Citrus Sinensis ID: 028312

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210
MIAFISHTKNKPKKRKRKRKRKRLLSRCACGFAVLSVFSVSLQIIVTGFPMAKDTGVAEHGSYSAKDYTDPPPEPLFDAVELTKWSFYRALIAEFIATLLFLYVTVLTVIGYKSQTDPAKNVDGCAGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMWGQRAGRWVQHRRWIGRRDHRHLCLGLHCLLGH
cEEEEcccccccHHHHHHHHHHHHHccccccccccEEEEcccccccccccccccccccccccccccccccccccccccHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccc
cEEEEEccccccHHHHHHHHHHHHHHHHccccEEEEEEEEEEEEccccccccccccccccccccccccccccccccccHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHcccccHHHHccEEEEccc
miafishtknkpkkrkrKRKRKRLLSRCACGFAVLSVFSVSLQIIVtgfpmakdtgvaehgsysakdytdpppeplfdaveLTKWSFYRALIAEFIATLLFLYVTVLTVIGyksqtdpaknvdgcagVGILGIAWAFGGMIFVLVYCTagisgghinpaVTFGLFLARKVSLVRAVMWGQRagrwvqhrrwigrrdhrhlclglhcllgh
miafishtknkpkkrkrkrkrkrllsrcacgfaVLSVFSVSLQIIVTGFPMAKDTGVAEHGSYSAKDYTDPPPEPLFDAVELTKWSFYRALIAEFIATLLFLYVTVLTVIGYKsqtdpaknvDGCAGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMWGQRAGRWVQHRRWIGRRDHRHLCLGLHCLLGH
MIAFISHTknkpkkrkrkrkrkrLLSRCACGFAVLSVFSVSLQIIVTGFPMAKDTGVAEHGSYSAKDYTDPPPEPLFDAVELTKWSFYRALIAEFIAtllflyvtvltvIGYKSQTDPAKNVDGCAGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMWGQRAGRWVQHRRWIgrrdhrhlclglhcllgh
***********************LLSRCACGFAVLSVFSVSLQIIVTGFPMAKDTGVA****************PLFDAVELTKWSFYRALIAEFIATLLFLYVTVLTVIGYKSQTDPAKNVDGCAGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMWGQRAGRWVQHRRWIGRRDHRHLCLGLHCLL**
***************************CACGFAVLSVFSVSLQ*******************************PLFDAVELTKWSFYRALIAEFIATLLFLYVTVLTVIGYKSQTDPAKNVDGCAGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMWGQRAGRWVQHRRWIGRRDHRHLCLGL******
************************LSRCACGFAVLSVFSVSLQIIVTGFPMAKDTGVAEHGSYSAKDYTDPPPEPLFDAVELTKWSFYRALIAEFIATLLFLYVTVLTVIGYKSQTDPAKNVDGCAGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMWGQRAGRWVQHRRWIGRRDHRHLCLGLHCLLGH
MIAFISHTKNKPKKRKRKRKRKRLLSRCACGFAVLSVFSVSLQIIVTGF****************KDYTDPPPEPLFDAVELTKWSFYRALIAEFIATLLFLYVTVLTVIGYKSQTDPAKNVDGCAGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMWGQRAGRWVQHRRWIGRRDHRHLCLGLHCLLGH
iiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIAFISHTKNKPKKRKRKRKRKRLLSRCACGFAVLSVFSVSLQIIVTGFPMAKDTGVAEHGSYSAKDYTDPPPEPLFDAVELTKWSFYRALIAEFIATLLFLYVTVLTVIGYKSQTDPAKNVDGCAGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMWGQRAGRWVQHRRWIGRRDHRHLCLGLHCLLGH
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query210 2.2.26 [Sep-21-2011]
Q9SV31 286 Probable aquaporin PIP2-5 yes no 0.604 0.444 0.812 3e-55
Q6K215 288 Probable aquaporin PIP2-2 yes no 0.609 0.444 0.757 4e-51
Q9ATM6 288 Aquaporin PIP2-4 OS=Zea m N/A no 0.609 0.444 0.772 1e-50
Q9ATM7 289 Aquaporin PIP2-3 OS=Zea m N/A no 0.571 0.415 0.803 2e-50
Q7XUA6 290 Probable aquaporin PIP2-3 no no 0.552 0.4 0.796 4e-50
Q9ATM4 287 Aquaporin PIP2-7 OS=Zea m N/A no 0.604 0.442 0.763 2e-49
Q9FF53 291 Probable aquaporin PIP2-4 no no 0.609 0.439 0.742 4e-49
P30302 285 Aquaporin PIP2-3 OS=Arabi no no 0.6 0.442 0.75 7e-49
P43287 285 Aquaporin PIP2-2 OS=Arabi no no 0.6 0.442 0.742 1e-48
Q9XF58 285 Aquaporin PIP2-5 OS=Zea m N/A no 0.6 0.442 0.730 3e-48
>sp|Q9SV31|PIP25_ARATH Probable aquaporin PIP2-5 OS=Arabidopsis thaliana GN=PIP2-5 PE=1 SV=1 Back     alignment and function desciption
 Score =  214 bits (545), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 104/128 (81%), Positives = 113/128 (88%), Gaps = 1/128 (0%)

