Citrus Sinensis ID: 028248
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 211 | ||||||
| 356514103 | 321 | PREDICTED: PGR5-like protein 1A, chlorop | 1.0 | 0.657 | 0.857 | 1e-103 | |
| 255537217 | 320 | conserved hypothetical protein [Ricinus | 1.0 | 0.659 | 0.867 | 1e-103 | |
| 297742627 | 326 | unnamed protein product [Vitis vinifera] | 1.0 | 0.647 | 0.862 | 1e-102 | |
| 145333783 | 321 | PGR5-like protein 1A [Arabidopsis thalia | 1.0 | 0.657 | 0.838 | 1e-102 | |
| 145333797 | 322 | PGR5-like protein 1A [Arabidopsis thalia | 1.0 | 0.655 | 0.838 | 1e-102 | |
| 225426724 | 331 | PREDICTED: PGR5-like protein 1A, chlorop | 1.0 | 0.637 | 0.862 | 1e-102 | |
| 18416029 | 324 | PGR5-like protein 1A [Arabidopsis thalia | 1.0 | 0.651 | 0.838 | 1e-102 | |
| 118487360 | 323 | unknown [Populus trichocarpa] | 1.0 | 0.653 | 0.862 | 1e-102 | |
| 255645443 | 321 | unknown [Glycine max] | 1.0 | 0.657 | 0.853 | 1e-102 | |
| 297803832 | 320 | hypothetical protein ARALYDRAFT_492575 [ | 1.0 | 0.659 | 0.838 | 1e-102 |
| >gi|356514103|ref|XP_003525746.1| PREDICTED: PGR5-like protein 1A, chloroplastic-like [Glycine max] | Back alignment and taxonomy information |
|---|
Score = 378 bits (971), Expect = e-103, Method: Compositional matrix adjust.
Identities = 181/211 (85%), Positives = 198/211 (93%)
Query: 1 MSNEEFDNLKEELMWEGSSVVMLSSAEQKFLEASMAYVAGKPIMSDEEYDKLKQKLKMEG 60
MSNEEFDNLKEELMWEGSSVVMLSS EQKFLEASMAYV+GKPIMSD+E+D+LK +LK+EG
Sbjct: 111 MSNEEFDNLKEELMWEGSSVVMLSSDEQKFLEASMAYVSGKPIMSDKEFDELKLRLKIEG 170
Query: 61 SEIVVEGPRCSLRSRKVYSDLSVDYLKMLLLNVPATVVALGLFFFLDDITGFEITYLLEL 120
SEIV EGPRCSLRSRKVYSDLSVDYLKMLLLNVPATV+ALGLFFFLDD+TGFEITYLLEL
Sbjct: 171 SEIVAEGPRCSLRSRKVYSDLSVDYLKMLLLNVPATVIALGLFFFLDDLTGFEITYLLEL 230
Query: 121 PEPFSFIFTWFAAVPLIVYLSQSLTKLIVRESLILKGPCPNCGTENVSFFGTILSISSGG 180
PEPFSFIFTWFAAVPLIV+++ SLT IV++ +ILKGPCPNCGTEN SFFGTILSIS+GG
Sbjct: 231 PEPFSFIFTWFAAVPLIVWIALSLTNAIVKDFVILKGPCPNCGTENTSFFGTILSISNGG 290
Query: 181 TTNTINCSNCGTTMVYDSNTRLITLPEGSEA 211
+TNT+ CSNCGT M YDS TRLITLPEGS A
Sbjct: 291 STNTVKCSNCGTAMEYDSTTRLITLPEGSNA 321
|
Source: Glycine max Species: Glycine max Genus: Glycine Family: Fabaceae Order: Fabales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255537217|ref|XP_002509675.1| conserved hypothetical protein [Ricinus communis] gi|223549574|gb|EEF51062.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|297742627|emb|CBI34776.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|145333783|ref|NP_001078431.1| PGR5-like protein 1A [Arabidopsis thaliana] gi|332659277|gb|AEE84677.1| PGR5-like protein 1A [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|145333797|ref|NP_001078432.1| PGR5-like protein 1A [Arabidopsis thaliana] gi|332659278|gb|AEE84678.1| PGR5-like protein 1A [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|225426724|ref|XP_002282120.1| PREDICTED: PGR5-like protein 1A, chloroplastic-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|18416029|ref|NP_567672.1| PGR5-like protein 1A [Arabidopsis thaliana] gi|30685973|ref|NP_849422.1| PGR5-like protein 1A [Arabidopsis thaliana] gi|30685977|ref|NP_849423.1| PGR5-like protein 1A [Arabidopsis thaliana] gi|75151862|sp|Q8H112.1|PGL1A_ARATH RecName: Full=PGR5-like protein 1A, chloroplastic; Flags: Precursor gi|24030260|gb|AAN41305.1| unknown protein [Arabidopsis thaliana] gi|332659274|gb|AEE84674.1| PGR5-like protein 1A [Arabidopsis thaliana] gi|332659275|gb|AEE84675.1| PGR5-like protein 1A [Arabidopsis thaliana] gi|332659276|gb|AEE84676.1| PGR5-like protein 1A [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|118487360|gb|ABK95508.1| unknown [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|255645443|gb|ACU23217.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|297803832|ref|XP_002869800.1| hypothetical protein ARALYDRAFT_492575 [Arabidopsis lyrata subsp. lyrata] gi|297315636|gb|EFH46059.1| hypothetical protein ARALYDRAFT_492575 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 211 | ||||||
| TAIR|locus:2127233 | 324 | PGR5-LIKE A "AT4G22890" [Arabi | 1.0 | 0.651 | 0.838 | 4.2e-95 | |
| TAIR|locus:2118031 | 313 | PGRL1B "AT4G11960" [Arabidopsi | 1.0 | 0.674 | 0.838 | 2.7e-93 | |
| TAIR|locus:2148338 | 301 | AT5G59400 "AT5G59400" [Arabido | 0.355 | 0.249 | 0.392 | 2.8e-10 |
| TAIR|locus:2127233 PGR5-LIKE A "AT4G22890" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 946 (338.1 bits), Expect = 4.2e-95, P = 4.2e-95
Identities = 177/211 (83%), Positives = 199/211 (94%)
Query: 1 MSNEEFDNLKEELMWEGSSVVMLSSAEQKFLEASMAYVAGKPIMSDEEYDKLKQKLKMEG 60
