19698889|gb|AAL91180.1| unknown protein [Arabidopsis thaliana] gi|23198350|gb|AAN15702.1| unknown protein [Arabidopsis thaliana] gi|332194587|gb|AEE32708.1| ubiquitin-conjugating enzyme-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query212
TAIR|locus:2017532252 AT1G51730 [Arabidopsis thalian 0.905 0.761 0.575 1.3e-50
ZFIN|ZDB-GENE-040718-270240 rwdd1 "RWD domain containing 1 0.650 0.575 0.354 3.3e-15
MGI|MGI:1913771243 Rwdd1 "RWD domain containing 1 0.650 0.567 0.340 1.8e-14
UNIPROTKB|Q9H446243 RWDD1 "RWD domain-containing p 0.650 0.567 0.340 2.3e-14
POMBASE|SPCC1393.09c215 SPCC1393.09c "RWD domain prote 0.452 0.446 0.373 2.7e-05
UNIPROTKB|G4MRT5230 MGG_04566 "RWD domain-containi 0.650 0.6 0.273 4.9e-05
WB|WBGene00012037240 T26E3.4 [Caenorhabditis elegan 0.636 0.562 0.287 5.5e-05
TAIR|locus:2017532 AT1G51730 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 526 (190.2 bits), Expect = 1.3e-50, P = 1.3e-50
 Identities = 114/198 (57%), Positives = 128/198 (64%)

Query:    13 VELALIFSHTEKYPDEPPLLNVKSLRGIQAGDLKILKEKLEQEASENLGMAMIYTLVTSA 72
             V+LAL+FSHTE YPDE PLL+VKS+RGI   DL ILKEKLEQEASENLGMAMIYTLV+SA
Sbjct:    59 VQLALVFSHTENYPDEAPLLDVKSIRGIHVSDLTILKEKLEQEASENLGMAMIYTLVSSA 118

Query:    73 KEWLSERYSQDAGIDNTGEEELEKDEVIVPHGEPVTVETFXXXXXXXXXXXXXXXXXXMP 132
             K+WLSE Y QD   +    E  ++DEVIVPHGEPVT+ETF                  MP
Sbjct:   119 KDWLSEHYGQDDAAEFAEVEAAKEDEVIVPHGEPVTLETFLAWRERYEAELALERAKLMP 178

Query:   133 ESALTAPKEKKLTGRQWFESGRATAVSQKGAVTV-NEVSXXXXXXXXXXXXXXXXXXXXX 191
             ESALTAPKEKKLTGRQWFESGR      +G V + +E                       
Sbjct:   179 ESALTAPKEKKLTGRQWFESGRG-----RGTVVIADEEDEEEDEEDIDFEDEDFEDDEED 233

Query:   192 MLEHYLAEKSDSSTHSSR 209
             MLEHYLAEKSDSS   +R
Sbjct:   234 MLEHYLAEKSDSSAPPTR 251




GO:0005737 "cytoplasm" evidence=ISM
GO:0008150 "biological_process" evidence=ND
ZFIN|ZDB-GENE-040718-270 rwdd1 "RWD domain containing 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:1913771 Rwdd1 "RWD domain containing 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q9H446 RWDD1 "RWD domain-containing protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
POMBASE|SPCC1393.09c SPCC1393.09c "RWD domain protein, implicated in translation" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
UNIPROTKB|G4MRT5 MGG_04566 "RWD domain-containing protein" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
WB|WBGene00012037 T26E3.4 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
eugene3.00970039
hypothetical protein (252 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query212
pfam05773113 pfam05773, RWD, RWD domain 2e-14
smart00591107 smart00591, RWD, domain in RING finger and WD repe 3e-11
>gnl|CDD|218742 pfam05773, RWD, RWD domain Back     alignment and domain information
 Score = 66.2 bits (162), Expect = 2e-14
 Identities = 26/64 (40%), Positives = 38/64 (59%)

Query: 13  VELALIFSHTEKYPDEPPLLNVKSLRGIQAGDLKILKEKLEQEASENLGMAMIYTLVTSA 72
           V L L F+  E YPDEPP +++ S   ++  D   L ++LE+ A ENLG  MI+ L+   
Sbjct: 50  VSLVLTFTLPEDYPDEPPKISLSSPWLLRDQDKLQLLKELEELAEENLGEVMIFELIEWL 109

Query: 73  KEWL 76
           +E L
Sbjct: 110 QENL 113


This domain was identified in WD40 repeat proteins and Ring finger domain proteins. The function of this domain is unknown. GCN2 is the alpha-subunit of the only translation initiation factor (eIF2 alpha) kinase that appears in all eukaryotes. Its function requires an interaction with GCN1 via the domain at its N-terminus, which is termed the RWD domain after three major RWD-containing proteins: RING finger-containing proteins, WD-repeat-containing proteins, and yeast DEAD (DEXD)-like helicases. The structure forms an alpha + beta sandwich fold consisting of two layers: a four-stranded antiparallel beta-sheet, and three side-by-side alpha-helices. Length = 113