Query: 51  MAKDTGVAEHGSYSAKDYTDPPPEPLFDAVELTKWSFYRALIAEFIATLLFLYVTVLTVI 110
           M K+  V +  S+S KDY DPPPEPLFDA EL KWSFYRALIAEFIATLLFLYVT++TVI
Sbjct: 1   MTKEV-VGDKRSFSGKDYQDPPPEPLFDATELGKWSFYRALIAEFIATLLFLYVTIMTVI 59

Query: 111 GYKSQTDPAKNVDGCAGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV 170
           GYKSQTDPA N D C GVG+LGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGL LARKV
Sbjct: 60  GYKSQTDPALNPDQCTGVGVLGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLLLARKV 119

Query: 171 SLVRAVMW 178
           +LVRAVM+
Sbjct: 120 TLVRAVMY 127
Aquaporins facilitate the transport of water and small neutral solutes across cell membranes.
Arabidopsis thaliana (taxid: 3702)
>sp|Q6K215|PIP22_ORYSJ Probable aquaporin PIP2-2 OS=Oryza sativa subsp. japonica GN=PIP2-2 PE=2 SV=1 Back     alignment and function description
>sp|Q9ATM6|PIP24_MAIZE Aquaporin PIP2-4 OS=Zea mays GN=PIP2-4 PE=1 SV=1 Back     alignment and function description
>sp|Q9ATM7|PIP23_MAIZE Aquaporin PIP2-3 OS=Zea mays GN=PIP2-3 PE=2 SV=1 Back     alignment and function description
>sp|Q7XUA6|PIP23_ORYSJ Probable aquaporin PIP2-3 OS=Oryza sativa subsp. japonica GN=PIP2-3 PE=2 SV=1 Back     alignment and function description
>sp|Q9ATM4|PIP27_MAIZE Aquaporin PIP2-7 OS=Zea mays GN=PIP2-7 PE=2 SV=1 Back     alignment and function description
>sp|Q9FF53|PIP24_ARATH Probable aquaporin PIP2-4 OS=Arabidopsis thaliana GN=PIP2-4 PE=1 SV=1 Back     alignment and function description
>sp|P30302|PIP23_ARATH Aquaporin PIP2-3 OS=Arabidopsis thaliana GN=PIP2-3 PE=1 SV=1 Back     alignment and function description
>sp|P43287|PIP22_ARATH Aquaporin PIP2-2 OS=Arabidopsis thaliana GN=PIP2-2 PE=1 SV=2 Back     alignment and function description
>sp|Q9XF58|PIP25_MAIZE Aquaporin PIP2-5 OS=Zea mays GN=PIP2-5 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query210
444300798285 aquaporin protein 5 [Camellia sinensis] 0.609 0.449 0.882 7e-60
373501939287 plasma membrane intrinsic protein [Malus 0.609 0.445 0.882 2e-59
13486942287 plasma membrane intrinsic protein 2-2 [P 0.609 0.445 0.882 5e-59
444300796287 aquaporin protein 4 [Camellia sinensis] 0.609 0.445 0.867 1e-58
383479030285 aquaporin PIP2;2 [Quercus petraea] 0.609 0.449 0.859 2e-57
300119934285 aquaporin [Fragaria x ananassa] 0.609 0.449 0.851 3e-56
383479032286 aquaporin PIP2;3 [Quercus petraea] 0.6 0.440 0.859 5e-56
224097915285 aquaporin, MIP family, PIP subfamily [Po 0.6 0.442 0.859 8e-56
255557012288 Aquaporin PIP2.2, putative [Ricinus comm 0.609 0.444 0.837 9e-56
224113031285 aquaporin, MIP family, PIP subfamily [Po 0.6 0.442 0.859 2e-55
>gi|444300798|gb|AGD98708.1| aquaporin protein 5 [Camellia sinensis] Back     alignment and taxonomy information
 Score =  235 bits (600), Expect = 7e-60,   Method: Compositional matrix adjust.
 Identities = 113/128 (88%), Positives = 117/128 (91%)

Query: 51  MAKDTGVAEHGSYSAKDYTDPPPEPLFDAVELTKWSFYRALIAEFIATLLFLYVTVLTVI 110
           MAKD GVAE GSYSAKDY DPPP PL DA ELTKWSFYRALIAEFIATLLFLY+T+LTVI
Sbjct: 1   MAKDMGVAEQGSYSAKDYQDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYITILTVI 60

Query: 111 GYKSQTDPAKNVDGCAGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV 170
           GYKSQ DP KN D C GVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV
Sbjct: 61  GYKSQVDPVKNADQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV 120