MSNEEFDNLKEELMWEGSSVVMLSS EQ+FLEASMAYV+G PI++DEEYDKLK KLK++G
Sbjct: 114 MSNEEFDNLKEELMWEGSSVVMLSSDEQRFLEASMAYVSGNPILNDEEYDKLKLKLKIDG 173
Query: 61 SEIVVEGPRCSLRSRKVYSDLSVDYLKMLLLNVPATVVALGLFFFLDDITGFEITYLLEL 120
S+IV EGPRCSLRS+KVYSDL+VDY KMLLLNVPATVVALGLFFFLDDITGFEITY++EL
Sbjct: 174 SDIVSEGPRCSLRSKKVYSDLAVDYFKMLLLNVPATVVALGLFFFLDDITGFEITYIMEL 233
Query: 121 PEPFSFIFTWFAAVPLIVYLSQSLTKLIVRESLILKGPCPNCGTENVSFFGTILSISSGG 180
PEP+SFIFTWFAAVP+IVYL+ S+TKLI+++ LILKGPCPNCGTEN SFFGTILSISSGG
Sbjct: 234 PEPYSFIFTWFAAVPVIVYLALSITKLIIKDFLILKGPCPNCGTENTSFFGTILSISSGG 293
Query: 181 TTNTINCSNCGTTMVYDSNTRLITLPEGSEA 211
TNT+ C+NCGT MVYDS +RLITLPEGS+A
Sbjct: 294 KTNTVKCTNCGTAMVYDSGSRLITLPEGSQA 324
|
|
| TAIR|locus:2118031 PGRL1B "AT4G11960" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2148338 AT5G59400 "AT5G59400" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 211 | |||
| pfam08996 | 187 | pfam08996, zf-DNA_Pol, DNA Polymerase alpha zinc f | 0.004 |
| >gnl|CDD|220087 pfam08996, zf-DNA_Pol, DNA Polymerase alpha zinc finger | Back alignment and domain information |
|---|
Score = 36.5 bits (85), Expect = 0.004
Identities = 15/41 (36%), Positives = 20/41 (48%), Gaps = 3/41 (7%)
Query: 155 LKGPCPNCGTENVSFFGTILSISSGGTT-NTINCSNCGTTM 194
LK CP+CGTE F I + S T + + CS C +
Sbjct: 17 LKLKCPSCGTEFP--FEGIFASSGERVTPSGLQCSKCNALI 55
|
The DNA Polymerase alpha zinc finger domain adopts an alpha-helix-like structure, followed by three turns, all of which involve proline. The resulting motif is a helix-turn-helix motif, in contrast to other zinc finger domains, which show anti-parallel sheet and helix conformation. Zinc binding occurs due to the presence of four cysteine residues positioned to bind the metal centre in a tetrahedral coordination geometry. Function of this domain is uncertain: it has been proposed that the zinc finger motif may be an essential part of the DNA binding domain. Length = 187 |
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 211 | |||
| PRK00420 | 112 | hypothetical protein; Validated | 97.56 | |
| PF11023 | 114 | DUF2614: Protein of unknown function (DUF2614); In | 97.04 | |
| PRK00398 | 46 | rpoP DNA-directed RNA polymerase subunit P; Provis | 96.93 | |
| COG2051 | 67 | RPS27A Ribosomal protein S27E [Translation, riboso | 96.7 | |
| TIGR01206 | 54 | lysW lysine biosynthesis protein LysW. This very s | 96.7 | |
| TIGR02098 | 38 | MJ0042_CXXC MJ0042 family finger-like domain. This | 96.46 | |
| PF06044 | 254 | DRP: Dam-replacing family; InterPro: IPR010324 Dam | 96.37 | |
| PF13240 | 23 | zinc_ribbon_2: zinc-ribbon domain | 96.27 | |
| PF13248 | 26 | zf-ribbon_3: zinc-ribbon domain | 96.19 | |
| PRK00415 | 59 | rps27e 30S ribosomal protein S27e; Reviewed | 96.1 | |
| cd00114 | 307 | LIGANc NAD+ dependent DNA ligase adenylation domai | 95.66 | |
| COG2888 | 61 | Predicted Zn-ribbon RNA-binding protein with a fun | 95.66 | |
| PF01667 | 55 | Ribosomal_S27e: Ribosomal protein S27; InterPro: I | 95.66 | |
| PF09538 | 108 | FYDLN_acid: Protein of unknown function (FYDLN_aci | 95.47 | |
| PRK08097 | 562 | ligB NAD-dependent DNA ligase LigB; Reviewed | 95.43 | |
| smart00531 | 147 | TFIIE Transcription initiation factor IIE. | 95.34 | |
| PF01653 | 315 | DNA_ligase_aden: NAD-dependent DNA ligase adenylat | 95.2 | |
| PLN00209 | 86 | ribosomal protein S27; Provisional | 94.78 | |
| smart00834 | 41 | CxxC_CXXC_SSSS Putative regulatory protein. CxxC_C | 94.78 | |
| PRK09710 | 64 | lar restriction alleviation and modification prote | 94.76 | |
| COG1645 | 131 | Uncharacterized Zn-finger containing protein [Gene | 94.66 | |
| TIGR00575 | 652 | dnlj DNA ligase, NAD-dependent. The member of this | 94.61 | |
| PTZ00083 | 85 | 40S ribosomal protein S27; Provisional | 94.55 | |
| PF08271 | 43 | TF_Zn_Ribbon: TFIIB zinc-binding; InterPro: IPR013 | 94.55 | |
| smart00532 | 441 | LIGANc Ligase N family. | 94.54 | |
| PRK07956 | 665 | ligA NAD-dependent DNA ligase LigA; Validated | 94.47 | |
| PRK05978 | 148 | hypothetical protein; Provisional | 94.46 | |
| PRK02935 | 110 | hypothetical protein; Provisional | 94.45 | |
| PF14353 | 128 | CpXC: CpXC protein | 94.3 | |
| TIGR02300 | 129 | FYDLN_acid conserved hypothetical protein TIGR0230 | 94.12 | |
| PRK06266 | 178 | transcription initiation factor E subunit alpha; V | 94.11 | |
| PHA00626 | 59 | hypothetical protein | 94.04 | |
| PF14803 | 34 | Nudix_N_2: Nudix N-terminal; PDB: 3CNG_C. | 94.04 | |
| PRK14890 | 59 | putative Zn-ribbon RNA-binding protein; Provisiona | 93.95 | |
| PF14255 | 52 | Cys_rich_CPXG: Cysteine-rich CPXCG | 93.83 | |