>gnl|CDD|214735 smart00591, RWD, domain in RING finger and WD repeat containing proteins and DEXDc-like helicases subfamily related to the UBCc domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 212
KOG4018215 consensus Uncharacterized conserved protein, conta 100.0
smart00591107 RWD domain in RING finger and WD repeat containing 99.56
PF05773113 RWD: RWD domain; InterPro: IPR006575 The RWD eukar 99.45
KOG4445 368 consensus Uncharacterized conserved protein, conta 99.22
KOG1763343 consensus Uncharacterized conserved protein, conta 98.65
KOG1035 1351 consensus eIF-2alpha kinase GCN2 [Translation, rib 97.74
COG5252299 Uncharacterized conserved protein, contains CCCH-t 96.18
KOG0309 1081 consensus Conserved WD40 repeat-containing protein 93.81
KOG1814 445 consensus Predicted E3 ubiquitin ligase [Posttrans 89.89
KOG0419152 consensus Ubiquitin-protein ligase [Posttranslatio 88.51
PF00179140 UQ_con: Ubiquitin-conjugating enzyme; InterPro: IP 87.2
cd00195141 UBCc Ubiquitin-conjugating enzyme E2, catalytic (U 85.41
smart00212145 UBCc Ubiquitin-conjugating enzyme E2, catalytic do 84.9
PTZ00390152 ubiquitin-conjugating enzyme; Provisional 84.65
PF08694161 UFC1: Ubiquitin-fold modifier-conjugating enzyme 1 84.48
PLN00172147 ubiquitin conjugating enzyme; Provisional 83.92
COG5078153 Ubiquitin-protein ligase [Posttranslational modifi 83.33
>KOG4018 consensus Uncharacterized conserved protein, contains RWD domain [Function unknown] Back     alignment and domain information
Probab=100.00  E-value=1.9e-36  Score=257.04  Aligned_cols=147  Identities=43%  Similarity=0.593  Sum_probs=129.1

Q ss_pred             CCce-EEEEEEEeCCCCCCCCCceEEecCCCCCHHhHHHHHHHHHHHHHHhcCChHHHHHHHHHHHHHHHHhhccccc--
Q 028191           10 LFAV-ELALIFSHTEKYPDEPPLLNVKSLRGIQAGDLKILKEKLEQEASENLGMAMIYTLVTSAKEWLSERYSQDAGI--   86 (212)
Q Consensus        10 ~~p~-~l~L~f~~p~~YP~e~P~i~i~~~~gL~~~~l~~L~~~L~~~aeenlGm~MIFtLve~lqE~L~e~~~~~~~~--   86 (212)
                      +.|. ++.|.|++|++||+++|+|.+..+.|+.+..+..|+..|+.+|++||||+|||+||+++|+||++++++....  
T Consensus        45 d~~~~~~~l~~s~tEnYPDe~Pli~~~~~~~~~~~~i~~i~~~l~~~aeenLGmaMiftLvss~ke~l~e~~~q~~~~e~  124 (215)
T KOG4018|consen   45 DEPKGSFILVFSLTENYPDEAPLIEAFENENLEDAEIEGILEKLQQEAEENLGMAMIFTLVSSAKEELNEIVEQQKAAEQ  124 (215)
T ss_pred             CCccccEEEEEEccCCCCCCCcceeccccccccHHHHHHHHHHHHHHHHHhcchHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            4555 8999999999999999999999999999999999999999999999999999999999999999999987665  


Q ss_pred             CCccchhhhhhcccCCCCCcccHHHHHHHHHHHHHHHHHHHHhcCccccccCCCCCCcchhHHhhcCcccccc
Q 028191           87 DNTGEEELEKDEVIVPHGEPVTVETFLAWRERFEAELALERAKLMPESALTAPKEKKLTGRQWFESGRATAVS  159 (212)
Q Consensus        87 ~e~~~~e~e~ee~~~~~GTpVT~EsF~~Wk~kf~~E~~~~k~k~~~e~~~~~~~~~kLTGRqlFe~~~~l~~~  159 (212)
                      .+.+.++++++++++|||||||+++|.+||.+|+++++..+++.++.   .+...+++||||+|++|+.+..+
T Consensus       125 ~e~~~~~~ee~e~~kfhgt~VT~esfl~Wk~~fe~el~~~~~k~~~~---~~~~~~k~tgRQ~f~~d~~~~~~  194 (215)
T KOG4018|consen  125 REQEAREAEEEERKKFHGTPVTLESFLEWKLKFEEELLQIKAKVKKR---LQALAKKLTGRQLFETDHKGDRS  194 (215)
T ss_pred             HHHHHHHHHHHhhccccCCceehhhhHHHHHhhhhhhhhhhhhhhhH---HHHHhhhHHHHHHHHhcccCChh
Confidence            22346677778899999999999999999999999996666665432   45667899999999999998544



>smart00591 RWD domain in RING finger and WD repeat containing proteins and DEXDc-like helicases subfamily related to the UBCc domain Back     alignment and domain information
>PF05773 RWD: RWD domain; InterPro: IPR006575 The RWD eukaryotic domain is found in RING finger (IPR001841 from INTERPRO) and WD repeat (IPR001680 from INTERPRO) containing proteins and DEXDc-like helicase (IPR001410 from INTERPRO) subfamily related to the ubiquitin-conjugating enzymes domain (IPR000608 from INTERPRO) Back     alignment and domain information
>KOG4445 consensus Uncharacterized conserved protein, contains RWD domain [Function unknown] Back     alignment and domain information
>KOG1763 consensus Uncharacterized conserved protein, contains CCCH-type Zn-finger [General function prediction only] Back     alignment and domain information
>KOG1035 consensus eIF-2alpha kinase GCN2 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG5252 Uncharacterized conserved protein, contains CCCH-type Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0419 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00179 UQ_con: Ubiquitin-conjugating enzyme; InterPro: IPR000608 The post-translational attachment of ubiquitin (IPR000626 from INTERPRO) to proteins (ubiquitinylation) alters the function, location or trafficking of a protein, or targets it to the 26S proteasome for degradation [, , ] Back     alignment and domain information
>cd00195 UBCc Ubiquitin-conjugating enzyme E2, catalytic (UBCc) domain Back     alignment and domain information
>smart00212 UBCc Ubiquitin-conjugating enzyme E2, catalytic domain homologues Back     alignment and domain information
>PTZ00390 ubiquitin-conjugating enzyme; Provisional Back     alignment and domain information
>PF08694 UFC1: Ubiquitin-fold modifier-conjugating enzyme 1; InterPro: IPR014806 Ubiquitin-like (UBL) post-translational modifiers are covalently linked to most, if not all, target protein(s) through an enzymatic cascade analogous to ubiquitylation, consisting of E1 (activating), E2 (conjugating), and E3 (ligating) enzymes Back     alignment and domain information
>PLN00172 ubiquitin conjugating enzyme; Provisional Back     alignment and domain information
>COG5078 Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query212
2ebm_A128 Solution Structure Of The Rwd Domain Of Human Rwd D 7e-10
>pdb|2EBM|A Chain A, Solution Structure Of The Rwd Domain Of Human Rwd Domain Containing Protein 1 Length = 128 Back     alignment and structure

