Citrus Sinensis ID: 028248


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-
MSNEEFDNLKEELMWEGSSVVMLSSAEQKFLEASMAYVAGKPIMSDEEYDKLKQKLKMEGSEIVVEGPRCSLRSRKVYSDLSVDYLKMLLLNVPATVVALGLFFFLDDITGFEITYLLELPEPFSFIFTWFAAVPLIVYLSQSLTKLIVRESLILKGPCPNCGTENVSFFGTILSISSGGTTNTINCSNCGTTMVYDSNTRLITLPEGSEA
ccHHHHHHHHHHHcccccEEEEEcHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHccccEEEEcccEEEccccEEcccccHHHHHHHHHHHHHHHHHHHHHHHccccccEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEccccccccccEEcccccccccccccccEEccccccEEEEEcccEEEEccccccc
ccHHHHHHHHHHHccccccEEEccHHHHHHHHHHHHHHcccccEcHHHHHHHHHHHHHccccEEEEcccccccccEEEEcHHHHHHHHHHHcccHHHHHHHHHHHcccccccccEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcEEEEccccccccccEEEEEccccccccccccccEEEccccEEEEEcccEEEEEccccccc
msneefdnLKEELMWEGSSVVMLSSAEQKFLEASMAYvagkpimsdeEYDKLKQKLKMEgseivvegprcslrsrkvysDLSVDYLKMLLLNVPATVVALGLFFFLDDITGFEITYllelpepfsfifTWFAAVPLIVYLSQSLTKLIVREslilkgpcpncgtenvsFFGTILSissggttntincsncgttmvydsntrlitlpegsea
msneefdnLKEELMWEGSSVVMLSSAEQKFLEASMAYVAGKPIMSDEEYDKLKQKLKmegseivvegprcslrsrkVYSDLSVDYLKMLLLNVPATVVALGLFFFLDDITGFEITYLLELPEPFSFIFTWFAAVPLIVYLSQSLTKLIVRESLILKGPCPNCGTENVSFFGTILSISSGGTTNTincsncgttmvydsntrlitlpegsea
MSNEEFDNLKEELMWEGSSVVMLSSAEQKFLEASMAYVAGKPIMSDEEYDKLKQKLKMEGSEIVVEGPRCSLRSRKVYSDLSVDYLKMLLLNVPATVVALGLFFFLDDITGFEITYLLELPEPFSFIFTWFAAVPLIVYLSQSLTKLIVRESLILKGPCPNCGTENVSFFGTILSISSGGTTNTINCSNCGTTMVYDSNTRLITLPEGSEA
*******************VVML*****KFLEASMAYVAG*********************EIVVEGPRCSLRSRKVYSDLSVDYLKMLLLNVPATVVALGLFFFLDDITGFEITYLLELPEPFSFIFTWFAAVPLIVYLSQSLTKLIVRESLILKGPCPNCGTENVSFFGTILSISSGGTTNTINCSNCGTTMVYDSNTRLIT*******
***EEFDNLKEELMWEGSSVVMLSSAEQKFLEASMAYVAGKPIMSDEEYDKLKQKLKMEGSEIVVEGPRCSLRSRKVYSDLSVDYLKMLLLNVPATVVALGLFFFLDDITGFEITYLLELPEPFSFIFTWFAAVPLIVYLSQSLTKLIVRESLILKGPCPNCGTENVSFFGTILS********TINCSNCGTTMVYDSN************
********LKEELMWEGSSVVMLSSAEQKFLEASMAYVAGKPIMSDEEYDKLKQKLKMEGSEIVVEGPRCSLRSRKVYSDLSVDYLKMLLLNVPATVVALGLFFFLDDITGFEITYLLELPEPFSFIFTWFAAVPLIVYLSQSLTKLIVRESLILKGPCPNCGTENVSFFGTILSISSGGTTNTINCSNCGTTMVYDSNTRLITLPEGSEA
*SNEEFDNLKEELMWEGSSVVMLSSAEQKFLEASMAYVAGKPIMSDEEYDKLKQKLKMEGSEIVVEGPRCSLRSRKVYSDLSVDYLKMLLLNVPATVVALGLFFFLDDITGFEITYLLELPEPFSFIFTWFAAVPLIVYLSQSLTKLIVRESLILKGPCPNCGTENVSFFGTILSISSGGTTNTINCSNCGTTMVYDSNTRLITLPE****
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSNEEFDNLKEELMWEGSSVVMLSSAEQKFLEASMAYVAGKPIMSDEEYDKLKQKLKMEGSEIVVEGPRCSLRSRKVYSDLSVDYLKMLLLNVPATVVALGLFFFLDDITGFEITYLLELPEPFSFIFTWFAAVPLIVYLSQSLTKLIVRESLILKGPCPNCGTENVSFFGTILSISSGGTTNTINCSNCGTTMVYDSNTRLITLPEGSEA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query211 2.2.26 [Sep-21-2011]
Q8H112324 PGR5-like protein 1A, chl yes no 1.0 0.651 0.838 1e-104
Q8GYC7313 PGR5-like protein 1B, chl no no 1.0 0.674 0.838 1e-102
>sp|Q8H112|PGL1A_ARATH PGR5-like protein 1A, chloroplastic OS=Arabidopsis thaliana GN=PGRL1A PE=1 SV=1 Back     alignment and function desciption
 Score =  377 bits (968), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 177/211 (83%), Positives = 199/211 (94%)

Query: 1   MSNEEFDNLKEELMWEGSSVVMLSSAEQKFLEASMAYVAGKPIMSDEEYDKLKQKLKMEG 60
           MSNEEFDNLKEELMWEGSSVVMLSS EQ+FLEASMAYV+G PI++DEEYDKLK KLK++G
Sbjct: 114 MSNEEFDNLKEELMWEGSSVVMLSSDEQRFLEASMAYVSGNPILNDEEYDKLKLKLKIDG 173

Query: 61  SEIVVEGPRCSLRSRKVYSDLSVDYLKMLLLNVPATVVALGLFFFLDDITGFEITYLLEL 120
           S+IV EGPRCSLRS+KVYSDL+VDY KMLLLNVPATVVALGLFFFLDDITGFEITY++EL
Sbjct: 174 SDIVSEGPRCSLRSKKVYSDLAVDYFKMLLLNVPATVVALGLFFFLDDITGFEITYIMEL 233

Query: 121 PEPFSFIFTWFAAVPLIVYLSQSLTKLIVRESLILKGPCPNCGTENVSFFGTILSISSGG 180
           PEP+SFIFTWFAAVP+IVYL+ S+TKLI+++ LILKGPCPNCGTEN SFFGTILSISSGG
Sbjct: 234 PEPYSFIFTWFAAVPVIVYLALSITKLIIKDFLILKGPCPNCGTENTSFFGTILSISSGG 293

Query: 181 TTNTINCSNCGTTMVYDSNTRLITLPEGSEA 211
            TNT+ C+NCGT MVYDS +RLITLPEGS+A
Sbjct: 294 KTNTVKCTNCGTAMVYDSGSRLITLPEGSQA 324