Query: 171 SLVRAVMW 178
           SL+RAVM+
Sbjct: 121 SLIRAVMY 128

Source: Camellia sinensis

Species: Camellia sinensis

Genus: Camellia

Family: Theaceae

Order: Ericales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|373501939|gb|AEY75242.1| plasma membrane intrinsic protein [Malus hupehensis] Back     alignment and taxonomy information
>gi|13486942|dbj|BAB40143.1| plasma membrane intrinsic protein 2-2 [Pyrus communis] Back     alignment and taxonomy information
>gi|444300796|gb|AGD98707.1| aquaporin protein 4 [Camellia sinensis] Back     alignment and taxonomy information
>gi|383479030|gb|AFH36337.1| aquaporin PIP2;2 [Quercus petraea] Back     alignment and taxonomy information
>gi|300119934|gb|ADJ67992.1| aquaporin [Fragaria x ananassa] Back     alignment and taxonomy information
>gi|383479032|gb|AFH36338.1| aquaporin PIP2;3 [Quercus petraea] Back     alignment and taxonomy information
>gi|224097915|ref|XP_002311092.1| aquaporin, MIP family, PIP subfamily [Populus trichocarpa] gi|118487660|gb|ABK95655.1| unknown [Populus trichocarpa] gi|222850912|gb|EEE88459.1| aquaporin, MIP family, PIP subfamily [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255557012|ref|XP_002519539.1| Aquaporin PIP2.2, putative [Ricinus communis] gi|223541402|gb|EEF42953.1| Aquaporin PIP2.2, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224113031|ref|XP_002316367.1| aquaporin, MIP family, PIP subfamily [Populus trichocarpa] gi|118480985|gb|ABK92446.1| unknown [Populus trichocarpa] gi|222865407|gb|EEF02538.1| aquaporin, MIP family, PIP subfamily [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query210
TAIR|locus:2082642 286 PIP2;5 "plasma membrane intrin 0.604 0.444 0.734 3.8e-46
TAIR|locus:2175831 291 PIP2;4 "plasma membrane intrin 0.604 0.436 0.682 7.5e-41
TAIR|locus:2061773 285 PIP2B "plasma membrane intrins 0.595 0.438 0.674 1.6e-40
TAIR|locus:2061763 285 RD28 "RESPONSIVE TO DESICCATIO 0.595 0.438 0.674 1.6e-40
TAIR|locus:2084031 287 PIP2A "plasma membrane intrins 0.604 0.442 0.643 1.8e-39
TAIR|locus:2064885 289 PIP2E "plasma membrane intrins 0.604 0.439 0.648 2.1e-38
TAIR|locus:2131601 280 PIP3 "plasma membrane intrinsi 0.561 0.421 0.669 4.3e-38
TAIR|locus:2039385 278 PIP2;8 "plasma membrane intrin 0.566 0.428 0.656 5.5e-38
TAIR|locus:2126026 287 PIP1;4 "plasma membrane intrin 0.580 0.425 0.592 5.2e-33
TAIR|locus:2025391 286 PIP1C "plasma membrane intrins 0.576 0.423 0.584 1.8e-32
TAIR|locus:2082642 PIP2;5 "plasma membrane intrinsic protein 2;5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 484 (175.4 bits), Expect = 3.8e-46, P = 3.8e-46
 Identities = 94/128 (73%), Positives = 101/128 (78%)

Query:    51 MAKDTGVAEHGSYSAKDYTDPPPEPLFDAVELTKWSFYRALIAEFIAXXXXXXXXXXXXI 110
             M K+  V +  S+S KDY DPPPEPLFDA EL KWSFYRALIAEFIA            I
Sbjct:     1 MTKEV-VGDKRSFSGKDYQDPPPEPLFDATELGKWSFYRALIAEFIATLLFLYVTIMTVI 59

Query:   111 GYKSQTDPAKNVDGCAGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV 170
             GYKSQTDPA N D C GVG+LGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGL LARKV
Sbjct:    60 GYKSQTDPALNPDQCTGVGVLGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLLLARKV 119

Query:   171 SLVRAVMW 178
             +LVRAVM+
Sbjct:   120 TLVRAVMY 127
GO:0005215 "transporter activity" evidence=IEA
GO:0005886 "plasma membrane" evidence=ISM
GO:0006810 "transport" evidence=ISS
GO:0015250 "water channel activity" evidence=ISS
GO:0016020 "membrane" evidence=IEA;ISS
GO:0016021 "integral to membrane" evidence=IEA
GO:0005515 "protein binding" evidence=IPI
GO:0006833 "water transport" evidence=RCA;IMP
GO:0006826 "iron ion transport" evidence=RCA
GO:0010106 "cellular response to iron ion starvation" evidence=RCA
TAIR|locus:2175831 PIP2;4 "plasma membrane intrinsic protein 2;4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2061773 PIP2B "plasma membrane intrinsic protein 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2061763 RD28 "RESPONSIVE TO DESICCATION 28" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2084031 PIP2A "plasma membrane intrinsic protein 2A" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2064885 PIP2E "plasma membrane intrinsic protein 2E" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2131601 PIP3 "plasma membrane intrinsic protein 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2039385 PIP2;8 "plasma membrane intrinsic protein 2;8" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2126026 PIP1;4 "plasma membrane intrinsic protein 1;4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2025391 PIP1C "plasma membrane intrinsic protein 1C" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q6K215PIP22_ORYSJNo assigned EC number0.75750.60950.4444yesno
Q9SV31PIP25_ARATHNo assigned EC number0.81250.60470.4440yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query210
pfam00230218 pfam00230, MIP, Major intrinsic protein 8e-35
cd00333 228 cd00333, MIP, Major intrinsic protein (MIP) superf 1e-25
TIGR00861 216 TIGR00861, MIP, MIP family channel proteins 5e-21
COG0580 241 COG0580, GlpF, Glycerol uptake facilitator and rel 1e-13
PLN00027 252 PLN00027, PLN00027, aquaporin TIP; Provisional 7e-13
PLN00166 250 PLN00166, PLN00166, aquaporin TIP2; Provisional 4e-11
PLN00167 256 PLN00167, PLN00167, aquaporin TIP5; Provisional 8e-10
PRK05420 231 PRK05420, PRK05420, aquaporin Z; Provisional 1e-08
PLN00184 296 PLN00184, PLN00184, aquaporin NIP1; Provisional 9e-07
PTZ00016 294 PTZ00016, PTZ00016, aquaglyceroporin; Provisional 1e-05
PLN00183 274 PLN00183, PLN00183, putative aquaporin NIP7; Provi 7e-05
PLN00026 298 PLN00026, PLN00026, aquaporin NIP; Provisional 2e-04
PLN00182 283 PLN00182, PLN00182, putative aquaporin NIP4; Provi 5e-04
COG0580241 COG0580, GlpF, Glycerol uptake facilitator and rel 7e-04
cd00333228 cd00333, MIP, Major intrinsic protein (MIP) superf 0.001
>gnl|CDD|215807 pfam00230, MIP, Major intrinsic protein Back     alignment and domain information 
 Score =  122 bits (308), Expect = 8e-35
 Identities = 46/98 (46%), Positives = 63/98 (64%), Gaps = 11/98 (11%)