| smart00659 | 44 | RPOLCX RNA polymerase subunit CX. present in RNA p | 93.78 | |
| PF09723 | 42 | Zn-ribbon_8: Zinc ribbon domain; InterPro: IPR0134 | 93.62 | |
| PF10571 | 26 | UPF0547: Uncharacterised protein family UPF0547; I | 93.51 | |
| TIGR00373 | 158 | conserved hypothetical protein TIGR00373. This fam | 93.49 | |
| PF09862 | 113 | DUF2089: Protein of unknown function (DUF2089); In | 93.12 | |
| PF13719 | 37 | zinc_ribbon_5: zinc-ribbon domain | 93.11 | |
| PRK14351 | 689 | ligA NAD-dependent DNA ligase LigA; Provisional | 92.77 | |
| PF14354 | 61 | Lar_restr_allev: Restriction alleviation protein L | 92.63 | |
| TIGR02605 | 52 | CxxC_CxxC_SSSS putative regulatory protein, FmdB f | 92.32 | |
| PF05191 | 36 | ADK_lid: Adenylate kinase, active site lid; InterP | 91.57 | |
| PRK14350 | 669 | ligA NAD-dependent DNA ligase LigA; Provisional | 91.5 | |
| PF06677 | 41 | Auto_anti-p27: Sjogren's syndrome/scleroderma auto | 91.16 | |
| PF05876 | 557 | Terminase_GpA: Phage terminase large subunit (GpA) | 91.11 | |
| PF13717 | 36 | zinc_ribbon_4: zinc-ribbon domain | 91.05 | |
| PF07282 | 69 | OrfB_Zn_ribbon: Putative transposase DNA-binding d | 90.94 | |
| smart00661 | 52 | RPOL9 RNA polymerase subunit 9. | 90.88 | |
| COG5349 | 126 | Uncharacterized protein conserved in bacteria [Fun | 90.49 | |
| PRK00464 | 154 | nrdR transcriptional regulator NrdR; Validated | 89.83 | |
| COG3877 | 122 | Uncharacterized protein conserved in bacteria [Fun | 89.67 | |
| PF03367 | 161 | zf-ZPR1: ZPR1 zinc-finger domain; InterPro: IPR004 | 89.57 | |
| PF03604 | 32 | DNA_RNApol_7kD: DNA directed RNA polymerase, 7 kDa | 89.42 | |
| TIGR03655 | 53 | anti_R_Lar restriction alleviation protein, Lar fa | 89.15 | |
| smart00709 | 160 | Zpr1 Duplicated domain in the epidermal growth fac | 88.6 | |
| PF01096 | 39 | TFIIS_C: Transcription factor S-II (TFIIS); InterP | 88.38 | |
| PRK00432 | 50 | 30S ribosomal protein S27ae; Validated | 88.35 | |
| PF12773 | 50 | DZR: Double zinc ribbon | 88.2 | |
| smart00440 | 40 | ZnF_C2C2 C2C2 Zinc finger. Nucleic-acid-binding mo | 87.62 | |
| PF10083 | 158 | DUF2321: Uncharacterized protein conserved in bact | 87.59 | |
| PRK12495 | 226 | hypothetical protein; Provisional | 87.49 | |
| PRK14892 | 99 | putative transcription elongation factor Elf1; Pro | 86.91 | |
| COG0272 | 667 | Lig NAD-dependent DNA ligase (contains BRCT domain | 86.75 | |
| PF04216 | 290 | FdhE: Protein involved in formate dehydrogenase fo | 85.94 | |
| PRK14714 | 1337 | DNA polymerase II large subunit; Provisional | 85.92 | |
| PF07754 | 24 | DUF1610: Domain of unknown function (DUF1610); Int | 85.86 | |
| COG1096 | 188 | Predicted RNA-binding protein (consists of S1 doma | 85.77 | |
| PRK03824 | 135 | hypA hydrogenase nickel incorporation protein; Pro | 85.54 | |
| COG1675 | 176 | TFA1 Transcription initiation factor IIE, alpha su | 84.48 | |
| PF09567 | 314 | RE_MamI: MamI restriction endonuclease; InterPro: | 84.35 | |
| smart00778 | 37 | Prim_Zn_Ribbon Zinc-binding domain of primase-heli | 84.12 | |
| COG1779 | 201 | C4-type Zn-finger protein [General function predic | 83.62 | |
| PRK01103 | 274 | formamidopyrimidine/5-formyluracil/ 5-hydroxymethy | 83.0 | |
| PF09851 | 31 | SHOCT: Short C-terminal domain; InterPro: IPR01864 | 82.99 | |
| PF05129 | 81 | Elf1: Transcription elongation factor Elf1 like; I | 82.88 | |
| COG0675 | 364 | Transposase and inactivated derivatives [DNA repli | 82.82 | |
| PF01155 | 113 | HypA: Hydrogenase expression/synthesis hypA family | 82.57 | |
| PF01807 | 97 | zf-CHC2: CHC2 zinc finger; InterPro: IPR002694 Zin | 82.23 | |
| PRK00398 | 46 | rpoP DNA-directed RNA polymerase subunit P; Provis | 82.17 | |
| PRK03681 | 114 | hypA hydrogenase nickel incorporation protein; Val | 82.14 | |
| TIGR00100 | 115 | hypA hydrogenase nickel insertion protein HypA. In | 81.95 | |
| TIGR00244 | 147 | transcriptional regulator NrdR. Members of this al | 81.85 | |
| PF15616 | 131 | TerY-C: TerY-C metal binding domain | 81.68 | |
| COG3677 | 129 | Transposase and inactivated derivatives [DNA repli | 80.36 |
| >PRK00420 hypothetical protein; Validated | Back alignment and domain information |
|---|
Probab=97.56 E-value=7.7e-05 Score=59.69 Aligned_cols=48 Identities=19% Similarity=0.492 Sum_probs=38.9
Q ss_pred HHHHHHhhhccceeeecCCCCCcccceeeccccccccCCCCcCceeCCCCCceeEEecC
Q 028248 141 SQSLTKLIVRESLILKGPCPNCGTENVSFFGTILSISSGGTTNTINCSNCGTTMVYDSN 199 (211)
Q Consensus 141 a~~lt~~~~~d~liLkG~CPnCg~Ev~aFfg~i~~v~s~~~~~~~kC~~C~~~L~f~~~ 199 (211)
++.+.++.++-...|...||.||.+.|.+ ...+..||+||..+.....