Involved in cyclic electron flow (CEF) around photosystem I.
Arabidopsis thaliana (taxid: 3702)
>sp|Q8GYC7|PGL1B_ARATH PGR5-like protein 1B, chloroplastic OS=Arabidopsis thaliana GN=PGRL1B PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query211
356514103 321 PREDICTED: PGR5-like protein 1A, chlorop 1.0 0.657 0.857 1e-103
255537217 320 conserved hypothetical protein [Ricinus 1.0 0.659 0.867 1e-103
297742627 326 unnamed protein product [Vitis vinifera] 1.0 0.647 0.862 1e-102
145333783 321 PGR5-like protein 1A [Arabidopsis thalia 1.0 0.657 0.838 1e-102
145333797 322 PGR5-like protein 1A [Arabidopsis thalia 1.0 0.655 0.838 1e-102
225426724 331 PREDICTED: PGR5-like protein 1A, chlorop 1.0 0.637 0.862 1e-102
18416029 324 PGR5-like protein 1A [Arabidopsis thalia 1.0 0.651 0.838 1e-102
118487360 323 unknown [Populus trichocarpa] 1.0 0.653 0.862 1e-102
255645443 321 unknown [Glycine max] 1.0 0.657 0.853 1e-102
297803832 320 hypothetical protein ARALYDRAFT_492575 [ 1.0 0.659 0.838 1e-102
>gi|356514103|ref|XP_003525746.1| PREDICTED: PGR5-like protein 1A, chloroplastic-like [Glycine max] Back     alignment and taxonomy information
 Score =  378 bits (971), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 181/211 (85%), Positives = 198/211 (93%)

Query: 1   MSNEEFDNLKEELMWEGSSVVMLSSAEQKFLEASMAYVAGKPIMSDEEYDKLKQKLKMEG 60
           MSNEEFDNLKEELMWEGSSVVMLSS EQKFLEASMAYV+GKPIMSD+E+D+LK +LK+EG
Sbjct: 111 MSNEEFDNLKEELMWEGSSVVMLSSDEQKFLEASMAYVSGKPIMSDKEFDELKLRLKIEG 170

Query: 61  SEIVVEGPRCSLRSRKVYSDLSVDYLKMLLLNVPATVVALGLFFFLDDITGFEITYLLEL 120
           SEIV EGPRCSLRSRKVYSDLSVDYLKMLLLNVPATV+ALGLFFFLDD+TGFEITYLLEL
Sbjct: 171 SEIVAEGPRCSLRSRKVYSDLSVDYLKMLLLNVPATVIALGLFFFLDDLTGFEITYLLEL 230

Query: 121 PEPFSFIFTWFAAVPLIVYLSQSLTKLIVRESLILKGPCPNCGTENVSFFGTILSISSGG 180
           PEPFSFIFTWFAAVPLIV+++ SLT  IV++ +ILKGPCPNCGTEN SFFGTILSIS+GG
Sbjct: 231 PEPFSFIFTWFAAVPLIVWIALSLTNAIVKDFVILKGPCPNCGTENTSFFGTILSISNGG 290

Query: 181 TTNTINCSNCGTTMVYDSNTRLITLPEGSEA 211
           +TNT+ CSNCGT M YDS TRLITLPEGS A
Sbjct: 291 STNTVKCSNCGTAMEYDSTTRLITLPEGSNA 321




Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|255537217|ref|XP_002509675.1| conserved hypothetical protein [Ricinus communis] gi|223549574|gb|EEF51062.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|297742627|emb|CBI34776.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|145333783|ref|NP_001078431.1| PGR5-like protein 1A [Arabidopsis thaliana] gi|332659277|gb|AEE84677.1| PGR5-like protein 1A [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|145333797|ref|NP_001078432.1| PGR5-like protein 1A [Arabidopsis thaliana] gi|332659278|gb|AEE84678.1| PGR5-like protein 1A [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|225426724|ref|XP_002282120.1| PREDICTED: PGR5-like protein 1A, chloroplastic-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|18416029|ref|NP_567672.1| PGR5-like protein 1A [Arabidopsis thaliana] gi|30685973|ref|NP_849422.1| PGR5-like protein 1A [Arabidopsis thaliana] gi|30685977|ref|NP_849423.1| PGR5-like protein 1A [Arabidopsis thaliana] gi|75151862|sp|Q8H112.1|PGL1A_ARATH RecName: Full=PGR5-like protein 1A, chloroplastic; Flags: Precursor gi|24030260|gb|AAN41305.1| unknown protein [Arabidopsis thaliana] gi|332659274|gb|AEE84674.1| PGR5-like protein 1A [Arabidopsis thaliana] gi|332659275|gb|AEE84675.1| PGR5-like protein 1A [Arabidopsis thaliana] gi|332659276|gb|AEE84676.1| PGR5-like protein 1A [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|118487360|gb|ABK95508.1| unknown [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255645443|gb|ACU23217.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|297803832|ref|XP_002869800.1| hypothetical protein ARALYDRAFT_492575 [Arabidopsis lyrata subsp. lyrata] gi|297315636|gb|EFH46059.1| hypothetical protein ARALYDRAFT_492575 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query211
TAIR|locus:2127233324 PGR5-LIKE A "AT4G22890" [Arabi 1.0 0.651 0.838 4.2e-95
TAIR|locus:2118031313 PGRL1B "AT4G11960" [Arabidopsi 1.0 0.674 0.838 2.7e-93
TAIR|locus:2148338301 AT5G59400 "AT5G59400" [Arabido 0.355 0.249 0.392 2.8e-10
TAIR|locus:2127233 PGR5-LIKE A "AT4G22890" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 946 (338.1 bits), Expect = 4.2e-95, P = 4.2e-95
 Identities = 177/211 (83%), Positives = 199/211 (94%)

Query:     1 MSNEEFDNLKEELMWEGSSVVMLSSAEQKFLEASMAYVAGKPIMSDEEYDKLKQKLKMEG 60
             MSNEEFDNLKEELMWEGSSVVMLSS EQ+FLEASMAYV+G PI++DEEYDKLK KLK++G
Sbjct:   114 MSNEEFDNLKEELMWEGSSVVMLSSDEQRFLEASMAYVSGNPILNDEEYDKLKLKLKIDG 173

Query:    61 SEIVVEGPRCSLRSRKVYSDLSVDYLKMLLLNVPATVVALGLFFFLDDITGFEITYLLEL 120
             S+IV EGPRCSLRS+KVYSDL+VDY KMLLLNVPATVVALGLFFFLDDITGFEITY++EL
Sbjct:   174 SDIVSEGPRCSLRSKKVYSDLAVDYFKMLLLNVPATVVALGLFFFLDDITGFEITYIMEL 233

Query:   121 PEPFSFIFTWFAAVPLIVYLSQSLTKLIVRESLILKGPCPNCGTENVSFFGTILSISSGG 180
             PEP+SFIFTWFAAVP+IVYL+ S+TKLI+++ LILKGPCPNCGTEN SFFGTILSISSGG
Sbjct:   234 PEPYSFIFTWFAAVPVIVYLALSITKLIIKDFLILKGPCPNCGTENTSFFGTILSISSGG 293