Iteration: 1

Score = 60.5 bits (145), Expect = 7e-10, Method: Compositional matrix adjust. Identities = 30/71 (42%), Positives = 45/71 (63%) Query: 12 AVELALIFSHTEKYPDEPPLLNVKSLRGIQAGDLKILKEKLEQEASENLGMAMIYTLVTS 71 V+ L F+++EKYPDE PL + S ++ D+ + + L +A ENLGM MI+TLVT+ Sbjct: 54 TVQTTLKFTYSEKYPDEAPLYEIFSQENLEDNDVSDILKLLALQAEENLGMVMIFTLVTA 113 Query: 72 AKEWLSERYSQ 82 +E L+E Q Sbjct: 114 VQEKLNEIVDQ 124

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query212
2ebk_A128 RWD domain-containing protein 3; alpha+beta sandwi 9e-16
1ukx_A137 GCN2, GCN2 EIF2alpha kinase; UBC-like fold, triple 1e-15
2day_A128 Ring finger protein 25; ligase, metal-binding, UB1 5e-15
2ebm_A128 RWD domain-containing protein 1; alpha+beta sandwi 1e-14
2yz0_A138 Serine/threonine-protein kinase GCN2; A-B-B-B-B-A- 3e-13
>2ebk_A RWD domain-containing protein 3; alpha+beta sandwich fold, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 128 Back     alignment and structure
 Score = 69.9 bits (171), Expect = 9e-16
 Identities = 19/72 (26%), Positives = 32/72 (44%), Gaps = 1/72 (1%)

Query: 13  VELALIFSHTEKYPDEPPLLNVKSLRGIQAGDLKILKEKLEQEASENLGMAMIYTLVTSA 72
           + L L+F     YP   P +++ S   +       +KEKL ++A   L   M++ LV   
Sbjct: 56  IPLELVFHLPVNYPSCLPGISINS-EQLTRAQCVTVKEKLLEQAESLLSEPMVHELVLWI 114