Query: 81  ELTKWSFYRALIAEFIATLLFLYVTVLTVIGYKSQTDPAKNVDGCAGVGILGIAWAFGGM 140
           EL   SF+RA+IAEF+ATLLF++  V + +G K               G+L +A AFG  
Sbjct: 1   ELRSVSFWRAVIAEFLATLLFVFFGVGSALGVKKLYG-----------GLLAVALAFGLA 49

Query: 141 IFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMW 178
           +F LVYCT  ISG H+NPAVTF L + R++SL+RA+ +
Sbjct: 50  LFTLVYCTGHISGAHLNPAVTFALLVGRRISLLRAIYY 87

MIP (Major Intrinsic Protein) family proteins exhibit essentially two distinct types of channel properties: (1) specific water transport by the aquaporins, and (2) small neutral solutes transport, such as glycerol by the glycerol facilitators. Length = 218
>gnl|CDD|238204 cd00333, MIP, Major intrinsic protein (MIP) superfamily Back     alignment and domain information
>gnl|CDD|233156 TIGR00861, MIP, MIP family channel proteins Back     alignment and domain information
>gnl|CDD|223653 COG0580, GlpF, Glycerol uptake facilitator and related permeases (Major Intrinsic Protein Family) [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|177664 PLN00027, PLN00027, aquaporin TIP; Provisional Back     alignment and domain information
>gnl|CDD|165733 PLN00166, PLN00166, aquaporin TIP2; Provisional Back     alignment and domain information
>gnl|CDD|215085 PLN00167, PLN00167, aquaporin TIP5; Provisional Back     alignment and domain information
>gnl|CDD|235453 PRK05420, PRK05420, aquaporin Z; Provisional Back     alignment and domain information
>gnl|CDD|177778 PLN00184, PLN00184, aquaporin NIP1; Provisional Back     alignment and domain information
>gnl|CDD|240230 PTZ00016, PTZ00016, aquaglyceroporin; Provisional Back     alignment and domain information
>gnl|CDD|215092 PLN00183, PLN00183, putative aquaporin NIP7; Provisional Back     alignment and domain information
>gnl|CDD|177663 PLN00026, PLN00026, aquaporin NIP; Provisional Back     alignment and domain information
>gnl|CDD|165748 PLN00182, PLN00182, putative aquaporin NIP4; Provisional Back     alignment and domain information
>gnl|CDD|223653 COG0580, GlpF, Glycerol uptake facilitator and related permeases (Major Intrinsic Protein Family) [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|238204 cd00333, MIP, Major intrinsic protein (MIP) superfamily Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 210
COG0580 241 GlpF Glycerol uptake facilitator and related perme 99.92
KOG0224 316 consensus Aquaporin (major intrinsic protein famil 99.92
KOG0223 238 consensus Aquaporin (major intrinsic protein famil 99.91
PLN00184 296 aquaporin NIP1; Provisional 99.89
PF00230227 MIP: Major intrinsic protein; InterPro: IPR000425 99.89
PLN00182 283 putative aquaporin NIP4; Provisional 99.88
PTZ00016 294 aquaglyceroporin; Provisional 99.87
PLN00167 256 aquaporin TIP5; Provisional 99.85
PLN00026 298 aquaporin NIP; Provisional 99.84
PRK05420 231 aquaporin Z; Provisional 99.84
PLN00166 250 aquaporin TIP2; Provisional 99.84
PLN00027 252 aquaporin TIP; Provisional 99.83
PLN00183 274 putative aquaporin NIP7; Provisional 99.83
cd00333 228 MIP Major intrinsic protein (MIP) superfamily. Mem 99.79
TIGR00861 216 MIP MIP family channel proteins. processes. Some m 99.74
cd00333228 MIP Major intrinsic protein (MIP) superfamily. Mem 99.53
PLN00182283 putative aquaporin NIP4; Provisional 99.5
TIGR00861216 MIP MIP family channel proteins. processes. Some m 99.48
PLN00026298 aquaporin NIP; Provisional 99.43
PLN00183274 putative aquaporin NIP7; Provisional 99.41
PLN00184296 aquaporin NIP1; Provisional 99.2
KOG0223238 consensus Aquaporin (major intrinsic protein famil 99.14
PLN00166250 aquaporin TIP2; Provisional 99.09
PLN00027252 aquaporin TIP; Provisional 99.03
PRK05420231 aquaporin Z; Provisional 98.98
PLN00167256 aquaporin TIP5; Provisional 98.91
PF00230227 MIP: Major intrinsic protein; InterPro: IPR000425 98.86
PTZ00016294 aquaglyceroporin; Provisional 98.82
COG0580241 GlpF Glycerol uptake facilitator and related perme 98.54
KOG0224316 consensus Aquaporin (major intrinsic protein famil 95.45
>COG0580 GlpF Glycerol uptake facilitator and related permeases (Major Intrinsic Protein Family) [Carbohydrate transport and metabolism] Back     alignment and domain information 
Probab=99.92  E-value=2.7e-25  Score=194.64  Aligned_cols=118  Identities=26%  Similarity=0.364  Sum_probs=103.9