Query:   181 TTNTINCSNCGTTMVYDSNTRLITLPEGSEA 211
              TNT+ C+NCGT MVYDS +RLITLPEGS+A
Sbjct:   294 KTNTVKCTNCGTAMVYDSGSRLITLPEGSQA 324




GO:0003674 "molecular_function" evidence=ND
GO:0009507 "chloroplast" evidence=ISM;IDA
GO:0009535 "chloroplast thylakoid membrane" evidence=IDA
GO:0009579 "thylakoid" evidence=IDA
GO:0009773 "photosynthetic electron transport in photosystem I" evidence=IGI;RCA
GO:0015979 "photosynthesis" evidence=IGI
GO:0009534 "chloroplast thylakoid" evidence=IDA
GO:0000023 "maltose metabolic process" evidence=RCA
GO:0006098 "pentose-phosphate shunt" evidence=RCA
GO:0006364 "rRNA processing" evidence=RCA
GO:0009637 "response to blue light" evidence=RCA
GO:0009657 "plastid organization" evidence=RCA
GO:0009902 "chloroplast relocation" evidence=RCA
GO:0010027 "thylakoid membrane organization" evidence=RCA
GO:0010114 "response to red light" evidence=RCA
GO:0010207 "photosystem II assembly" evidence=RCA
GO:0010218 "response to far red light" evidence=RCA
GO:0010304 "PSII associated light-harvesting complex II catabolic process" evidence=RCA
GO:0019252 "starch biosynthetic process" evidence=RCA
GO:0019684 "photosynthesis, light reaction" evidence=RCA
GO:0034660 "ncRNA metabolic process" evidence=RCA
GO:0035304 "regulation of protein dephosphorylation" evidence=RCA
GO:0042742 "defense response to bacterium" evidence=RCA
GO:0043085 "positive regulation of catalytic activity" evidence=RCA
TAIR|locus:2118031 PGRL1B "AT4G11960" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2148338 AT5G59400 "AT5G59400" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8H112PGL1A_ARATHNo assigned EC number0.83881.00.6512yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query211
pfam08996 187 pfam08996, zf-DNA_Pol, DNA Polymerase alpha zinc f 0.004
>gnl|CDD|220087 pfam08996, zf-DNA_Pol, DNA Polymerase alpha zinc finger Back     alignment and domain information
 Score = 36.5 bits (85), Expect = 0.004
 Identities = 15/41 (36%), Positives = 20/41 (48%), Gaps = 3/41 (7%)

Query: 155 LKGPCPNCGTENVSFFGTILSISSGGTT-NTINCSNCGTTM 194
           LK  CP+CGTE    F  I + S    T + + CS C   +
Sbjct: 17  LKLKCPSCGTEFP--FEGIFASSGERVTPSGLQCSKCNALI 55


The DNA Polymerase alpha zinc finger domain adopts an alpha-helix-like structure, followed by three turns, all of which involve proline. The resulting motif is a helix-turn-helix motif, in contrast to other zinc finger domains, which show anti-parallel sheet and helix conformation. Zinc binding occurs due to the presence of four cysteine residues positioned to bind the metal centre in a tetrahedral coordination geometry. Function of this domain is uncertain: it has been proposed that the zinc finger motif may be an essential part of the DNA binding domain. Length = 187