T Consensus 8 ~k~~a~~Ll~Ga~ml~~~CP~Cg~pLf~l-----------k~g~~~Cp~Cg~~~~v~~~ 55 (112)
T PRK00420 8 VKKAAELLLKGAKMLSKHCPVCGLPLFEL-----------KDGEVVCPVHGKVYIVKSD 55 (112)
T ss_pred HHHHHHHHHhHHHHccCCCCCCCCcceec-----------CCCceECCCCCCeeeeccH
Confidence 34456667777766889999999999988 5779999999998887653
|
|
| >PF11023 DUF2614: Protein of unknown function (DUF2614); InterPro: IPR020912 This entry describes proteins of unknown function, which are thought to be membrane proteins | Back alignment and domain information |
|---|
| >PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional | Back alignment and domain information |
|---|
| >COG2051 RPS27A Ribosomal protein S27E [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR01206 lysW lysine biosynthesis protein LysW | Back alignment and domain information |
|---|
| >TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain | Back alignment and domain information |
|---|
| >PF06044 DRP: Dam-replacing family; InterPro: IPR010324 Dam-replacing protein (DRP) is a restriction endonuclease that is flanked by pseudo-transposable small repeat elements | Back alignment and domain information |
|---|
| >PF13240 zinc_ribbon_2: zinc-ribbon domain | Back alignment and domain information |
|---|
| >PF13248 zf-ribbon_3: zinc-ribbon domain | Back alignment and domain information |
|---|
| >PRK00415 rps27e 30S ribosomal protein S27e; Reviewed | Back alignment and domain information |
|---|
| >cd00114 LIGANc NAD+ dependent DNA ligase adenylation domain | Back alignment and domain information |
|---|
| >COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF01667 Ribosomal_S27e: Ribosomal protein S27; InterPro: IPR000592 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms | Back alignment and domain information |
|---|
| >PF09538 FYDLN_acid: Protein of unknown function (FYDLN_acid); InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues | Back alignment and domain information |
|---|
| >PRK08097 ligB NAD-dependent DNA ligase LigB; Reviewed | Back alignment and domain information |
|---|
| >smart00531 TFIIE Transcription initiation factor IIE | Back alignment and domain information |
|---|
| >PF01653 DNA_ligase_aden: NAD-dependent DNA ligase adenylation domain; InterPro: IPR013839 DNA ligase (polydeoxyribonucleotide synthase) is the enzyme that joins two DNA fragments by catalyzing the formation of an internucleotide ester bond between phosphate and deoxyribose | Back alignment and domain information |
|---|
| >PLN00209 ribosomal protein S27; Provisional | Back alignment and domain information |
|---|
| >smart00834 CxxC_CXXC_SSSS Putative regulatory protein | Back alignment and domain information |
|---|
| >PRK09710 lar restriction alleviation and modification protein; Reviewed | Back alignment and domain information |
|---|
| >COG1645 Uncharacterized Zn-finger containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00575 dnlj DNA ligase, NAD-dependent | Back alignment and domain information |
|---|
| >PTZ00083 40S ribosomal protein S27; Provisional | Back alignment and domain information |
|---|
| >PF08271 TF_Zn_Ribbon: TFIIB zinc-binding; InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >smart00532 LIGANc Ligase N family | Back alignment and domain information |
|---|
| >PRK07956 ligA NAD-dependent DNA ligase LigA; Validated | Back alignment and domain information |
|---|
| >PRK05978 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK02935 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF14353 CpXC: CpXC protein | Back alignment and domain information |
|---|
| >TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300 | Back alignment and domain information |
|---|
| >PRK06266 transcription initiation factor E subunit alpha; Validated | Back alignment and domain information |
|---|
| >PHA00626 hypothetical protein | Back alignment and domain information |
|---|
| >PF14803 Nudix_N_2: Nudix N-terminal; PDB: 3CNG_C | Back alignment and domain information |
|---|
| >PRK14890 putative Zn-ribbon RNA-binding protein; Provisional | Back alignment and domain information |
|---|
| >PF14255 Cys_rich_CPXG: Cysteine-rich CPXCG | Back alignment and domain information |
|---|
| >smart00659 RPOLCX RNA polymerase subunit CX | Back alignment and domain information |
|---|
| >PF09723 Zn-ribbon_8: Zinc ribbon domain; InterPro: IPR013429 This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria | Back alignment and domain information |
|---|
| >PF10571 UPF0547: Uncharacterised protein family UPF0547; InterPro: IPR018886 This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines | Back alignment and domain information |
|---|
| >TIGR00373 conserved hypothetical protein TIGR00373 | Back alignment and domain information |
|---|
| >PF09862 DUF2089: Protein of unknown function (DUF2089); InterPro: IPR018658 This family consists of various hypothetical prokaryotic proteins | Back alignment and domain information |
|---|
| >PF13719 zinc_ribbon_5: zinc-ribbon domain | Back alignment and domain information |
|---|
| >PRK14351 ligA NAD-dependent DNA ligase LigA; Provisional | Back alignment and domain information |
|---|
| >PF14354 Lar_restr_allev: Restriction alleviation protein Lar | Back alignment and domain information |
|---|
| >TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family | Back alignment and domain information |
|---|
| >PF05191 ADK_lid: Adenylate kinase, active site lid; InterPro: IPR007862 Adenylate kinases (ADK; 2 | Back alignment and domain information |
|---|
| >PRK14350 ligA NAD-dependent DNA ligase LigA; Provisional | Back alignment and domain information |
|---|