Q ss_pred             HHHHHHHHHHHHHHHHHHHHhhhhhcccccCCCCCCCCCCCCcchhHHHHHHHHHHHHHHHHhcCCCCcccChHHHHHHH
Q 028312           86 SFYRALIAEFIATLLFLYVTVLTVIGYKSQTDPAKNVDGCAGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLF  165 (210)
Q Consensus        86 sl~Ra~lAEFigTfLfvfi~~gtvi~~~~~~~~~~~~~~~~~~g~l~iAlafGl~I~vlIy~~g~ISGgHlNPAVTfal~  165 (210)
                      +..+.+++||+||+++++++++++++.....      ++..+.+++.++++||+++++.+|++++|||+|+|||||++++
T Consensus         3 ~~~~~~~aEflGT~~Li~~G~G~~a~~~l~~------~~~~~~~~~~i~~~wGl~V~~~iy~~g~iSGaHlNPAVTi~la   76 (241)
T COG0580           3 TLTKKLLAEFLGTFLLIFFGNGSVAAVALKG------SKALGGGWLGIALAWGLGVLVAIYAFGGISGAHLNPAVTIALA   76 (241)
T ss_pred             cHHHHHHHHHHHHHHHHHhhccHHHHHHhcc------ccccccceeehhHHHHHHHHHHHHhccCcCccccChHHHHHHH
Confidence            4567789999999999999999998776432      2234567888999999999999999999999999999999999


Q ss_pred             HhccCcchhhHHHHHHH---------HHHHHhHhhhhccC-CCCceeeeeeccC
Q 028312          166 LARKVSLVRAVMWGQRA---------GRWVQHRRWIGRRD-HRHLCLGLHCLLG  209 (210)
Q Consensus       166 l~gkis~~r~~~YiiAQ---------ga~l~y~~~~~~~~-~~~~~~g~fct~~  209 (210)
                      +.|+++|.+++.|++||         .+|+.|..++...+ |+...+|.|||.-
T Consensus        77 ~~g~fp~~~v~~YivAQ~lGA~~ga~l~~~~~~~~~~~~~~~~~~~~g~~~t~p  130 (241)
T COG0580          77 VRGRFPWRKVLPYIVAQVLGAFAGAALLYLLYYGKILETEGDPLASLGAFSTSP  130 (241)
T ss_pred             HhCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhHhhcCCchhhccccccCC
Confidence            99999999999999999         35677788888888 9999999999953