Query: 73  KEWLSERYSQDA 84
           ++ L    SQ  
Sbjct: 115 QQNLRHILSQPE 126


>1ukx_A GCN2, GCN2 EIF2alpha kinase; UBC-like fold, triple beta-turns, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.20.1.3 Length = 137 Back     alignment and structure
>2day_A Ring finger protein 25; ligase, metal-binding, UB1 conjugation, UB1 conjugation pathway, RWD domain, alpha+beta sandwich fold, structural genomics; NMR {Homo sapiens} SCOP: d.20.1.3 PDB: 2dmf_A Length = 128 Back     alignment and structure
>2ebm_A RWD domain-containing protein 1; alpha+beta sandwich fold, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 128 Back     alignment and structure
>2yz0_A Serine/threonine-protein kinase GCN2; A-B-B-B-B-A-A, amino acid starvation signal response, EIF2alpha kinase, transferase; NMR {Saccharomyces cerevisiae} Length = 138 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query212
2ebm_A128 RWD domain-containing protein 1; alpha+beta sandwi 99.73
2ebk_A128 RWD domain-containing protein 3; alpha+beta sandwi 99.69
2yz0_A138 Serine/threonine-protein kinase GCN2; A-B-B-B-B-A- 99.68
2day_A128 Ring finger protein 25; ligase, metal-binding, UB1 99.67
1ukx_A137 GCN2, GCN2 EIF2alpha kinase; UBC-like fold, triple 99.65
2dax_A152 Protein C21ORF6; RWD domain, alpha+beta sandwich f 99.48
2daw_A154 RWD domain containing protein 2; alpha+beta sandwi 99.48
4a9a_C142 Translation machinery-associated protein 46; DRG-D 98.41
3kpa_A168 Probable ubiquitin fold modifier conjugating ENZY; 89.69
2a7l_A136 Hypothetical ubiquitin-conjugating enzyme LOC55284 89.54
2z6o_A172 UFM1-conjugating enzyme 1; UFC1, ubiquitin, UBL, p 88.2
2fo3_A125 Ubiquitin-conjugating enzyme; SGC, UBC, structural 88.04
2r0j_A149 Ubiquitin carrier protein; ubiquitin conjugating, 88.0
1z2u_A150 Ubiquitin-conjugating enzyme E2 2; PSI, secsg, pro 87.97
2h2y_A136 Ubiquitin-conjugating enzyme; structural genomics, 87.8
2aak_A152 UBC1, ubiquitin conjugating enzyme; ubiquitin conj 87.74
2bep_A159 Ubiquitin-conjugating enzyme E2-25 kDa; ligase, E2 87.62
2ayv_A166 Ubiquitin-conjugating enzyme E2; structural genomi 87.59
1fxt_A149 Ubiquitin-conjugating enzyme E2-24 kDa; ligase; NM 87.59
2c2v_B154 Ubiquitin-conjugating enzyme E2 N; chaperone, heat 87.56
2ucz_A165 UBC7, ubiquitin conjugating enzyme; ubiquitin conj 87.45
3h8k_A164 Ubiquitin-conjugating enzyme E2 G2; alpha beta, al 87.41
1zdn_A158 Ubiquitin-conjugating enzyme E2S; structural genom 87.41
1jat_A155 Ubiquitin-conjugating enzyme E2-17.5 kDa; UEV, lig 87.38
2awf_A172 Ubiquitin-conjugating enzyme E2 G1; ligase, UBL co 87.35
2e2c_A156 Ubiquitin conjugating enzyme; ubiquitin conjugatio 87.35
1zuo_A186 Hypothetical protein LOC92912; ligase, ubiquitin-c 87.32
2c4o_A165 Ubiquitin-conjugating enzyme E2 D2; thioesterifica 87.01
1ayz_A169 UBC2, ubiquitin-conjugating enzyme RAD6; ubiquitin 86.81
1wzv_A155 Ubiquitin-conjugating enzyme E2 L6; ligase; 2.10A 86.73
1jat_B138 Ubiquitin-conjugating enzyme variant MMS2; UEV, li 86.71
2q0v_A156 Ubiquitin-conjugating enzyme E2, putative; malaria 86.58
2onu_A152 Ubiquitin-conjugating enzyme, putative; UBC, plasm 86.45
2y9m_A172 Ubiquitin-conjugating enzyme E2-21 kDa; ligase-tra 86.29
1c4z_D154 UBCH7, ubiquitin conjugating enzyme E2; bilobal st 86.25
4gpr_A151 Ubiquitin-conjugating enzyme family protein; ubiqu 86.03
1yh2_A169 HSPC150 protein similar to ubiquitin-conjugating e 85.99
2grr_A161 Ubiquitin-conjugating enzyme E2 I; ubiquitin, conj 85.85
2z5d_A179 Ubiquitin-conjugating enzyme E2 H; UBE2H, SGC, lig 85.82
2gjd_A157 Ubiquitin-conjugating enzyme E2-18 kDa; UBC9P, SMT 85.52
1i7k_A179 Ubiquitin-conjugating enzyme E2 H10; ligase; 1.95A 85.5
2pwq_A216 Ubiquitin conjugating enzyme; structural genomics 85.36
3bzh_A194 Ubiquitin-conjugating enzyme E2 E1; structural gen 85.1
2nvu_C180 NEDD8-conjugating enzyme UBC12; multifunction macr 85.08
1yrv_A169 Ubiquitin-conjugating ligase MGC351130; structural 85.04
1y8x_A160 Ubiquitin-conjugating enzyme E2 M; ubiquitin-conju 85.04
3rz3_A183 Ubiquitin-conjugating enzyme E2 R1; ubiquitin conj 84.85
2a4d_A160 Ubiquitin-conjugating enzyme E2 variant 1; alterna 84.79
3k9o_A201 Ubiquitin-conjugating enzyme E2 K; E2-25K, complex 84.5
3rcz_B163 SUMO-conjugating enzyme UBC9; SUMO-like domain, pr 84.46
2f4z_A193 Tgtwinscan_2721 - E2 domain; ubiquitin conjugating 84.43
3fn1_B167 NEDD8-conjugating enzyme UBE2F; ligase, ATP-bindin 84.3
2f4w_A187 Ubiquitin-conjugating enzyme E2, J2; endoplasmic r 84.15
4ds2_A167 Ubiquitin-conjugating enzyme E2, putative; structu 83.85
1yf9_A171 Ubiquitin carrier protein 4; SGPP, structural geno 83.78
3o2u_A190 NEDD8-conjugating enzyme UBC12; E2 conjugase, liga 83.46
1tte_A215 Ubiquitin-conjugating enzyme E2-24 kDa; UBC1, ubiq 82.65
3e46_A253 Ubiquitin-conjugating enzyme E2-25 kDa; huntington 81.07
>2ebm_A RWD domain-containing protein 1; alpha+beta sandwich fold, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
Probab=99.73  E-value=1e-17  Score=130.38  Aligned_cols=75  Identities=40%  Similarity=0.548  Sum_probs=70.9

Q ss_pred             CceEEEEEEEeCCCCCCCCCceEEecCCCCCHHhHHHHHHHHHHHHHHhcCChHHHHHHHHHHHHHHHHhhcccc
Q 028191           11 FAVELALIFSHTEKYPDEPPLLNVKSLRGIQAGDLKILKEKLEQEASENLGMAMIYTLVTSAKEWLSERYSQDAG   85 (212)
Q Consensus        11 ~p~~l~L~f~~p~~YP~e~P~i~i~~~~gL~~~~l~~L~~~L~~~aeenlGm~MIFtLve~lqE~L~e~~~~~~~   85 (212)
                      .++.+.|+|++|++||+++|.|.|.+.+||+...+..|.+.|...+++++|+||||+||+|||++|.++++++++
T Consensus        53 ~~~~~~L~v~~p~~YP~~~P~i~l~~~~~l~~~~~~~L~~~L~~~~~e~~G~~mif~lv~~lqe~l~e~~~~~~~  127 (128)
T 2ebm_A           53 ETVQTTLKFTYSEKYPDEAPLYEIFSQENLEDNDVSDILKLLALQAEENLGMVMIFTLVTAVQEKLNEIVDQIKT  127 (128)
T ss_dssp             CCCBEEEEEECCSSTTTSCCEEEEEEESSCCHHHHHHHHHHHHHHHHHHTTSCCHHHHHHHHHHHHHHHHHHGGG
T ss_pred             CceeEEEEEEeCCCCCCCCceEEEEcCCCCCHHHHHHHHHHHHHHHHHhCCCEEHHHHHHHHHHHHHHHHHHHhc
Confidence            457899999999999999999999988899999999999999999999999999999999999999999998764