| >PF06677 Auto_anti-p27: Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27); InterPro: IPR009563 The proteins in this entry are functionally uncharacterised and include several proteins that characterise Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27) | Back alignment and domain information |
|---|
| >PF05876 Terminase_GpA: Phage terminase large subunit (GpA); InterPro: IPR008866 This entry is represented by Bacteriophage lambda, GpA | Back alignment and domain information |
|---|
| >PF13717 zinc_ribbon_4: zinc-ribbon domain | Back alignment and domain information |
|---|
| >PF07282 OrfB_Zn_ribbon: Putative transposase DNA-binding domain; InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins | Back alignment and domain information |
|---|
| >smart00661 RPOL9 RNA polymerase subunit 9 | Back alignment and domain information |
|---|
| >COG5349 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PRK00464 nrdR transcriptional regulator NrdR; Validated | Back alignment and domain information |
|---|
| >COG3877 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PF03367 zf-ZPR1: ZPR1 zinc-finger domain; InterPro: IPR004457 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF03604 DNA_RNApol_7kD: DNA directed RNA polymerase, 7 kDa subunit; InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates | Back alignment and domain information |
|---|
| >TIGR03655 anti_R_Lar restriction alleviation protein, Lar family | Back alignment and domain information |
|---|
| >smart00709 Zpr1 Duplicated domain in the epidermal growth factor- and elongation factor-1alpha-binding protein Zpr1 | Back alignment and domain information |
|---|
| >PF01096 TFIIS_C: Transcription factor S-II (TFIIS); InterPro: IPR001222 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PRK00432 30S ribosomal protein S27ae; Validated | Back alignment and domain information |
|---|
| >PF12773 DZR: Double zinc ribbon | Back alignment and domain information |
|---|
| >smart00440 ZnF_C2C2 C2C2 Zinc finger | Back alignment and domain information |
|---|
| >PF10083 DUF2321: Uncharacterized protein conserved in bacteria (DUF2321); InterPro: IPR016891 This entry is represented by Bacteriophage 'Lactobacillus prophage Lj928', Orf-Ljo1454 | Back alignment and domain information |
|---|
| >PRK12495 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK14892 putative transcription elongation factor Elf1; Provisional | Back alignment and domain information |
|---|
| >COG0272 Lig NAD-dependent DNA ligase (contains BRCT domain type II) [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF04216 FdhE: Protein involved in formate dehydrogenase formation; InterPro: IPR006452 This family of sequences describe an accessory protein required for the assembly of formate dehydrogenase of certain proteobacteria although not present in the final complex [] | Back alignment and domain information |
|---|
| >PRK14714 DNA polymerase II large subunit; Provisional | Back alignment and domain information |
|---|
| >PF07754 DUF1610: Domain of unknown function (DUF1610); InterPro: IPR011668 This domain is found in archaeal species | Back alignment and domain information |
|---|
| >COG1096 Predicted RNA-binding protein (consists of S1 domain and a Zn-ribbon domain) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK03824 hypA hydrogenase nickel incorporation protein; Provisional | Back alignment and domain information |
|---|
| >COG1675 TFA1 Transcription initiation factor IIE, alpha subunit [Transcription] | Back alignment and domain information |
|---|
| >PF09567 RE_MamI: MamI restriction endonuclease; InterPro: IPR019067 There are four classes of restriction endonucleases: types I, II,III and IV | Back alignment and domain information |
|---|
| >smart00778 Prim_Zn_Ribbon Zinc-binding domain of primase-helicase | Back alignment and domain information |
|---|
| >COG1779 C4-type Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK01103 formamidopyrimidine/5-formyluracil/ 5-hydroxymethyluracil DNA glycosylase; Validated | Back alignment and domain information |
|---|
| >PF09851 SHOCT: Short C-terminal domain; InterPro: IPR018649 This family of hypothetical prokaryotic proteins has no known function | Back alignment and domain information |
|---|
| >PF05129 Elf1: Transcription elongation factor Elf1 like; InterPro: IPR007808 This family of uncharacterised, mostly short, proteins contain a putative zinc binding domain with four conserved cysteines | Back alignment and domain information |
|---|
| >COG0675 Transposase and inactivated derivatives [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF01155 HypA: Hydrogenase expression/synthesis hypA family; InterPro: IPR000688 Bacterial membrane-bound nickel-dependent hydrogenases requires a number of accessory proteins which are involved in their maturation | Back alignment and domain information |
|---|
| >PF01807 zf-CHC2: CHC2 zinc finger; InterPro: IPR002694 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional | Back alignment and domain information |
|---|
| >PRK03681 hypA hydrogenase nickel incorporation protein; Validated | Back alignment and domain information |
|---|
| >TIGR00100 hypA hydrogenase nickel insertion protein HypA | Back alignment and domain information |
|---|
| >TIGR00244 transcriptional regulator NrdR | Back alignment and domain information |
|---|
| >PF15616 TerY-C: TerY-C metal binding domain | Back alignment and domain information |
|---|
| >COG3677 Transposase and inactivated derivatives [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 211 | |||
| 3k1f_M | 197 | Transcription initiation factor IIB; RNA polymeras | 1e-04 |