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 211
PRK00420112 hypothetical protein; Validated 97.56
PF11023114 DUF2614: Protein of unknown function (DUF2614); In 97.04
PRK0039846 rpoP DNA-directed RNA polymerase subunit P; Provis 96.93
COG205167 RPS27A Ribosomal protein S27E [Translation, riboso 96.7
TIGR0120654 lysW lysine biosynthesis protein LysW. This very s 96.7
TIGR0209838 MJ0042_CXXC MJ0042 family finger-like domain. This 96.46
PF06044 254 DRP: Dam-replacing family; InterPro: IPR010324 Dam 96.37
PF1324023 zinc_ribbon_2: zinc-ribbon domain 96.27
PF1324826 zf-ribbon_3: zinc-ribbon domain 96.19
PRK0041559 rps27e 30S ribosomal protein S27e; Reviewed 96.1
cd00114 307 LIGANc NAD+ dependent DNA ligase adenylation domai 95.66
COG288861 Predicted Zn-ribbon RNA-binding protein with a fun 95.66
PF0166755 Ribosomal_S27e: Ribosomal protein S27; InterPro: I 95.66
PF09538108 FYDLN_acid: Protein of unknown function (FYDLN_aci 95.47
PRK08097 562 ligB NAD-dependent DNA ligase LigB; Reviewed 95.43
smart00531147 TFIIE Transcription initiation factor IIE. 95.34
PF01653 315 DNA_ligase_aden: NAD-dependent DNA ligase adenylat 95.2
PLN0020986 ribosomal protein S27; Provisional 94.78
smart0083441 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_C 94.78
PRK0971064 lar restriction alleviation and modification prote 94.76
COG1645131 Uncharacterized Zn-finger containing protein [Gene 94.66
TIGR00575 652 dnlj DNA ligase, NAD-dependent. The member of this 94.61
PTZ0008385 40S ribosomal protein S27; Provisional 94.55
PF0827143 TF_Zn_Ribbon: TFIIB zinc-binding; InterPro: IPR013 94.55
smart00532 441 LIGANc Ligase N family. 94.54
PRK07956 665 ligA NAD-dependent DNA ligase LigA; Validated 94.47
PRK05978148 hypothetical protein; Provisional 94.46
PRK02935110 hypothetical protein; Provisional 94.45
PF14353128 CpXC: CpXC protein 94.3
TIGR02300129 FYDLN_acid conserved hypothetical protein TIGR0230 94.12
PRK06266178 transcription initiation factor E subunit alpha; V 94.11
PHA0062659 hypothetical protein 94.04
PF1480334 Nudix_N_2: Nudix N-terminal; PDB: 3CNG_C. 94.04
PRK1489059 putative Zn-ribbon RNA-binding protein; Provisiona 93.95
PF1425552 Cys_rich_CPXG: Cysteine-rich CPXCG 93.83
smart0065944 RPOLCX RNA polymerase subunit CX. present in RNA p 93.78
PF0972342 Zn-ribbon_8: Zinc ribbon domain; InterPro: IPR0134 93.62
PF1057126 UPF0547: Uncharacterised protein family UPF0547; I 93.51
TIGR00373158 conserved hypothetical protein TIGR00373. This fam 93.49
PF09862113 DUF2089: Protein of unknown function (DUF2089); In 93.12
PF1371937 zinc_ribbon_5: zinc-ribbon domain 93.11
PRK14351 689 ligA NAD-dependent DNA ligase LigA; Provisional 92.77
PF1435461 Lar_restr_allev: Restriction alleviation protein L 92.63
TIGR0260552 CxxC_CxxC_SSSS putative regulatory protein, FmdB f 92.32
PF0519136 ADK_lid: Adenylate kinase, active site lid; InterP 91.57
PRK14350 669 ligA NAD-dependent DNA ligase LigA; Provisional 91.5
PF0667741 Auto_anti-p27: Sjogren's syndrome/scleroderma auto 91.16
PF05876 557 Terminase_GpA: Phage terminase large subunit (GpA) 91.11
PF1371736 zinc_ribbon_4: zinc-ribbon domain 91.05
PF0728269 OrfB_Zn_ribbon: Putative transposase DNA-binding d 90.94
smart0066152 RPOL9 RNA polymerase subunit 9. 90.88
COG5349126 Uncharacterized protein conserved in bacteria [Fun 90.49
PRK00464154 nrdR transcriptional regulator NrdR; Validated 89.83
COG3877122 Uncharacterized protein conserved in bacteria [Fun 89.67
PF03367161 zf-ZPR1: ZPR1 zinc-finger domain; InterPro: IPR004 89.57
PF0360432 DNA_RNApol_7kD: DNA directed RNA polymerase, 7 kDa 89.42
TIGR0365553 anti_R_Lar restriction alleviation protein, Lar fa 89.15
smart00709160 Zpr1 Duplicated domain in the epidermal growth fac 88.6
PF0109639 TFIIS_C: Transcription factor S-II (TFIIS); InterP 88.38
PRK0043250 30S ribosomal protein S27ae; Validated 88.35
PF1277350 DZR: Double zinc ribbon 88.2
smart0044040 ZnF_C2C2 C2C2 Zinc finger. Nucleic-acid-binding mo 87.62
PF10083158 DUF2321: Uncharacterized protein conserved in bact 87.59
PRK12495 226 hypothetical protein; Provisional 87.49
PRK1489299 putative transcription elongation factor Elf1; Pro 86.91
COG0272 667 Lig NAD-dependent DNA ligase (contains BRCT domain 86.75
PF04216290 FdhE: Protein involved in formate dehydrogenase fo 85.94
PRK14714 1337 DNA polymerase II large subunit; Provisional 85.92
PF0775424 DUF1610: Domain of unknown function (DUF1610); Int 85.86
COG1096188 Predicted RNA-binding protein (consists of S1 doma 85.77
PRK03824135 hypA hydrogenase nickel incorporation protein; Pro 85.54
COG1675176 TFA1 Transcription initiation factor IIE, alpha su 84.48
PF09567 314 RE_MamI: MamI restriction endonuclease; InterPro: 84.35
smart0077837 Prim_Zn_Ribbon Zinc-binding domain of primase-heli 84.12
COG1779 201 C4-type Zn-finger protein [General function predic 83.62
PRK01103274 formamidopyrimidine/5-formyluracil/ 5-hydroxymethy 83.0
PF0985131 SHOCT: Short C-terminal domain; InterPro: IPR01864 82.99
PF0512981 Elf1: Transcription elongation factor Elf1 like; I 82.88
COG0675364 Transposase and inactivated derivatives [DNA repli 82.82
PF01155113 HypA: Hydrogenase expression/synthesis hypA family 82.57
PF0180797 zf-CHC2: CHC2 zinc finger; InterPro: IPR002694 Zin 82.23
PRK0039846 rpoP DNA-directed RNA polymerase subunit P; Provis 82.17
PRK03681114 hypA hydrogenase nickel incorporation protein; Val 82.14
TIGR00100115 hypA hydrogenase nickel insertion protein HypA. In 81.95
TIGR00244147 transcriptional regulator NrdR. Members of this al 81.85
PF15616131 TerY-C: TerY-C metal binding domain 81.68
COG3677129 Transposase and inactivated derivatives [DNA repli 80.36
>PRK00420 hypothetical protein; Validated Back     alignment and domain information
Probab=97.56  E-value=7.7e-05  Score=59.69  Aligned_cols=48  Identities=19%  Similarity=0.492  Sum_probs=38.9

Q ss_pred             HHHHHHhhhccceeeecCCCCCcccceeeccccccccCCCCcCceeCCCCCceeEEecC
Q 028248          141 SQSLTKLIVRESLILKGPCPNCGTENVSFFGTILSISSGGTTNTINCSNCGTTMVYDSN  199 (211)
Q Consensus       141 a~~lt~~~~~d~liLkG~CPnCg~Ev~aFfg~i~~v~s~~~~~~~kC~~C~~~L~f~~~  199 (211)
                      ++.+.++.++-...|...||.||.+.|.+           ...+..||+||..+.....
T Consensus         8 ~k~~a~~Ll~Ga~ml~~~CP~Cg~pLf~l-----------k~g~~~Cp~Cg~~~~v~~~   55 (112)
T PRK00420          8 VKKAAELLLKGAKMLSKHCPVCGLPLFEL-----------KDGEVVCPVHGKVYIVKSD   55 (112)
T ss_pred             HHHHHHHHHhHHHHccCCCCCCCCcceec-----------CCCceECCCCCCeeeeccH
Confidence            34456667777766889999999999988           5779999999998887653