>2ebk_A RWD domain-containing protein 3; alpha+beta sandwich fold, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yz0_A Serine/threonine-protein kinase GCN2; A-B-B-B-B-A-A, amino acid starvation signal response, EIF2alpha kinase, transferase; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2day_A Ring finger protein 25; ligase, metal-binding, UB1 conjugation, UB1 conjugation pathway, RWD domain, alpha+beta sandwich fold, structural genomics; NMR {Homo sapiens} SCOP: d.20.1.3 PDB: 2dmf_A Back     alignment and structure
>1ukx_A GCN2, GCN2 EIF2alpha kinase; UBC-like fold, triple beta-turns, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.20.1.3 Back     alignment and structure
>2dax_A Protein C21ORF6; RWD domain, alpha+beta sandwich fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.20.1.3 Back     alignment and structure
>2daw_A RWD domain containing protein 2; alpha+beta sandwich fold, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.20.1.3 Back     alignment and structure
>4a9a_C Translation machinery-associated protein 46; DRG-DFRP complex, ribosome binding GTPase; 2.67A {Saccharomyces cerevisiae} Back     alignment and structure
>3kpa_A Probable ubiquitin fold modifier conjugating ENZY; UBL conjugation pathway, ligase, structural genomics, PSI; 2.20A {Leishmania major} SCOP: d.20.1.4 Back     alignment and structure
>2a7l_A Hypothetical ubiquitin-conjugating enzyme LOC55284; structural genomics consortium, (SGC), ligase; 1.82A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>2z6o_A UFM1-conjugating enzyme 1; UFC1, ubiquitin, UBL, polymorphism, UBL conjugation pathway, ligase; 1.60A {Homo sapiens} PDB: 2z6p_A 1ywz_A 2in1_A 2k07_A 3e2g_A 3evx_A Back     alignment and structure
>2fo3_A Ubiquitin-conjugating enzyme; SGC, UBC, structural genomics, structural genomics consortium, unknown function; 1.86A {Plasmodium vivax} SCOP: d.20.1.1 Back     alignment and structure
>2r0j_A Ubiquitin carrier protein; ubiquitin conjugating, malaria, ligas conjugation pathway, structural genomics, structural genomi consortium; 1.85A {Plasmodium falciparum} PDB: 3e95_A Back     alignment and structure
>1z2u_A Ubiquitin-conjugating enzyme E2 2; PSI, secsg, proteosome pathway, structural genomics, protein structure initiative; 1.10A {Caenorhabditis elegans} SCOP: d.20.1.1 PDB: 3tgd_A 2esk_A 1ur6_A 1w4u_A 4a49_B* 4a4b_C* 4a4c_C* 3eb6_B 3l1y_A 2esp_A 2eso_A 2esq_A 3l1z_A 2oxq_A 3a33_A 4ddg_D 4ddi_D 1x23_A 3rpg_A 2fuh_A ... Back     alignment and structure
>2h2y_A Ubiquitin-conjugating enzyme; structural genomics, unknown function, structural genomics consortium, SGC; 2.80A {Plasmodium falciparum 3D7} Back     alignment and structure
>2aak_A UBC1, ubiquitin conjugating enzyme; ubiquitin conjugation, ligase; 2.40A {Arabidopsis thaliana} SCOP: d.20.1.1 PDB: 1jas_A 2y4w_A 2yb6_A 2ybf_A 1q34_A 1z3d_A Back     alignment and structure
>2bep_A Ubiquitin-conjugating enzyme E2-25 kDa; ligase, E2 conjugating enzyme, protein degradatio structural proteomics in europe, spine; 1.8A {Bos taurus} SCOP: d.20.1.1 PDB: 2bf8_A Back     alignment and structure
>2ayv_A Ubiquitin-conjugating enzyme E2; structural genomics, structural genomics consortium, ubiquit ubiquitin-conjugating enzyme, SGC, ligase; 2.00A {Toxoplasma gondii} SCOP: d.20.1.1 Back     alignment and structure
>1fxt_A Ubiquitin-conjugating enzyme E2-24 kDa; ligase; NMR {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 1fzy_A Back     alignment and structure
>2c2v_B Ubiquitin-conjugating enzyme E2 N; chaperone, heat-shock protein complex, E3 ligase, ubiquitiny TPR, heat-shock protein; 2.9A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>2ucz_A UBC7, ubiquitin conjugating enzyme; ubiquitin conjugation, ligase, yeast; 2.93A {Saccharomyces cerevisiae} SCOP: d.20.1.1 Back     alignment and structure
>3h8k_A Ubiquitin-conjugating enzyme E2 G2; alpha beta, all alpha, ligase, UBL conjugation pathway, endo reticulum, membrane, metal-binding; 1.80A {Homo sapiens} SCOP: d.20.1.1 PDB: 3fsh_A 2cyx_A 2kly_A Back     alignment and structure
>1zdn_A Ubiquitin-conjugating enzyme E2S; structural genomics consortium, ubiquitin-conjuga enzyme, ligase, SGC; 1.93A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>1jat_A Ubiquitin-conjugating enzyme E2-17.5 kDa; UEV, ligase; 1.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 1jbb_A 2gmi_A 3hct_B 3hcu_B 4dhi_D 1j7d_B 4dhj_C 4dhz_F Back     alignment and structure
>2awf_A Ubiquitin-conjugating enzyme E2 G1; ligase, UBL conjugation pathway, structural genomics, structural genomics consortium SGC; 2.10A {Homo sapiens} SCOP: d.20.1.1 PDB: 1pzv_A Back     alignment and structure
>2e2c_A Ubiquitin conjugating enzyme; ubiquitin conjugation, ubiquitin carrier protein, thioester ligase; 2.00A {Spisula solidissima} SCOP: d.20.1.1 Back     alignment and structure
>1zuo_A Hypothetical protein LOC92912; ligase, ubiquitin-conjugating enzyme, structural genomics consortium ,SGC; 1.80A {Homo sapiens} SCOP: d.20.1.1 PDB: 2qgx_A Back     alignment and structure
>2c4o_A Ubiquitin-conjugating enzyme E2 D2; thioesterification, ligase, UBL conjugation pathway; HET: CME; 1.94A {Homo sapiens} SCOP: d.20.1.1 PDB: 2clw_A* 2c4p_A Back     alignment and structure
>1ayz_A UBC2, ubiquitin-conjugating enzyme RAD6; ubiquitin conjugation; 2.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 Back     alignment and structure
>1wzv_A Ubiquitin-conjugating enzyme E2 L6; ligase; 2.10A {Homo sapiens} SCOP: d.20.1.1 PDB: 1wzw_A 2kjh_A Back     alignment and structure
>1jat_B Ubiquitin-conjugating enzyme variant MMS2; UEV, ligase; 1.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 2gmi_B Back     alignment and structure
>2q0v_A Ubiquitin-conjugating enzyme E2, putative; malaria, structural G structural genomics consortium, SGC, ligase; 2.40A {Plasmodium falciparum} PDB: 3e95_C Back     alignment and structure