| >3k1f_M Transcription initiation factor IIB; RNA polymerase II, TFIIB, transcription factor, DNA-binding, DNA-directed RNA polymerase; 4.30A {Saccharomyces cerevisiae} Length = 197 | Back alignment and structure |
|---|
Score = 40.4 bits (94), Expect = 1e-04
Identities = 11/52 (21%), Positives = 19/52 (36%), Gaps = 13/52 (25%)
Query: 159 CPNCGTENVSFFGTILSISSGGTTNTINCSNCGTTMVYDSNTRLITLPEGSE 210
CP C + S G + + C+ CG + + +L+ SE
Sbjct: 24 CPECKVYPPKI---VERFSEG---DVV-CALCGLVL----SDKLVD--TRSE 62
|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 211 | |||
| 4esj_A | 257 | Type-2 restriction enzyme DPNI; restriction endonu | 96.75 | |
| 1qxf_A | 66 | GR2, 30S ribosomal protein S27E; structural genomi | 95.78 | |
| 1b04_A | 318 | Protein (DNA ligase); DNA replication; 2.80A {Geob | 95.77 | |
| 3j20_W | 63 | 30S ribosomal protein S27E; archaea, archaeal, KIN | 95.49 | |
| 2xzm_6 | 81 | RPS27E; ribosome, translation; 3.93A {Tetrahymena | 94.55 | |
| 3jsl_A | 318 | DNA ligase; NAD+-dependent, DNA damage, DNA repair | 94.52 | |
| 3uq8_A | 322 | DNA ligase; adenylated protein, ATP-grAsp, rossman | 94.46 | |
| 4glw_A | 305 | DNA ligase; inhibitor, ligase-ligase inhibitor com | 94.41 | |
| 3u5c_b | 82 | RP61, YS20, 40S ribosomal protein S27-A; translati | 94.27 | |
| 2owo_A | 671 | DNA ligase; protein-DNA complex, ligase-DNA comple | 94.01 | |
| 1ta8_A | 332 | DNA ligase, NAD-dependent; nucleotidyl transferase | 93.94 | |
| 1zau_A | 328 | DNA ligase; AMP; HET: DNA AMP; 3.15A {Mycobacteriu | 93.94 | |
| 1nui_A | 255 | DNA primase/helicase; zinc-biding domain, toprim f | 93.21 | |
| 4glx_A | 586 | DNA ligase; inhibitor, ligase-ligase inhibitor-DNA | 93.12 | |
| 1dgs_A | 667 | DNA ligase; AMP complex, NAD+-dependent; HET: DNA | 92.96 | |
| 3iz6_X | 86 | 40S ribosomal protein S27 (S27E); eukaryotic ribos | 92.26 | |
| 1pft_A | 50 | TFIIB, PFTFIIBN; N-terminal domain, transcription | 91.72 | |
| 1qyp_A | 57 | RNA polymerase II; transcription, RPB9, Zn ribbon, | 90.8 | |
| 3j20_Y | 50 | 30S ribosomal protein S27AE; archaea, archaeal, KI | 90.51 | |
| 1twf_L | 70 | ABC10-alpha, DNA-directed RNA polymerases I, II, a | 89.62 | |
| 1dl6_A | 58 | Transcription factor II B (TFIIB); zinc ribbon, ge | 89.58 | |
| 3flo_B | 206 | DNA polymerase alpha catalytic subunit A; protein- | 88.74 | |
| 1lko_A | 191 | Rubrerythrin all-iron(II) form; reduced form, DIIR | 87.94 | |
| 3sgi_A | 615 | DNA ligase; HET: DNA AMP; 3.50A {Mycobacterium tub | 86.94 | |
| 1vq8_Z | 83 | 50S ribosomal protein L37AE; ribosome 50S, protein | 85.9 | |
| 1x3z_A | 335 | Peptide: N-glycanase; hydrolase-hydrolase inhibito | 85.75 | |
| 1gh9_A | 71 | 8.3 kDa protein (gene MTH1184); beta+alpha complex | 84.01 | |
| 3v2d_5 | 60 | 50S ribosomal protein L32; ribosome associated inh | 83.44 | |
| 2kdx_A | 119 | HYPA, hydrogenase/urease nickel incorporation prot | 83.3 | |
| 3pwf_A | 170 | Rubrerythrin; non heme iron peroxidases, oxidative | 83.24 | |
| 3h0g_L | 63 | DNA-directed RNA polymerases I, II, and III subuni | 82.87 | |
| 2lcq_A | 165 | Putative toxin VAPC6; PIN domain, Zn ribbon domain | 82.77 | |
| 3m7n_A | 179 | Putative uncharacterized protein AF_0206; exosome, | 81.36 | |
| 2qkd_A | 404 | Zinc finger protein ZPR1; helical hairpins, beta h | 80.55 | |
| 1wii_A | 85 | Hypothetical UPF0222 protein MGC4549; domain of un | 80.31 |
| >4esj_A Type-2 restriction enzyme DPNI; restriction endonuclease-DNA complex, type IIM, type IIE, RE enzyme, DPNI; HET: DNA 6MA; 2.05A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
Probab=96.75 E-value=0.0011 Score=58.42 Aligned_cols=50 Identities=24% Similarity=0.468 Sum_probs=37.1
Q ss_pred HHHHHHHhhhccceeeecCCCCCccc-ceeeccccccccCCCCcCceeCCCCCceeEEecCc
Q 028248 140 LSQSLTKLIVRESLILKGPCPNCGTE-NVSFFGTILSISSGGTTNTINCSNCGTTMVYDSNT 200 (211)
Q Consensus 140 ~a~~lt~~~~~d~liLkG~CPnCg~E-v~aFfg~i~~v~s~~~~~~~kC~~C~~~L~f~~~~ 200 (211)
.|..||.-|+..+. -|||||.. ...| ++|+.....-|++|.+..+..++.
T Consensus 22 ~aRVLTE~Wv~~n~----yCPnCG~~~l~~f-------~nN~PVaDF~C~~C~EeyELKSk~ 72 (257)
T 4esj_A 22 KARILTEDWVYRQS----YCPNCGNNPLNHF-------ENNRPVADFYCNHCSEEFELKSKK 72 (257)
T ss_dssp HHHHHHHHHHHHHC----CCTTTCCSSCEEC-----------CCCEEECTTTCCEEEEEEEE
T ss_pred eehhhhHHHHHHCC----cCCCCCChhhhhc-------cCCCcccccccCCcchhheecccc
Confidence 46677887777665 89999996 4466 667777889999999999998863
|
| >1qxf_A GR2, 30S ribosomal protein S27E; structural genomics, beta sheet, PSI, protein structure initiative; NMR {Archaeoglobus fulgidus} SCOP: g.41.8.4 | Back alignment and structure |
|---|
| >1b04_A Protein (DNA ligase); DNA replication; 2.80A {Geobacillus stearothermophilus} SCOP: d.142.2.2 | Back alignment and structure |
|---|
| >3j20_W 30S ribosomal protein S27E; archaea, archaeal, KINK-turn, protein synthe ribosome; 6.60A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >2xzm_6 RPS27E; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_6 | Back alignment and structure |
|---|
| >3jsl_A DNA ligase; NAD+-dependent, DNA damage, DNA repair, DNA replication, magnesium, manganese, metal-binding, NAD, zinc; HET: DNA; 1.80A {Staphylococcus aureus} SCOP: d.142.2.2 PDB: 3jsn_A* | Back alignment and structure |
|---|
| >3uq8_A DNA ligase; adenylated protein, ATP-grAsp, rossman fold, adenylation; HET: DNA NAD AMP; 1.70A {Haemophilus influenzae} PDB: 3pn1_A* 3bac_A* | Back alignment and structure |
|---|
| >4glw_A DNA ligase; inhibitor, ligase-ligase inhibitor complex; HET: DNA 0XT NMN; 2.00A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >3u5c_b RP61, YS20, 40S ribosomal protein S27-A; translation, ribosome, ribosomal, ribosomal R ribosomal protein, eukaryotic ribosome, RNA-protein C; 3.00A {Saccharomyces cerevisiae} PDB: 3izb_X 3u5g_b | Back alignment and structure |