>KOG0224 consensus Aquaporin (major intrinsic protein family) [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG0223 consensus Aquaporin (major intrinsic protein family) [Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN00184 aquaporin NIP1; Provisional Back     alignment and domain information
>PF00230 MIP: Major intrinsic protein; InterPro: IPR000425 A number of transmembrane (TM) channel proteins can be grouped together on the basis of sequence similarities [, , , , ] Back     alignment and domain information
>PLN00182 putative aquaporin NIP4; Provisional Back     alignment and domain information
>PTZ00016 aquaglyceroporin; Provisional Back     alignment and domain information
>PLN00167 aquaporin TIP5; Provisional Back     alignment and domain information
>PLN00026 aquaporin NIP; Provisional Back     alignment and domain information
>PRK05420 aquaporin Z; Provisional Back     alignment and domain information
>PLN00166 aquaporin TIP2; Provisional Back     alignment and domain information
>PLN00027 aquaporin TIP; Provisional Back     alignment and domain information
>PLN00183 putative aquaporin NIP7; Provisional Back     alignment and domain information
>cd00333 MIP Major intrinsic protein (MIP) superfamily Back     alignment and domain information
>TIGR00861 MIP MIP family channel proteins Back     alignment and domain information
>cd00333 MIP Major intrinsic protein (MIP) superfamily Back     alignment and domain information
>PLN00182 putative aquaporin NIP4; Provisional Back     alignment and domain information
>TIGR00861 MIP MIP family channel proteins Back     alignment and domain information
>PLN00026 aquaporin NIP; Provisional Back     alignment and domain information
>PLN00183 putative aquaporin NIP7; Provisional Back     alignment and domain information
>PLN00184 aquaporin NIP1; Provisional Back     alignment and domain information
>KOG0223 consensus Aquaporin (major intrinsic protein family) [Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN00166 aquaporin TIP2; Provisional Back     alignment and domain information
>PLN00027 aquaporin TIP; Provisional Back     alignment and domain information
>PRK05420 aquaporin Z; Provisional Back     alignment and domain information
>PLN00167 aquaporin TIP5; Provisional Back     alignment and domain information
>PF00230 MIP: Major intrinsic protein; InterPro: IPR000425 A number of transmembrane (TM) channel proteins can be grouped together on the basis of sequence similarities [, , , , ] Back     alignment and domain information
>PTZ00016 aquaglyceroporin; Provisional Back     alignment and domain information
>COG0580 GlpF Glycerol uptake facilitator and related permeases (Major Intrinsic Protein Family) [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG0224 consensus Aquaporin (major intrinsic protein family) [Carbohydrate transport and metabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query210
2b5f_A 303 Crystal Structure Of The Spinach Aquaporin Sopip2;1 9e-36
1z98_A 281 Crystal Structure Of The Spinach Aquaporin Sopip2;1 1e-35
3cn6_A 304 Crystal Structure Of The Spinach Aquaporin Sopip2;1 1e-35
3cn5_A 304 Crystal Structure Of The Spinach Aquaporin Sopip2;1 3e-35
3cll_A 300 Crystal Structure Of The Spinach Aquaporin Sopip2;1 3e-35
1fqy_A 269 Structure Of Aquaporin-1 At 3.8 A Resolution By Ele 5e-09
1j4n_A 271 Crystal Structure Of The Aqp1 Water Channel Length 3e-08
3iyz_A 340 Structure Of Aquaporin-4 S180d Mutant At 10.0 A Res 4e-07
2zz9_A 301 Structure Of Aquaporin-4 S180d Mutant At 2.8 A Reso 4e-07
2d57_A 301 Double Layered 2d Crystal Structure Of Aquaporin-4 4e-07
3gd8_A 223 Crystal Structure Of Human Aquaporin 4 At 1.8 And I 2e-06
2b6o_A 263 Electron Crystallographic Structure Of Lens Aquapor 5e-06
1ymg_A 263 The Channel Architecture Of Aquaporin O At 2.2 Angs 7e-06
3d9s_A 266 Human Aquaporin 5 (Aqp5) - High Resolution X-Ray St 1e-05
3m9i_A 220 Electron Crystallographic Structure Of Lens Aquapor 4e-05
1sor_A 235 Aquaporin-0 Membrane Junctions Reveal The Structure 4e-05
3llq_A 256 Aquaporin Structure From Plant Pathogen Agrobacteri 5e-05
2o9f_A 234 Crystal Structure Of Aqpz Mutant L170c Length = 234 6e-04
2o9d_A 234 Crystal Structure Of Aqpz Mutant T183c. Length = 23 6e-04
2o9e_A 234 Crystal Structure Of Aqpz Mutant T183c Complexed Wi 6e-04
1rc2_B 231 2.5 Angstrom Resolution X-Ray Structure Of Aquapori 7e-04
3nka_A 234 Crystal Structure Of Aqpz H174g,T183f Length = 234 7e-04
>pdb|2B5F|A Chain A, Crystal Structure Of The Spinach Aquaporin Sopip2;1 In An Open Conformation To 3.9 Resolution Length = 303 Back     alignment and structure 
Iteration: 1