>2onu_A Ubiquitin-conjugating enzyme, putative; UBC, plasmodium FAL structural genomics consortium, SGC, ligase; HET: PG4; 2.38A {Plasmodium falciparum} Back     alignment and structure
>2y9m_A Ubiquitin-conjugating enzyme E2-21 kDa; ligase-transport protein complex, ubiquitin conjugating ENZY complex, peroxisomal protein; 2.60A {Saccharomyces cerevisiae} PDB: 2y9p_A 2y9o_A Back     alignment and structure
>1c4z_D UBCH7, ubiquitin conjugating enzyme E2; bilobal structure, elongated shape, E3 ubiquitin ligase, E2 ubiquitin conjugating enzyme; 2.60A {Homo sapiens} SCOP: d.20.1.1 PDB: 1fbv_C* 3sy2_C 3sqv_C Back     alignment and structure
>4gpr_A Ubiquitin-conjugating enzyme family protein; ubiquitin conjugation, EHU ehring1, thiol esterification, ligase; 1.60A {Entamoeba histolytica} Back     alignment and structure
>1yh2_A HSPC150 protein similar to ubiquitin-conjugating enzyme; structural genomics consortium, HSCP150, ligase, SGC; 2.00A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>2grr_A Ubiquitin-conjugating enzyme E2 I; ubiquitin, conjugation, small ubiquitin like modifer, SMT3, ligase; 1.30A {Homo sapiens} PDB: 2grq_A 2grn_A 2pe6_A 2gro_A 2grp_A 1u9a_A 1u9b_A 2vrr_A 2px9_B 1z5s_A 2xwu_A 3uin_A 3uio_A 3uip_A* 1kps_A 2o25_C 1a3s_A 3a4s_A 2uyz_A Back     alignment and structure
>2z5d_A Ubiquitin-conjugating enzyme E2 H; UBE2H, SGC, ligase, structural genomics, structural genomics consortium; 2.10A {Homo sapiens} Back     alignment and structure
>2gjd_A Ubiquitin-conjugating enzyme E2-18 kDa; UBC9P, SMT3, crystallography, ligase; 1.75A {Saccharomyces cerevisiae} PDB: 2eke_A 3ong_B Back     alignment and structure
>1i7k_A Ubiquitin-conjugating enzyme E2 H10; ligase; 1.95A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>2pwq_A Ubiquitin conjugating enzyme; structural genomics consortium, SGC, ligase; 1.90A {Plasmodium yoelii} Back     alignment and structure
>3bzh_A Ubiquitin-conjugating enzyme E2 E1; structural genomics consortium, ubiquitin-conjuga enzyme, ligase, SGC, UBL conjugation pathway; 1.60A {Homo sapiens} PDB: 1y6l_A Back     alignment and structure
>2nvu_C NEDD8-conjugating enzyme UBC12; multifunction macromolecular complex, ubiquitin, ATP, conformational change, thioester, switch, adenylation, protein turnover, ligase; HET: ATP; 2.80A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>1yrv_A Ubiquitin-conjugating ligase MGC351130; structural genomics consortium, SGC, ubiquitin- conjugating enzyme; 2.18A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>1y8x_A Ubiquitin-conjugating enzyme E2 M; ubiquitin-conjugating enzyme E2 M, ligase; 2.40A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>3rz3_A Ubiquitin-conjugating enzyme E2 R1; ubiquitin conjugating enzyme domain, E2 domain, ligase-ligas inhibitor complex; HET: U94; 2.30A {Homo sapiens} PDB: 2ob4_A Back     alignment and structure
>2a4d_A Ubiquitin-conjugating enzyme E2 variant 1; alternative splicing, nuclear protein, UBL conjugation pathway,ubiquitin, ligase, structural genomics; 1.69A {Homo sapiens} SCOP: d.20.1.1 PDB: 2c2v_C 1j7d_A 1j74_A 1zgu_A Back     alignment and structure
>3k9o_A Ubiquitin-conjugating enzyme E2 K; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 3k9p_A 1yla_A 2o25_A Back     alignment and structure
>3rcz_B SUMO-conjugating enzyme UBC9; SUMO-like domain, protein:protein interaction, protein ligase complex; HET: DNA; 1.90A {Schizosaccharomyces pombe} SCOP: d.20.1.1 Back     alignment and structure
>2f4z_A Tgtwinscan_2721 - E2 domain; ubiquitin conjugating tgtwinscan_2721, structural genomics, structural genomics consortium, SGC; 2.11A {Toxoplasma gondii} SCOP: d.20.1.1 Back     alignment and structure
>3fn1_B NEDD8-conjugating enzyme UBE2F; ligase, ATP-binding, cell cycle, nucleotide-binding, UBL CON pathway; 2.50A {Homo sapiens} PDB: 2edi_A Back     alignment and structure
>2f4w_A Ubiquitin-conjugating enzyme E2, J2; endoplasmic reticulum, ligase, UBL conjugation pathway, structural genomics consortium (SGC); 2.00A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>4ds2_A Ubiquitin-conjugating enzyme E2, putative; structural genomics, PSI, protein structure initiative; 2.63A {Trypanosoma cruzi} Back     alignment and structure
>1yf9_A Ubiquitin carrier protein 4; SGPP, structural genomics, PSI, protein structure initiative ubiquitin conjugating enzyme; 2.00A {Leishmania major} SCOP: d.20.1.1 Back     alignment and structure
>3o2u_A NEDD8-conjugating enzyme UBC12; E2 conjugase, ligase; 2.00A {Saccharomyces cerevisiae} PDB: 3tdi_C Back     alignment and structure
>1tte_A Ubiquitin-conjugating enzyme E2-24 kDa; UBC1, ubiquitin-dependent degradation, ligase; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 d.20.1.1 Back     alignment and structure
>3e46_A Ubiquitin-conjugating enzyme E2-25 kDa; huntington interacting, ligase, alternative splicing, cytoplasm, UBL conjugation, UBL conjugation pathway; 1.86A {Homo sapiens} SCOP: a.5.2.1 d.20.1.1 PDB: 3f92_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 212
d1ukxa_137 d.20.1.3 (A:) EIF2-alpha kinase 4 (GCN2-like prote 2e-13
d2daya1115 d.20.1.3 (A:8-122) E3 ubiquitin-protein ligase RNF 4e-12
d2daxa1140 d.20.1.3 (A:8-147) Uncharacterized protein C21orf6 1e-06
d2dawa1141 d.20.1.3 (A:8-148) RWD domain-containing protein 2 1e-04
>d1ukxa_ d.20.1.3 (A:) EIF2-alpha kinase 4 (GCN2-like protein) {Mouse (Mus musculus) [TaxId: 10090]} Length = 137 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: UBC-like
superfamily: UBC-like
family: RWD domain
domain: EIF2-alpha kinase 4 (GCN2-like protein)
species: Mouse (Mus musculus) [TaxId: 10090]
 Score = 63.1 bits (153), Expect = 2e-13
 Identities = 20/67 (29%), Positives = 35/67 (52%)