|---|
| >2owo_A DNA ligase; protein-DNA complex, ligase-DNA complex; HET: DNA OMC AMP; 2.30A {Escherichia coli} | Back alignment and structure |
|---|
| >1ta8_A DNA ligase, NAD-dependent; nucleotidyl transferase fold; HET: DNA NMN; 1.80A {Enterococcus faecalis} SCOP: d.142.2.2 PDB: 3ba8_A* 1tae_A* 3ba9_A* 3baa_A* 3bab_A* | Back alignment and structure |
|---|
| >1zau_A DNA ligase; AMP; HET: DNA AMP; 3.15A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1nui_A DNA primase/helicase; zinc-biding domain, toprim fold, DNA replication, DNA-direct polymerase, primosome, late protein, ATP-binding; HET: DNA; 2.90A {Enterobacteria phage T7} SCOP: e.13.1.2 g.41.3.2 | Back alignment and structure |
|---|
| >4glx_A DNA ligase; inhibitor, ligase-ligase inhibitor-DNA complex; HET: DNA 0XS; 1.90A {Escherichia coli} | Back alignment and structure |
|---|
| >1dgs_A DNA ligase; AMP complex, NAD+-dependent; HET: DNA AMP; 2.90A {Thermus filiformis} SCOP: a.60.2.2 b.40.4.6 d.142.2.2 PDB: 1v9p_A* | Back alignment and structure |
|---|
| >3iz6_X 40S ribosomal protein S27 (S27E); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} | Back alignment and structure |
|---|
| >1pft_A TFIIB, PFTFIIBN; N-terminal domain, transcription initiation factor; NMR {Pyrococcus furiosus} SCOP: g.41.3.1 | Back alignment and structure |
|---|
| >1qyp_A RNA polymerase II; transcription, RPB9, Zn ribbon, hyperthermophilic, extremophIle; NMR {Thermococcus celer} SCOP: g.41.3.1 | Back alignment and structure |
|---|
| >3j20_Y 30S ribosomal protein S27AE; archaea, archaeal, KINK-turn, protein synthe ribosome; 6.60A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >1twf_L ABC10-alpha, DNA-directed RNA polymerases I, II, and III 7.7 K polypeptide; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: g.41.9.2 PDB: 1i3q_L 1i6h_L 1k83_L* 1nik_L 1nt9_L 1pqv_L 1r5u_L 1r9s_L* 1r9t_L* 1sfo_L* 1twa_L* 1twc_L* 1i50_L* 1twg_L* 1twh_L* 1wcm_L 1y1v_L 1y1w_L 1y1y_L 1y77_L* ... | Back alignment and structure |
|---|
| >1dl6_A Transcription factor II B (TFIIB); zinc ribbon, gene regulation; NMR {Homo sapiens} SCOP: g.41.3.1 PDB: 1rly_A 1ro4_A | Back alignment and structure |
|---|
| >3flo_B DNA polymerase alpha catalytic subunit A; protein-protein complex, phosphoesterase fold, OB fold, zinc motif, DNA replication, nucleus; HET: DNA; 2.50A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1lko_A Rubrerythrin all-iron(II) form; reduced form, DIIRON, four-helix bundle, rubre like, electron transport; 1.63A {Desulfovibrio vulgaris} SCOP: a.25.1.1 g.41.5.1 PDB: 1dvb_A 1jyb_A 1b71_A 1lkm_A 1lkp_A 1qyb_A 1s2z_A 1s30_A 1ryt_A | Back alignment and structure |
|---|
| >3sgi_A DNA ligase; HET: DNA AMP; 3.50A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1vq8_Z 50S ribosomal protein L37AE; ribosome 50S, protein-protein complex, RNA-RNA complex, PROT complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} SCOP: g.41.8.1 PDB: 1vq4_Z* 1vq6_Z* 1vq5_Z* 1vq7_Z* 1vq9_Z* 1vqk_Z* 1vql_Z* 1vqm_Z* 1vqn_Z* 1vqo_Z* 1vqp_Z* 1yhq_Z* 1yi2_Z* 1yij_Z* 1yit_Z* 1yj9_Z* 1yjn_Z* 1yjw_Z* 2qa4_Z* 1s72_Z* ... | Back alignment and structure |
|---|
| >1x3z_A Peptide: N-glycanase; hydrolase-hydrolase inhibitor complex; HET: SUC; 2.80A {Saccharomyces cerevisiae} SCOP: d.3.1.4 PDB: 1x3w_A* 3esw_A* | Back alignment and structure |
|---|
| >1gh9_A 8.3 kDa protein (gene MTH1184); beta+alpha complex structure, structural genomics, PSI, protein structure initiative; NMR {Methanothermobacterthermautotrophicus} SCOP: g.41.6.1 | Back alignment and structure |
|---|
| >3v2d_5 50S ribosomal protein L32; ribosome associated inhibitor A, RAIA, protein Y, stress RES stationary phase, ribosome hibernation, ribosome; 2.70A {Thermus thermophilus} PDB: 2hgq_4 2hgj_4 2hgu_4 2j03_5 2jl6_5 2jl8_5 2v47_5 2v49_5 2wdi_5 2wdj_5 2wdl_5 2wdn_5 2wh2_5 2wh4_5 2wrj_5 2wrl_5 2wro_5 2wrr_5 2x9s_5 2x9u_5 ... | Back alignment and structure |
|---|
| >2kdx_A HYPA, hydrogenase/urease nickel incorporation protein HYPA; metallochaperone, metal-binding, metal- binding protein; NMR {Helicobacter pylori} | Back alignment and structure |
|---|
| >3pwf_A Rubrerythrin; non heme iron peroxidases, oxidative stress, oxidoreductase; 1.64A {Pyrococcus furiosus} PDB: 3mps_A 3pza_A 3qvd_A 1nnq_A 2hr5_A | Back alignment and structure |
|---|
| >3h0g_L DNA-directed RNA polymerases I, II, and III subunit rpabc4; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >2lcq_A Putative toxin VAPC6; PIN domain, Zn ribbon domain, ribosome biogenesis, metal BIN protein; NMR {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3m7n_A Putative uncharacterized protein AF_0206; exosome, RNA, exonuclease, hydrolase, nuclease, hydrolase-RN; 2.40A {Archaeoglobus fulgidus} PDB: 2ba1_A 3m85_A | Back alignment and structure |
|---|
| >2qkd_A Zinc finger protein ZPR1; helical hairpins, beta helix, anti-parrallel beta sheet, double straded anti-parallel beta helix, metal binding protein; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >1wii_A Hypothetical UPF0222 protein MGC4549; domain of unknown function, zinc finger, metal-binding protein, structural genomics; NMR {Mus musculus} SCOP: g.41.3.4 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 211 | ||||
| d1b04a_ | 312 | d.142.2.2 (A:) Adenylation domain of NAD+-dependen | 3e-05 | |
| d1ta8a_ | 313 | d.142.2.2 (A:) Adenylation domain of NAD+-dependen | 4e-05 | |
| d1dgsa3 | 314 | d.142.2.2 (A:1-314) Adenylation domain of NAD+-dep | 6e-05 |