 Score =  146 bits (368), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 75/128 (58%), Positives = 85/128 (66%), Gaps = 6/128 (4%)
Query: 51  MAKDTGVAEHGSYSAKDYTDPPPEPLFDAVELTKWSFYRALIAEFIAXXXXXXXXXXXXI 110
           M+K+           KDY DPPP P FD  EL  WSF+RA IAEFIA            I
Sbjct: 1   MSKEVSEEAQAHQHGKDYVDPPPAPFFDLGELKLWSFWRAAIAEFIATLLFLYITVATVI 60
Query: 111 GYKSQTDPAKNVDGCAGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV 170
           G+  +T        C  VG+LGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV
Sbjct: 61  GHSKETVV------CGSVGLLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV 114
Query: 171 SLVRAVMW 178
           SL+RA+++
Sbjct: 115 SLLRALVY 122
>pdb|1Z98|A Chain A, Crystal Structure Of The Spinach Aquaporin Sopip2;1 In A Closed Conformation Length = 281 Back     alignment and structure
>pdb|3CN6|A Chain A, Crystal Structure Of The Spinach Aquaporin Sopip2;1 S274e Mutant Length = 304 Back     alignment and structure
>pdb|3CN5|A Chain A, Crystal Structure Of The Spinach Aquaporin Sopip2;1 S115e, S274e Mutant Length = 304 Back     alignment and structure
>pdb|3CLL|A Chain A, Crystal Structure Of The Spinach Aquaporin Sopip2;1 S115e Mutant Length = 300 Back     alignment and structure
>pdb|1FQY|A Chain A, Structure Of Aquaporin-1 At 3.8 A Resolution By Electron Crystallography Length = 269 Back     alignment and structure
>pdb|1J4N|A Chain A, Crystal Structure Of The Aqp1 Water Channel Length = 271 Back     alignment and structure
>pdb|3IYZ|A Chain A, Structure Of Aquaporin-4 S180d Mutant At 10.0 A Resolution From Electron Micrograph Length = 340 Back     alignment and structure
>pdb|2ZZ9|A Chain A, Structure Of Aquaporin-4 S180d Mutant At 2.8 A Resolution By Electron Crystallography Length = 301 Back     alignment and structure
>pdb|2D57|A Chain A, Double Layered 2d Crystal Structure Of Aquaporin-4 (Aqp4m23) At 3.2 A Resolution By Electron Crystallography Length = 301 Back     alignment and structure
>pdb|3GD8|A Chain A, Crystal Structure Of Human Aquaporin 4 At 1.8 And Its Mechanism Of Conductance Length = 223 Back     alignment and structure
>pdb|2B6O|A Chain A, Electron Crystallographic Structure Of Lens Aquaporin-0 (Aqp0) (Lens Mip) At 1.9a Resolution, In A Closed Pore State Length = 263 Back     alignment and structure
>pdb|1YMG|A Chain A, The Channel Architecture Of Aquaporin O At 2.2 Angstrom Resolution Length = 263 Back     alignment and structure
>pdb|3D9S|A Chain A, Human Aquaporin 5 (Aqp5) - High Resolution X-Ray Structure Length = 266 Back     alignment and structure
>pdb|3M9I|A Chain A, Electron Crystallographic Structure Of Lens Aquaporin-0 (Aqp Mip) In E. Coli Polar Lipids Length = 220 Back     alignment and structure
>pdb|1SOR|A Chain A, Aquaporin-0 Membrane Junctions Reveal The Structure Of A Closed Water Pore Length = 235 Back     alignment and structure
>pdb|3LLQ|A Chain A, Aquaporin Structure From Plant Pathogen Agrobacterium Tumerfaciens Length = 256 Back     alignment and structure
>pdb|2O9F|A Chain A, Crystal Structure Of Aqpz Mutant L170c Length = 234 Back     alignment and structure
>pdb|2O9D|A Chain A, Crystal Structure Of Aqpz Mutant T183c. Length = 234 Back     alignment and structure
>pdb|2O9E|A Chain A, Crystal Structure Of Aqpz Mutant T183c Complexed With Mercury Length = 234 Back     alignment and structure
>pdb|1RC2|B Chain B, 2.5 Angstrom Resolution X-Ray Structure Of Aquaporin Z Length = 231 Back     alignment and structure
>pdb|3NKA|A Chain A, Crystal Structure Of Aqpz H174g,T183f Length = 234 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query210
3cn5_A 304 Aquaporin; membrane protein, transmembrane, transp 4e-55
3cn5_A304 Aquaporin; membrane protein, transmembrane, transp 5e-05
3iyz_A 340 Aquaporin-4; water transport, water channel, two-d 7e-46
3iyz_A340 Aquaporin-4; water transport, water channel, two-d 2e-05
2w2e_A 279 AQY1, aquaporin, aquaporin PIP2-7 7; yeast, gating 9e-42
2w2e_A279 AQY1, aquaporin, aquaporin PIP2-7 7; yeast, gating 1e-04
3llq_A 256 Aquaporin Z 2; aquaporin tetramer, membrane protei 2e-41
3llq_A256 Aquaporin Z 2; aquaporin tetramer, membrane protei 6e-04
1j4n_A 271 Aquaporin 1; membrane protein, channel protein, tr 2e-39
1j4n_A271 Aquaporin 1; membrane protein, channel protein, tr 2e-04
2zz9_A 301 Aquaporin-4; water transport, water channel, two-d 6e-39
2zz9_A301 Aquaporin-4; water transport, water channel, two-d 3e-05
3d9s_A 266 Aquaporin-5, AQP-5; aquaglyceroporin, membrane pro 7e-38
3d9s_A266 Aquaporin-5, AQP-5; aquaglyceroporin, membrane pro 5e-04
2b6o_A 263 Aquaporin-0, lens fiber major intrinsic protein; a 3e-37
2b6o_A263 Aquaporin-0, lens fiber major intrinsic protein; a 6e-05
2o9g_A 234 Aquaporin Z; integral membrane protein, structural 8e-37
2o9g_A234 Aquaporin Z; integral membrane protein, structural 4e-04
3gd8_A 223 Aquaporin-4; proton exclusion, structural genomics 1e-35
3gd8_A223 Aquaporin-4; proton exclusion, structural genomics 2e-04
2f2b_A 246 Aquaporin AQPM; protein, integral membrane protein 4e-27
2f2b_A246 Aquaporin AQPM; protein, integral membrane protein 1e-04
3c02_A 258 Aquaglyceroporin; membrane protein, glycerol, wate 1e-14
3c02_A258 Aquaglyceroporin; membrane protein, glycerol, wate 3e-04
1ldf_A 281 Glycerol uptake facilitator protein; glycerol-cond 1e-13
>3cn5_A Aquaporin; membrane protein, transmembrane, transport, transport protein; 2.05A {Spinacia oleracea} PDB: 3cn6_A 3cll_A 1z98_A 2b5f_A Length = 304 Back     alignment and structure
 Score =  176 bits (448), Expect = 4e-55
 Identities = 84/127 (66%), Positives = 94/127 (74%), Gaps = 6/127 (4%)

Query: 51  MAKDTGVAEHGSYSAKDYTDPPPEPLFDAVELTKWSFYRALIAEFIATLLFLYVTVLTVI 110
           M+K+           KDY DPPP P FD  EL  WSF+RA IAEFIATLLFLY+TV TVI
Sbjct: 24  MSKEVSEEAQAHQHGKDYVDPPPAPFFDLGELKLWSFWRAAIAEFIATLLFLYITVATVI 83

Query: 111 GYKSQTDPAKNVDGCAGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV 170
           G+  +T        C  VG+LGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV
Sbjct: 84  GHSKETVV------CGSVGLLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV 137