Query: 13  VELALIFSHTEKYPDEPPLLNVKSLRGIQAGDLKILKEKLEQEASENLGMAMIYTLVTSA 72
           V++ L       YPD  P +++K+ +G+    + +LK  LE+ A +  G  MI+ L    
Sbjct: 63  VQVELRVKCPPTYPDVVPEIDLKNAKGLSNESVNLLKSHLEELAKKQCGEVMIFELAHHV 122

Query: 73  KEWLSER 79
           + +LSE 
Sbjct: 123 QSFLSEH 129


>d2daya1 d.20.1.3 (A:8-122) E3 ubiquitin-protein ligase RNF25 {Human (Homo sapiens) [TaxId: 9606]} Length = 115 Back     information, alignment and structure
>d2daxa1 d.20.1.3 (A:8-147) Uncharacterized protein C21orf6 {Human (Homo sapiens) [TaxId: 9606]} Length = 140 Back     information, alignment and structure
>d2dawa1 d.20.1.3 (A:8-148) RWD domain-containing protein 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 141 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query212
d2daya1115 E3 ubiquitin-protein ligase RNF25 {Human (Homo sap 99.65
d1ukxa_137 EIF2-alpha kinase 4 (GCN2-like protein) {Mouse (Mu 99.61
d2dawa1141 RWD domain-containing protein 2 {Human (Homo sapie 99.47
d2daxa1140 Uncharacterized protein C21orf6 {Human (Homo sapie 99.43
d2a7la1117 Ubiquitin-protein ligase W (E2 W) {Human (Homo sap 89.83
d2fo3a1109 Putative ubiquitin-conjugating enzyme, E2 domain { 89.65
d1zuoa1162 Ubiquitin-conjugating enzyme E2 Q2, C-terminal dom 87.37
d1z2ua1147 Ubiquitin conjugating enzyme, UBC {Caenorhabditis 87.26
d1c4zd_144 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 87.21
d2f4wa1157 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 86.73
d2awfa1125 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 86.47
d2z5da1152 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 86.0
d2ucza_164 Ubiquitin conjugating enzyme, UBC {Baker's yeast ( 85.94
d1wzva1150 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 85.83
d1yh2a1154 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 85.57
d2bepa1154 Ubiquitin-conjugating enzyme E2-25 kDa, E2 domain 85.3
d1yf9a1158 Ubiquitin conjugating enzyme, UBC {Leishmania majo 85.11
d1ayza_153 Ubiquitin conjugating enzyme, UBC {Baker's yeast ( 85.07
d2f4za1161 Hypothetical protein Tgtwinscan_2721, E2 domain {T 85.0
d1jatb_136 Ubiquitin conjugating enzyme, UBC {Baker's yeast ( 84.78
d1j7db_149 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 84.69
d1yrva1148 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 84.31
d2in1a1162 Ufm1-conjugating enzyme 1, UFC1 {Human (Homo sapie 83.57
d2a4da1139 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 83.32
d1y8xa1157 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 83.28
d1i7ka_146 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 83.2
d2uyza1156 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 83.09
d2e2ca_156 Ubiquitin conjugating enzyme, UBC {Clam (Spisula s 82.96
d1z3da1149 Ubiquitin conjugating enzyme, UBC {Nematode (Caeno 82.94
d1pzva_161 Ubiquitin conjugating enzyme, UBC {Nematode (Caeno 82.75
d1fzya_149 Ubiquitin conjugating enzyme, UBC {Baker's yeast ( 82.21
d1s1qa_141 Tumor susceptibility gene 101 (TSG101) {Human (Hom 81.72
d1y6la_148 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 81.36
d1jata_152 Ubiquitin conjugating enzyme, UBC {Baker's yeast ( 81.3
d1zdna1151 Ubiquitin conjugating enzyme, UBC {Human(Homo sapi 81.19
>d2daya1 d.20.1.3 (A:8-122) E3 ubiquitin-protein ligase RNF25 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: UBC-like
superfamily: UBC-like
family: RWD domain
domain: E3 ubiquitin-protein ligase RNF25
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.65  E-value=1.5e-16  Score=119.95  Aligned_cols=65  Identities=29%  Similarity=0.554  Sum_probs=62.8