| >d1b04a_ d.142.2.2 (A:) Adenylation domain of NAD+-dependent DNA ligase {Bacillus stearothermophilus [TaxId: 1422]} Length = 312 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: ATP-grasp superfamily: DNA ligase/mRNA capping enzyme, catalytic domain family: Adenylation domain of NAD+-dependent DNA ligase domain: Adenylation domain of NAD+-dependent DNA ligase species: Bacillus stearothermophilus [TaxId: 1422]
Score = 41.5 bits (96), Expect = 3e-05
Identities = 10/21 (47%), Positives = 14/21 (66%)
Query: 37 YVAGKPIMSDEEYDKLKQKLK 57
YV +P + D EYD+L Q+L
Sbjct: 24 YVLDRPSVPDAEYDRLMQELI 44
|
| >d1ta8a_ d.142.2.2 (A:) Adenylation domain of NAD+-dependent DNA ligase {Enterococcus faecalis [TaxId: 1351]} Length = 313 | Back information, alignment and structure |
|---|
| >d1dgsa3 d.142.2.2 (A:1-314) Adenylation domain of NAD+-dependent DNA ligase {Thermus filiformis [TaxId: 276]} Length = 314 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 211 | |||
| d1ta8a_ | 313 | Adenylation domain of NAD+-dependent DNA ligase {E | 96.95 | |
| d1b04a_ | 312 | Adenylation domain of NAD+-dependent DNA ligase {B | 96.84 | |
| d1dgsa3 | 314 | Adenylation domain of NAD+-dependent DNA ligase {T | 96.59 | |
| d1qxfa_ | 58 | Ribosomal protein S27e {Archaeon Archaeoglobus ful | 96.07 | |
| d1pfva3 | 35 | Methionyl-tRNA synthetase (MetRS), Zn-domain {Esch | 94.13 | |
| d1rqga3 | 35 | Methionyl-tRNA synthetase (MetRS), Zn-domain {Pyro | 94.07 | |
| d1s3ga2 | 35 | Microbial and mitochondrial ADK, insert "zinc fing | 90.77 | |
| d1akya2 | 38 | Microbial and mitochondrial ADK, insert "zinc fing | 90.16 | |
| d1dl6a_ | 58 | Transcription initiation factor TFIIB, N-terminal | 90.1 | |
| d1zina2 | 35 | Microbial and mitochondrial ADK, insert "zinc fing | 89.98 | |
| d2ak3a2 | 37 | Microbial and mitochondrial ADK, insert "zinc fing | 89.07 | |
| d1pfta_ | 50 | Transcription initiation factor TFIIB, N-terminal | 87.75 | |
| d1e4va2 | 35 | Microbial and mitochondrial ADK, insert "zinc fing | 86.64 | |
| d2j0151 | 59 | Ribosomal protein L32p {Thermus thermophilus [TaxI | 85.54 | |
| d2f4ma1 | 287 | Peptide:N-glycanase 1, PNG1 {Mouse (Mus musculus) | 83.97 | |
| d1d0qa_ | 102 | Zinc-binding domain of DNA primase {Bacillus stear | 83.88 | |
| d1nnqa2 | 37 | Rubrerythrin, C-terminal domain {Archaeon Pyrococc | 83.52 | |
| d1yuza2 | 36 | Nigerythrin, C-terminal domain {Desulfovibrio vulg | 81.7 | |
| d2qam01 | 56 | Ribosomal protein L32p {Escherichia coli [TaxId: 5 | 81.06 | |
| d1k3xa3 | 40 | Endonuclease VIII {Escherichia coli [TaxId: 562]} | 80.79 |
| >d1ta8a_ d.142.2.2 (A:) Adenylation domain of NAD+-dependent DNA ligase {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: ATP-grasp superfamily: DNA ligase/mRNA capping enzyme, catalytic domain family: Adenylation domain of NAD+-dependent DNA ligase domain: Adenylation domain of NAD+-dependent DNA ligase species: Enterococcus faecalis [TaxId: 1351]
Probab=96.95 E-value=0.00029 Score=59.33 Aligned_cols=27 Identities=30% Similarity=0.434 Sum_probs=22.9
Q ss_pred HHHHhhh-cCCCccChHHHHHHHHHHhh
Q 028248 32 EASMAYV-AGKPIMSDEEYDKLKQKLKM 58 (211)
Q Consensus 32 eA~~aY~-~G~Pi~sD~efD~Lk~~Lk~ 58 (211)
++-.+|| .|+|+|||+|||.|+.+|+.
T Consensus 20 ~~~~~Yy~~~~p~iSD~eYD~L~~~L~~ 47 (313)
T d1ta8a_ 20 QYSHEYYVKDQPSVEDYVYDRLYKELVD 47 (313)
T ss_dssp HHHHHHHTSSCCSSCHHHHHHHHHHHHH
T ss_pred HHHHHHhcCCCCCCCHHHHHHHHHHHHH
Confidence 3446788 59999999999999999975
|
| >d1b04a_ d.142.2.2 (A:) Adenylation domain of NAD+-dependent DNA ligase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1dgsa3 d.142.2.2 (A:1-314) Adenylation domain of NAD+-dependent DNA ligase {Thermus filiformis [TaxId: 276]} | Back information, alignment and structure |
|---|
| >d1qxfa_ g.41.8.4 (A:) Ribosomal protein S27e {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1pfva3 g.41.1.1 (A:141-175) Methionyl-tRNA synthetase (MetRS), Zn-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1rqga3 g.41.1.1 (A:139-173) Methionyl-tRNA synthetase (MetRS), Zn-domain {Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d1s3ga2 g.41.2.1 (A:126-160) Microbial and mitochondrial ADK, insert "zinc finger" domain {Bacillus globisporus [TaxId: 1459]} | Back information, alignment and structure |
|---|
| >d1akya2 g.41.2.1 (A:131-168) Microbial and mitochondrial ADK, insert "zinc finger" domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1dl6a_ g.41.3.1 (A:) Transcription initiation factor TFIIB, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zina2 g.41.2.1 (A:126-160) Microbial and mitochondrial ADK, insert "zinc finger" domain {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d2ak3a2 g.41.2.1 (A:125-161) Microbial and mitochondrial ADK, insert "zinc finger" domain {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1pfta_ g.41.3.1 (A:) Transcription initiation factor TFIIB, N-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1e4va2 g.41.2.1 (A:122-156) Microbial and mitochondrial ADK, insert "zinc finger" domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2j0151 g.41.8.5 (5:2-60) Ribosomal protein L32p {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2f4ma1 d.3.1.4 (A:164-450) Peptide:N-glycanase 1, PNG1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1d0qa_ g.41.3.2 (A:) Zinc-binding domain of DNA primase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1nnqa2 g.41.5.1 (A:135-171) Rubrerythrin, C-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1yuza2 g.41.5.1 (A:167-202) Nigerythrin, C-terminal domain {Desulfovibrio vulgaris [TaxId: 881]} | Back information, alignment and structure |
|---|
| >d2qam01 g.41.8.5 (0:1-56) Ribosomal protein L32p {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1k3xa3 g.39.1.8 (A:223-262) Endonuclease VIII {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|