>PF11023 DUF2614: Protein of unknown function (DUF2614); InterPro: IPR020912 This entry describes proteins of unknown function, which are thought to be membrane proteins Back     alignment and domain information
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional Back     alignment and domain information
>COG2051 RPS27A Ribosomal protein S27E [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR01206 lysW lysine biosynthesis protein LysW Back     alignment and domain information
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain Back     alignment and domain information
>PF06044 DRP: Dam-replacing family; InterPro: IPR010324 Dam-replacing protein (DRP) is a restriction endonuclease that is flanked by pseudo-transposable small repeat elements Back     alignment and domain information
>PF13240 zinc_ribbon_2: zinc-ribbon domain Back     alignment and domain information
>PF13248 zf-ribbon_3: zinc-ribbon domain Back     alignment and domain information
>PRK00415 rps27e 30S ribosomal protein S27e; Reviewed Back     alignment and domain information
>cd00114 LIGANc NAD+ dependent DNA ligase adenylation domain Back     alignment and domain information
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF01667 Ribosomal_S27e: Ribosomal protein S27; InterPro: IPR000592 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PF09538 FYDLN_acid: Protein of unknown function (FYDLN_acid); InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues Back     alignment and domain information
>PRK08097 ligB NAD-dependent DNA ligase LigB; Reviewed Back     alignment and domain information
>smart00531 TFIIE Transcription initiation factor IIE Back     alignment and domain information
>PF01653 DNA_ligase_aden: NAD-dependent DNA ligase adenylation domain; InterPro: IPR013839 DNA ligase (polydeoxyribonucleotide synthase) is the enzyme that joins two DNA fragments by catalyzing the formation of an internucleotide ester bond between phosphate and deoxyribose Back     alignment and domain information
>PLN00209 ribosomal protein S27; Provisional Back     alignment and domain information
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein Back     alignment and domain information
>PRK09710 lar restriction alleviation and modification protein; Reviewed Back     alignment and domain information
>COG1645 Uncharacterized Zn-finger containing protein [General function prediction only] Back     alignment and domain information
>TIGR00575 dnlj DNA ligase, NAD-dependent Back     alignment and domain information
>PTZ00083 40S ribosomal protein S27; Provisional Back     alignment and domain information
>PF08271 TF_Zn_Ribbon: TFIIB zinc-binding; InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>smart00532 LIGANc Ligase N family Back     alignment and domain information
>PRK07956 ligA NAD-dependent DNA ligase LigA; Validated Back     alignment and domain information
>PRK05978 hypothetical protein; Provisional Back     alignment and domain information
>PRK02935 hypothetical protein; Provisional Back     alignment and domain information
>PF14353 CpXC: CpXC protein Back     alignment and domain information
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300 Back     alignment and domain information
>PRK06266 transcription initiation factor E subunit alpha; Validated Back     alignment and domain information
>PHA00626 hypothetical protein Back     alignment and domain information
>PF14803 Nudix_N_2: Nudix N-terminal; PDB: 3CNG_C Back     alignment and domain information
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional Back     alignment and domain information
>PF14255 Cys_rich_CPXG: Cysteine-rich CPXCG Back     alignment and domain information
>smart00659 RPOLCX RNA polymerase subunit CX Back     alignment and domain information
>PF09723 Zn-ribbon_8: Zinc ribbon domain; InterPro: IPR013429 This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria Back     alignment and domain information
>PF10571 UPF0547: Uncharacterised protein family UPF0547; InterPro: IPR018886 This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines Back     alignment and domain information
>TIGR00373 conserved hypothetical protein TIGR00373 Back     alignment and domain information
>PF09862 DUF2089: Protein of unknown function (DUF2089); InterPro: IPR018658 This family consists of various hypothetical prokaryotic proteins Back     alignment and domain information
>PF13719 zinc_ribbon_5: zinc-ribbon domain Back     alignment and domain information
>PRK14351 ligA NAD-dependent DNA ligase LigA; Provisional Back     alignment and domain information
>PF14354 Lar_restr_allev: Restriction alleviation protein Lar Back     alignment and domain information
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family Back     alignment and domain information
>PF05191 ADK_lid: Adenylate kinase, active site lid; InterPro: IPR007862 Adenylate kinases (ADK; 2 Back     alignment and domain information
>PRK14350 ligA NAD-dependent DNA ligase LigA; Provisional Back     alignment and domain information
>PF06677 Auto_anti-p27: Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27); InterPro: IPR009563 The proteins in this entry are functionally uncharacterised and include several proteins that characterise Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27) Back     alignment and domain information
>PF05876 Terminase_GpA: Phage terminase large subunit (GpA); InterPro: IPR008866 This entry is represented by Bacteriophage lambda, GpA Back     alignment and domain information
>PF13717 zinc_ribbon_4: zinc-ribbon domain Back     alignment and domain information
>PF07282 OrfB_Zn_ribbon: Putative transposase DNA-binding domain; InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins Back     alignment and domain information
>smart00661 RPOL9 RNA polymerase subunit 9 Back     alignment and domain information
>COG5349 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK00464 nrdR transcriptional regulator NrdR; Validated Back     alignment and domain information
>COG3877 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF03367 zf-ZPR1: ZPR1 zinc-finger domain; InterPro: IPR004457 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF03604 DNA_RNApol_7kD: DNA directed RNA polymerase, 7 kDa subunit; InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates Back     alignment and domain information
>TIGR03655 anti_R_Lar restriction alleviation protein, Lar family Back     alignment and domain information
>smart00709 Zpr1 Duplicated domain in the epidermal growth factor- and elongation factor-1alpha-binding protein Zpr1 Back     alignment and domain information
>PF01096 TFIIS_C: Transcription factor S-II (TFIIS); InterPro: IPR001222 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PRK00432 30S ribosomal protein S27ae; Validated Back     alignment and domain information
>PF12773 DZR: Double zinc ribbon Back     alignment and domain information
>smart00440 ZnF_C2C2 C2C2 Zinc finger Back     alignment and domain information
>PF10083 DUF2321: Uncharacterized protein conserved in bacteria (DUF2321); InterPro: IPR016891 This entry is represented by Bacteriophage 'Lactobacillus prophage Lj928', Orf-Ljo1454 Back     alignment and domain information
>PRK12495 hypothetical protein; Provisional Back     alignment and domain information
>PRK14892 putative transcription elongation factor Elf1; Provisional Back     alignment and domain information
>COG0272 Lig NAD-dependent DNA ligase (contains BRCT domain type II) [DNA replication, recombination, and repair] Back     alignment and domain information
>PF04216 FdhE: Protein involved in formate dehydrogenase formation; InterPro: IPR006452 This family of sequences describe an accessory protein required for the assembly of formate dehydrogenase of certain proteobacteria although not present in the final complex [] Back     alignment and domain information
>PRK14714 DNA polymerase II large subunit; Provisional Back     alignment and domain information
>PF07754 DUF1610: Domain of unknown function (DUF1610); InterPro: IPR011668 This domain is found in archaeal species Back     alignment and domain information
>COG1096 Predicted RNA-binding protein (consists of S1 domain and a Zn-ribbon domain) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional Back     alignment and domain information
>COG1675 TFA1 Transcription initiation factor IIE, alpha subunit [Transcription] Back     alignment and domain information
>PF09567 RE_MamI: MamI restriction endonuclease; InterPro: IPR019067 There are four classes of restriction endonucleases: types I, II,III and IV Back     alignment and domain information
>smart00778 Prim_Zn_Ribbon Zinc-binding domain of primase-helicase Back     alignment and domain information
>COG1779 C4-type Zn-finger protein [General function prediction only] Back     alignment and domain information
>PRK01103 formamidopyrimidine/5-formyluracil/ 5-hydroxymethyluracil DNA glycosylase; Validated Back     alignment and domain information
>PF09851 SHOCT: Short C-terminal domain; InterPro: IPR018649 This family of hypothetical prokaryotic proteins has no known function Back     alignment and domain information
>PF05129 Elf1: Transcription elongation factor Elf1 like; InterPro: IPR007808 This family of uncharacterised, mostly short, proteins contain a putative zinc binding domain with four conserved cysteines Back     alignment and domain information
>COG0675 Transposase and inactivated derivatives [DNA replication, recombination, and repair] Back     alignment and domain information
>PF01155 HypA: Hydrogenase expression/synthesis hypA family; InterPro: IPR000688 Bacterial membrane-bound nickel-dependent hydrogenases requires a number of accessory proteins which are involved in their maturation Back     alignment and domain information
>PF01807 zf-CHC2: CHC2 zinc finger; InterPro: IPR002694 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional Back     alignment and domain information
>PRK03681 hypA hydrogenase nickel incorporation protein; Validated Back     alignment and domain information
>TIGR00100 hypA hydrogenase nickel insertion protein HypA Back     alignment and domain information
>TIGR00244 transcriptional regulator NrdR Back     alignment and domain information
>PF15616 TerY-C: TerY-C metal binding domain Back     alignment and domain information
>COG3677 Transposase and inactivated derivatives [DNA replication, recombination, and repair] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query211
3k1f_M 197 Transcription initiation factor IIB; RNA polymeras 1e-04
>3k1f_M Transcription initiation factor IIB; RNA polymerase II, TFIIB, transcription factor, DNA-binding, DNA-directed RNA polymerase; 4.30A {Saccharomyces cerevisiae} Length = 197 Back     alignment and structure
 Score = 40.4 bits (94), Expect = 1e-04
 Identities = 11/52 (21%), Positives = 19/52 (36%), Gaps = 13/52 (25%)