Q ss_pred             ceEEEEEEEeCCCCCCCCCceEEecCCCCCHHhHHHHHHHHHHHHHHhcCChHHHHHHHHHHHHH
Q 028191           12 AVELALIFSHTEKYPDEPPLLNVKSLRGIQAGDLKILKEKLEQEASENLGMAMIYTLVTSAKEWL   76 (212)
Q Consensus        12 p~~l~L~f~~p~~YP~e~P~i~i~~~~gL~~~~l~~L~~~L~~~aeenlGm~MIFtLve~lqE~L   76 (212)
                      .++++|+|++|++||+++|.+.+.+.+||+..++..|++.|...+++++||||||+||+|+||||
T Consensus        51 ~~~v~L~~~~p~~YP~~~P~i~~~~~~~l~~~~~~~L~~~l~~~~~e~~G~~mif~lv~~~qE~L  115 (115)
T d2daya1          51 YVCFTLVLQVPAEYPHEVPQISIRNPRGLSDEQIHTILQVLGHVAKAGLGTAMLYELIEKGKEIL  115 (115)
T ss_dssp             CCEEEEEEEECSSTTSSCCEEEEEEEESSCHHHHHHHHHHHHHHHHHTTTSCCHHHHHHHHHHHH
T ss_pred             ceEEEEEEEcCCCCCCCCCcEEeeccCCCCHHHHHHHHHHHHHHHHHcCCCEEHHHHHHHHHhhC
Confidence            47899999999999999999999999999999999999999999999999999999999999997



>d1ukxa_ d.20.1.3 (A:) EIF2-alpha kinase 4 (GCN2-like protein) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dawa1 d.20.1.3 (A:8-148) RWD domain-containing protein 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2daxa1 d.20.1.3 (A:8-147) Uncharacterized protein C21orf6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a7la1 d.20.1.1 (A:1-117) Ubiquitin-protein ligase W (E2 W) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fo3a1 d.20.1.1 (A:9-117) Putative ubiquitin-conjugating enzyme, E2 domain {Plasmodium chabaudi [TaxId: 5825]} Back     information, alignment and structure
>d1zuoa1 d.20.1.1 (A:201-362) Ubiquitin-conjugating enzyme E2 Q2, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z2ua1 d.20.1.1 (A:1-147) Ubiquitin conjugating enzyme, UBC {Caenorhabditis elegans, E2 2 [TaxId: 6239]} Back     information, alignment and structure
>d1c4zd_ d.20.1.1 (D:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch7 [TaxId: 9606]} Back     information, alignment and structure
>d2f4wa1 d.20.1.1 (A:12-168) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 J2 [TaxId: 9606]} Back     information, alignment and structure
>d2awfa1 d.20.1.1 (A:7-131) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 G1 [TaxId: 9606]} Back     information, alignment and structure
>d2ucza_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc7 [TaxId: 4932]} Back     information, alignment and structure
>d1wzva1 d.20.1.1 (A:2-151) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 L6 [TaxId: 9606]} Back     information, alignment and structure
>d1yh2a1 d.20.1.1 (A:1-154) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 T [TaxId: 9606]} Back     information, alignment and structure
>d2bepa1 d.20.1.1 (A:1-154) Ubiquitin-conjugating enzyme E2-25 kDa, E2 domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1yf9a1 d.20.1.1 (A:13-170) Ubiquitin conjugating enzyme, UBC {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1ayza_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc2 (RAD6) [TaxId: 4932]} Back     information, alignment and structure
>d2f4za1 d.20.1.1 (A:32-192) Hypothetical protein Tgtwinscan_2721, E2 domain {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1jatb_ d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), mms2 [TaxId: 4932]} Back     information, alignment and structure
>d1j7db_ d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc13 [TaxId: 9606]} Back     information, alignment and structure
>d1yrva1 d.20.1.1 (A:1-148) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 U [TaxId: 9606]} Back     information, alignment and structure
>d2in1a1 d.20.1.4 (A:3-164) Ufm1-conjugating enzyme 1, UFC1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a4da1 d.20.1.1 (A:82-220) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 variant 1 [TaxId: 9606]} Back     information, alignment and structure
>d1y8xa1 d.20.1.1 (A:27-183) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 M [TaxId: 9606]} Back     information, alignment and structure
>d1i7ka_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch10 [TaxId: 9606]} Back     information, alignment and structure
>d2uyza1 d.20.1.1 (A:3-158) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc9 [TaxId: 9606]} Back     information, alignment and structure
>d2e2ca_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Clam (Spisula solidissima), E-2C [TaxId: 6584]} Back     information, alignment and structure
>d1z3da1 d.20.1.1 (A:2-150) Ubiquitin conjugating enzyme, UBC {Nematode (Caenorhabditis elegans), E2-21.5 kDa [TaxId: 6239]} Back     information, alignment and structure
>d1pzva_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Nematode (Caenorhabditis elegans), E2-19 kDa [TaxId: 6239]} Back     information, alignment and structure
>d1fzya_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc1 [TaxId: 4932]} Back     information, alignment and structure
>d1s1qa_ d.20.1.2 (A:) Tumor susceptibility gene 101 (TSG101) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y6la_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch8 [TaxId: 9606]} Back     information, alignment and structure
>d1jata_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc13 [TaxId: 4932]} Back     information, alignment and structure
>d1zdna1 d.20.1.1 (A:6-156) Ubiquitin conjugating enzyme, UBC {Human(Homo sapiens), E2 S [TaxId: 9606]} Back     information, alignment and structure