Query: 159 CPNCGTENVSFFGTILSISSGGTTNTINCSNCGTTMVYDSNTRLITLPEGSE 210
           CP C          +   S G   + + C+ CG  +    + +L+     SE
Sbjct: 24  CPECKVYPPKI---VERFSEG---DVV-CALCGLVL----SDKLVD--TRSE 62


Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query211
4esj_A 257 Type-2 restriction enzyme DPNI; restriction endonu 96.75
1qxf_A66 GR2, 30S ribosomal protein S27E; structural genomi 95.78
1b04_A 318 Protein (DNA ligase); DNA replication; 2.80A {Geob 95.77
3j20_W63 30S ribosomal protein S27E; archaea, archaeal, KIN 95.49
2xzm_681 RPS27E; ribosome, translation; 3.93A {Tetrahymena 94.55
3jsl_A 318 DNA ligase; NAD+-dependent, DNA damage, DNA repair 94.52
3uq8_A 322 DNA ligase; adenylated protein, ATP-grAsp, rossman 94.46
4glw_A 305 DNA ligase; inhibitor, ligase-ligase inhibitor com 94.41
3u5c_b82 RP61, YS20, 40S ribosomal protein S27-A; translati 94.27
2owo_A 671 DNA ligase; protein-DNA complex, ligase-DNA comple 94.01
1ta8_A 332 DNA ligase, NAD-dependent; nucleotidyl transferase 93.94
1zau_A 328 DNA ligase; AMP; HET: DNA AMP; 3.15A {Mycobacteriu 93.94
1nui_A 255 DNA primase/helicase; zinc-biding domain, toprim f 93.21
4glx_A 586 DNA ligase; inhibitor, ligase-ligase inhibitor-DNA 93.12
1dgs_A 667 DNA ligase; AMP complex, NAD+-dependent; HET: DNA 92.96
3iz6_X86 40S ribosomal protein S27 (S27E); eukaryotic ribos 92.26
1pft_A50 TFIIB, PFTFIIBN; N-terminal domain, transcription 91.72
1qyp_A57 RNA polymerase II; transcription, RPB9, Zn ribbon, 90.8
3j20_Y50 30S ribosomal protein S27AE; archaea, archaeal, KI 90.51
1twf_L70 ABC10-alpha, DNA-directed RNA polymerases I, II, a 89.62
1dl6_A58 Transcription factor II B (TFIIB); zinc ribbon, ge 89.58
3flo_B 206 DNA polymerase alpha catalytic subunit A; protein- 88.74
1lko_A191 Rubrerythrin all-iron(II) form; reduced form, DIIR 87.94
3sgi_A 615 DNA ligase; HET: DNA AMP; 3.50A {Mycobacterium tub 86.94
1vq8_Z83 50S ribosomal protein L37AE; ribosome 50S, protein 85.9
1x3z_A 335 Peptide: N-glycanase; hydrolase-hydrolase inhibito 85.75
1gh9_A71 8.3 kDa protein (gene MTH1184); beta+alpha complex 84.01
3v2d_560 50S ribosomal protein L32; ribosome associated inh 83.44
2kdx_A119 HYPA, hydrogenase/urease nickel incorporation prot 83.3
3pwf_A170 Rubrerythrin; non heme iron peroxidases, oxidative 83.24
3h0g_L63 DNA-directed RNA polymerases I, II, and III subuni 82.87
2lcq_A165 Putative toxin VAPC6; PIN domain, Zn ribbon domain 82.77
3m7n_A179 Putative uncharacterized protein AF_0206; exosome, 81.36
2qkd_A 404 Zinc finger protein ZPR1; helical hairpins, beta h 80.55
1wii_A85 Hypothetical UPF0222 protein MGC4549; domain of un 80.31
>4esj_A Type-2 restriction enzyme DPNI; restriction endonuclease-DNA complex, type IIM, type IIE, RE enzyme, DPNI; HET: DNA 6MA; 2.05A {Streptococcus pneumoniae} Back     alignment and structure
Probab=96.75  E-value=0.0011  Score=58.42  Aligned_cols=50  Identities=24%  Similarity=0.468  Sum_probs=37.1

Q ss_pred             HHHHHHHhhhccceeeecCCCCCccc-ceeeccccccccCCCCcCceeCCCCCceeEEecCc
Q 028248          140 LSQSLTKLIVRESLILKGPCPNCGTE-NVSFFGTILSISSGGTTNTINCSNCGTTMVYDSNT  200 (211)
Q Consensus       140 ~a~~lt~~~~~d~liLkG~CPnCg~E-v~aFfg~i~~v~s~~~~~~~kC~~C~~~L~f~~~~  200 (211)
                      .|..||.-|+..+.    -|||||.. ...|       ++|+.....-|++|.+..+..++.
T Consensus        22 ~aRVLTE~Wv~~n~----yCPnCG~~~l~~f-------~nN~PVaDF~C~~C~EeyELKSk~   72 (257)
T 4esj_A           22 KARILTEDWVYRQS----YCPNCGNNPLNHF-------ENNRPVADFYCNHCSEEFELKSKK   72 (257)
T ss_dssp             HHHHHHHHHHHHHC----CCTTTCCSSCEEC-----------CCCEEECTTTCCEEEEEEEE
T ss_pred             eehhhhHHHHHHCC----cCCCCCChhhhhc-------cCCCcccccccCCcchhheecccc
Confidence            46677887777665    89999996 4466       667777889999999999998863



>1qxf_A GR2, 30S ribosomal protein S27E; structural genomics, beta sheet, PSI, protein structure initiative; NMR {Archaeoglobus fulgidus} SCOP: g.41.8.4 Back     alignment and structure
>1b04_A Protein (DNA ligase); DNA replication; 2.80A {Geobacillus stearothermophilus} SCOP: d.142.2.2 Back     alignment and structure
>3j20_W 30S ribosomal protein S27E; archaea, archaeal, KINK-turn, protein synthe ribosome; 6.60A {Pyrococcus furiosus} Back     alignment and structure
>2xzm_6 RPS27E; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_6 Back     alignment and structure
>3jsl_A DNA ligase; NAD+-dependent, DNA damage, DNA repair, DNA replication, magnesium, manganese, metal-binding, NAD, zinc; HET: DNA; 1.80A {Staphylococcus aureus} SCOP: d.142.2.2 PDB: 3jsn_A* Back     alignment and structure
>3uq8_A DNA ligase; adenylated protein, ATP-grAsp, rossman fold, adenylation; HET: DNA NAD AMP; 1.70A {Haemophilus influenzae} PDB: 3pn1_A* 3bac_A* Back     alignment and structure
>4glw_A DNA ligase; inhibitor, ligase-ligase inhibitor complex; HET: DNA 0XT NMN; 2.00A {Streptococcus pneumoniae} Back     alignment and structure
>3u5c_b RP61, YS20, 40S ribosomal protein S27-A; translation, ribosome, ribosomal, ribosomal R ribosomal protein, eukaryotic ribosome, RNA-protein C; 3.00A {Saccharomyces cerevisiae} PDB: 3izb_X 3u5g_b Back     alignment and structure
>2owo_A DNA ligase; protein-DNA complex, ligase-DNA complex; HET: DNA OMC AMP; 2.30A {Escherichia coli} Back     alignment and structure
>1ta8_A DNA ligase, NAD-dependent; nucleotidyl transferase fold; HET: DNA NMN; 1.80A {Enterococcus faecalis} SCOP: d.142.2.2 PDB: 3ba8_A* 1tae_A* 3ba9_A* 3baa_A* 3bab_A* Back     alignment and structure
>1zau_A DNA ligase; AMP; HET: DNA AMP; 3.15A {Mycobacterium tuberculosis} Back     alignment and structure
>1nui_A DNA primase/helicase; zinc-biding domain, toprim fold, DNA replication, DNA-direct polymerase, primosome, late protein, ATP-binding; HET: DNA; 2.90A {Enterobacteria phage T7} SCOP: e.13.1.2 g.41.3.2 Back     alignment and structure
>4glx_A DNA ligase; inhibitor, ligase-ligase inhibitor-DNA complex; HET: DNA 0XS; 1.90A {Escherichia coli} Back     alignment and structure
>1dgs_A DNA ligase; AMP complex, NAD+-dependent; HET: DNA AMP; 2.90A {Thermus filiformis} SCOP: a.60.2.2 b.40.4.6 d.142.2.2 PDB: 1v9p_A* Back     alignment and structure
>3iz6_X 40S ribosomal protein S27 (S27E); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>1pft_A TFIIB, PFTFIIBN; N-terminal domain, transcription initiation factor; NMR {Pyrococcus furiosus} SCOP: g.41.3.1 Back     alignment and structure
>1qyp_A RNA polymerase II; transcription, RPB9, Zn ribbon, hyperthermophilic, extremophIle; NMR {Thermococcus celer} SCOP: g.41.3.1 Back     alignment and structure
>3j20_Y 30S ribosomal protein S27AE; archaea, archaeal, KINK-turn, protein synthe ribosome; 6.60A {Pyrococcus furiosus} Back     alignment and structure
>1twf_L ABC10-alpha, DNA-directed RNA polymerases I, II, and III 7.7 K polypeptide; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: g.41.9.2 PDB: 1i3q_L 1i6h_L 1k83_L* 1nik_L 1nt9_L 1pqv_L 1r5u_L 1r9s_L* 1r9t_L* 1sfo_L* 1twa_L* 1twc_L* 1i50_L* 1twg_L* 1twh_L* 1wcm_L 1y1v_L 1y1w_L 1y1y_L 1y77_L* ... Back     alignment and structure
>1dl6_A Transcription factor II B (TFIIB); zinc ribbon, gene regulation; NMR {Homo sapiens} SCOP: g.41.3.1 PDB: 1rly_A 1ro4_A Back     alignment and structure
>3flo_B DNA polymerase alpha catalytic subunit A; protein-protein complex, phosphoesterase fold, OB fold, zinc motif, DNA replication, nucleus; HET: DNA; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1lko_A Rubrerythrin all-iron(II) form; reduced form, DIIRON, four-helix bundle, rubre like, electron transport; 1.63A {Desulfovibrio vulgaris} SCOP: a.25.1.1 g.41.5.1 PDB: 1dvb_A 1jyb_A 1b71_A 1lkm_A 1lkp_A 1qyb_A 1s2z_A 1s30_A 1ryt_A Back     alignment and structure
>3sgi_A DNA ligase; HET: DNA AMP; 3.50A {Mycobacterium tuberculosis} Back     alignment and structure
>1vq8_Z 50S ribosomal protein L37AE; ribosome 50S, protein-protein complex, RNA-RNA complex, PROT complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} SCOP: g.41.8.1 PDB: 1vq4_Z* 1vq6_Z* 1vq5_Z* 1vq7_Z* 1vq9_Z* 1vqk_Z* 1vql_Z* 1vqm_Z* 1vqn_Z* 1vqo_Z* 1vqp_Z* 1yhq_Z* 1yi2_Z* 1yij_Z* 1yit_Z* 1yj9_Z* 1yjn_Z* 1yjw_Z* 2qa4_Z* 1s72_Z* ... Back     alignment and structure
>1x3z_A Peptide: N-glycanase; hydrolase-hydrolase inhibitor complex; HET: SUC; 2.80A {Saccharomyces cerevisiae} SCOP: d.3.1.4 PDB: 1x3w_A* 3esw_A* Back     alignment and structure
>1gh9_A 8.3 kDa protein (gene MTH1184); beta+alpha complex structure, structural genomics, PSI, protein structure initiative; NMR {Methanothermobacterthermautotrophicus} SCOP: g.41.6.1 Back     alignment and structure
>3v2d_5 50S ribosomal protein L32; ribosome associated inhibitor A, RAIA, protein Y, stress RES stationary phase, ribosome hibernation, ribosome; 2.70A {Thermus thermophilus} PDB: 2hgq_4 2hgj_4 2hgu_4 2j03_5 2jl6_5 2jl8_5 2v47_5 2v49_5 2wdi_5 2wdj_5 2wdl_5 2wdn_5 2wh2_5 2wh4_5 2wrj_5 2wrl_5 2wro_5 2wrr_5 2x9s_5 2x9u_5 ... Back     alignment and structure
>2kdx_A HYPA, hydrogenase/urease nickel incorporation protein HYPA; metallochaperone, metal-binding, metal- binding protein; NMR {Helicobacter pylori} Back     alignment and structure
>3pwf_A Rubrerythrin; non heme iron peroxidases, oxidative stress, oxidoreductase; 1.64A {Pyrococcus furiosus} PDB: 3mps_A 3pza_A 3qvd_A 1nnq_A 2hr5_A Back     alignment and structure
>3h0g_L DNA-directed RNA polymerases I, II, and III subunit rpabc4; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Back     alignment and structure
>2lcq_A Putative toxin VAPC6; PIN domain, Zn ribbon domain, ribosome biogenesis, metal BIN protein; NMR {Pyrococcus horikoshii} Back     alignment and structure
>3m7n_A Putative uncharacterized protein AF_0206; exosome, RNA, exonuclease, hydrolase, nuclease, hydrolase-RN; 2.40A {Archaeoglobus fulgidus} PDB: 2ba1_A 3m85_A Back     alignment and structure
>2qkd_A Zinc finger protein ZPR1; helical hairpins, beta helix, anti-parrallel beta sheet, double straded anti-parallel beta helix, metal binding protein; 2.00A {Mus musculus} Back     alignment and structure
>1wii_A Hypothetical UPF0222 protein MGC4549; domain of unknown function, zinc finger, metal-binding protein, structural genomics; NMR {Mus musculus} SCOP: g.41.3.4 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 211
d1b04a_ 312 d.142.2.2 (A:) Adenylation domain of NAD+-dependen 3e-05
d1ta8a_ 313 d.142.2.2 (A:) Adenylation domain of NAD+-dependen 4e-05
d1dgsa3 314 d.142.2.2 (A:1-314) Adenylation domain of NAD+-dep 6e-05
>d1b04a_ d.142.2.2 (A:) Adenylation domain of NAD+-dependent DNA ligase {Bacillus stearothermophilus [TaxId: 1422]} Length = 312 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: ATP-grasp
superfamily: DNA ligase/mRNA capping enzyme, catalytic domain
family: Adenylation domain of NAD+-dependent DNA ligase
domain: Adenylation domain of NAD+-dependent DNA ligase
species: Bacillus stearothermophilus [TaxId: 1422]
 Score = 41.5 bits (96), Expect = 3e-05
 Identities = 10/21 (47%), Positives = 14/21 (66%)

Query: 37 YVAGKPIMSDEEYDKLKQKLK 57
          YV  +P + D EYD+L Q+L 
Sbjct: 24 YVLDRPSVPDAEYDRLMQELI 44


>d1ta8a_ d.142.2.2 (A:) Adenylation domain of NAD+-dependent DNA ligase {Enterococcus faecalis [TaxId: 1351]} Length = 313 Back     information, alignment and structure
>d1dgsa3 d.142.2.2 (A:1-314) Adenylation domain of NAD+-dependent DNA ligase {Thermus filiformis [TaxId: 276]} Length = 314 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query211
d1ta8a_ 313 Adenylation domain of NAD+-dependent DNA ligase {E 96.95
d1b04a_ 312 Adenylation domain of NAD+-dependent DNA ligase {B 96.84
d1dgsa3 314 Adenylation domain of NAD+-dependent DNA ligase {T 96.59
d1qxfa_58 Ribosomal protein S27e {Archaeon Archaeoglobus ful 96.07
d1pfva335 Methionyl-tRNA synthetase (MetRS), Zn-domain {Esch 94.13
d1rqga335 Methionyl-tRNA synthetase (MetRS), Zn-domain {Pyro 94.07
d1s3ga235 Microbial and mitochondrial ADK, insert "zinc fing 90.77
d1akya238 Microbial and mitochondrial ADK, insert "zinc fing 90.16
d1dl6a_58 Transcription initiation factor TFIIB, N-terminal 90.1
d1zina235 Microbial and mitochondrial ADK, insert "zinc fing 89.98
d2ak3a237 Microbial and mitochondrial ADK, insert "zinc fing 89.07
d1pfta_50 Transcription initiation factor TFIIB, N-terminal 87.75
d1e4va235 Microbial and mitochondrial ADK, insert "zinc fing 86.64
d2j015159 Ribosomal protein L32p {Thermus thermophilus [TaxI 85.54
d2f4ma1 287 Peptide:N-glycanase 1, PNG1 {Mouse (Mus musculus) 83.97
d1d0qa_102 Zinc-binding domain of DNA primase {Bacillus stear 83.88
d1nnqa237 Rubrerythrin, C-terminal domain {Archaeon Pyrococc 83.52
d1yuza236 Nigerythrin, C-terminal domain {Desulfovibrio vulg 81.7
d2qam0156 Ribosomal protein L32p {Escherichia coli [TaxId: 5 81.06
d1k3xa340 Endonuclease VIII {Escherichia coli [TaxId: 562]} 80.79
>d1ta8a_ d.142.2.2 (A:) Adenylation domain of NAD+-dependent DNA ligase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: ATP-grasp
superfamily: DNA ligase/mRNA capping enzyme, catalytic domain
family: Adenylation domain of NAD+-dependent DNA ligase
domain: Adenylation domain of NAD+-dependent DNA ligase
species: Enterococcus faecalis [TaxId: 1351]
Probab=96.95  E-value=0.00029  Score=59.33  Aligned_cols=27  Identities=30%  Similarity=0.434  Sum_probs=22.9

Q ss_pred             HHHHhhh-cCCCccChHHHHHHHHHHhh
Q 028248           32 EASMAYV-AGKPIMSDEEYDKLKQKLKM   58 (211)
Q Consensus        32 eA~~aY~-~G~Pi~sD~efD~Lk~~Lk~   58 (211)
                      ++-.+|| .|+|+|||+|||.|+.+|+.
T Consensus        20 ~~~~~Yy~~~~p~iSD~eYD~L~~~L~~   47 (313)
T d1ta8a_          20 QYSHEYYVKDQPSVEDYVYDRLYKELVD   47 (313)
T ss_dssp             HHHHHHHTSSCCSSCHHHHHHHHHHHHH
T ss_pred             HHHHHHhcCCCCCCCHHHHHHHHHHHHH
Confidence            3446788 59999999999999999975



>d1b04a_ d.142.2.2 (A:) Adenylation domain of NAD+-dependent DNA ligase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1dgsa3 d.142.2.2 (A:1-314) Adenylation domain of NAD+-dependent DNA ligase {Thermus filiformis [TaxId: 276]} Back     information, alignment and structure
>d1qxfa_ g.41.8.4 (A:) Ribosomal protein S27e {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1pfva3 g.41.1.1 (A:141-175) Methionyl-tRNA synthetase (MetRS), Zn-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rqga3 g.41.1.1 (A:139-173) Methionyl-tRNA synthetase (MetRS), Zn-domain {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1s3ga2 g.41.2.1 (A:126-160) Microbial and mitochondrial ADK, insert "zinc finger" domain {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1akya2 g.41.2.1 (A:131-168) Microbial and mitochondrial ADK, insert "zinc finger" domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1dl6a_ g.41.3.1 (A:) Transcription initiation factor TFIIB, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zina2 g.41.2.1 (A:126-160) Microbial and mitochondrial ADK, insert "zinc finger" domain {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2ak3a2 g.41.2.1 (A:125-161) Microbial and mitochondrial ADK, insert "zinc finger" domain {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1pfta_ g.41.3.1 (A:) Transcription initiation factor TFIIB, N-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1e4va2 g.41.2.1 (A:122-156) Microbial and mitochondrial ADK, insert "zinc finger" domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2j0151 g.41.8.5 (5:2-60) Ribosomal protein L32p {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2f4ma1 d.3.1.4 (A:164-450) Peptide:N-glycanase 1, PNG1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1d0qa_ g.41.3.2 (A:) Zinc-binding domain of DNA primase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1nnqa2 g.41.5.1 (A:135-171) Rubrerythrin, C-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1yuza2 g.41.5.1 (A:167-202) Nigerythrin, C-terminal domain {Desulfovibrio vulgaris [TaxId: 881]} Back     information, alignment and structure
>d2qam01 g.41.8.5 (0:1-56) Ribosomal protein L32p {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1k3xa3 g.39.1.8 (A:223-262) Endonuclease VIII {Escherichia coli [TaxId: 562]} Back     information, alignment and structure