Query: 171 SLVRAVM 177
            L+RA++
Sbjct: 138 ELLRALV 144
>3cn5_A Aquaporin; membrane protein, transmembrane, transport, transport protein; 2.05A {Spinacia oleracea} PDB: 3cn6_A 3cll_A 1z98_A 2b5f_A Length = 304 Back     alignment and structure
>3iyz_A Aquaporin-4; water transport, water channel, two-dimensional C membrane protein, baculovirus expression system, glycoprote membrane; 10.00A {Rattus norvegicus} Length = 340 Back     alignment and structure
>3iyz_A Aquaporin-4; water transport, water channel, two-dimensional C membrane protein, baculovirus expression system, glycoprote membrane; 10.00A {Rattus norvegicus} Length = 340 Back     alignment and structure
>2w2e_A AQY1, aquaporin, aquaporin PIP2-7 7; yeast, gating, membrane protein; HET: BOG; 1.15A {Komagataella pastoris} PDB: 2w1p_A* Length = 279 Back     alignment and structure
>2w2e_A AQY1, aquaporin, aquaporin PIP2-7 7; yeast, gating, membrane protein; HET: BOG; 1.15A {Komagataella pastoris} PDB: 2w1p_A* Length = 279 Back     alignment and structure
>3llq_A Aquaporin Z 2; aquaporin tetramer, membrane protein, water channel, structu genomics, PSI-2, protein structure initiative; 2.01A {Agrobacterium tumefaciens str} Length = 256 Back     alignment and structure
>3llq_A Aquaporin Z 2; aquaporin tetramer, membrane protein, water channel, structu genomics, PSI-2, protein structure initiative; 2.01A {Agrobacterium tumefaciens str} Length = 256 Back     alignment and structure
>1j4n_A Aquaporin 1; membrane protein, channel protein, transmembrane helices; HET: BNG; 2.20A {Bos taurus} SCOP: f.19.1.1 PDB: 1h6i_A 1fqy_A 1ih5_A Length = 271 Back     alignment and structure
>1j4n_A Aquaporin 1; membrane protein, channel protein, transmembrane helices; HET: BNG; 2.20A {Bos taurus} SCOP: f.19.1.1 PDB: 1h6i_A 1fqy_A 1ih5_A Length = 271 Back     alignment and structure
>2zz9_A Aquaporin-4; water transport, water channel, two-dimensional crystal, electron diffraction, electron microscopy, membrane protein; HET: PEE; 2.80A {Rattus norvegicus} PDB: 2d57_A Length = 301 Back     alignment and structure
>2zz9_A Aquaporin-4; water transport, water channel, two-dimensional crystal, electron diffraction, electron microscopy, membrane protein; HET: PEE; 2.80A {Rattus norvegicus} PDB: 2d57_A Length = 301 Back     alignment and structure
>3d9s_A Aquaporin-5, AQP-5; aquaglyceroporin, membrane protein, water transport, X-RAY diffraction, lipid, phosphatidylserine, PSF, NPA, AR/R, water channel; HET: PS6; 2.00A {Homo sapiens} Length = 266 Back     alignment and structure
>3d9s_A Aquaporin-5, AQP-5; aquaglyceroporin, membrane protein, water transport, X-RAY diffraction, lipid, phosphatidylserine, PSF, NPA, AR/R, water channel; HET: PS6; 2.00A {Homo sapiens} Length = 266 Back     alignment and structure
>2b6o_A Aquaporin-0, lens fiber major intrinsic protein; aquaporin-0 junctions, AQP0, lens MIP, lipid-protein interac membrane, lipid bilayer; HET: MC3; 1.90A {Ovis aries} SCOP: f.19.1.1 PDB: 1ymg_A* 2b6p_A 2c32_A 1sor_A 3m9i_A* Length = 263 Back     alignment and structure
>2b6o_A Aquaporin-0, lens fiber major intrinsic protein; aquaporin-0 junctions, AQP0, lens MIP, lipid-protein interac membrane, lipid bilayer; HET: MC3; 1.90A {Ovis aries} SCOP: f.19.1.1 PDB: 1ymg_A* 2b6p_A 2c32_A 1sor_A 3m9i_A* Length = 263 Back     alignment and structure
>2o9g_A Aquaporin Z; integral membrane protein, structural genomics, P protein structure initiative, center for structures of MEMB proteins, CSMP; HET: BOG; 1.90A {Escherichia coli} PDB: 2o9f_A* 2o9d_A* 2o9e_A 1rc2_B* 2abm_A* 3nk5_A* 3nka_A* 3nkc_A* Length = 234 Back     alignment and structure
>2o9g_A Aquaporin Z; integral membrane protein, structural genomics, P protein structure initiative, center for structures of MEMB proteins, CSMP; HET: BOG; 1.90A {Escherichia coli} PDB: 2o9f_A* 2o9d_A* 2o9e_A 1rc2_B* 2abm_A* 3nk5_A* 3nka_A* 3nkc_A* Length = 234 Back     alignment and structure
>3gd8_A Aquaporin-4; proton exclusion, structural genomics protein structure initiative, center for structures of MEMB proteins, CSMP, glycoprotein; HET: BOG; 1.80A {Homo sapiens} Length = 223 Back     alignment and structure
>3gd8_A Aquaporin-4; proton exclusion, structural genomics protein structure initiative, center for structures of MEMB proteins, CSMP, glycoprotein; HET: BOG; 1.80A {Homo sapiens} Length = 223 Back     alignment and structure
>2f2b_A Aquaporin AQPM; protein, integral membrane protein, channel, structural GENO PSI-2, protein structure initiative; 1.68A {Methanothermobacter marburgensis str} PDB: 2evu_A 3ne2_A* Length = 246 Back     alignment and structure
>2f2b_A Aquaporin AQPM; protein, integral membrane protein, channel, structural GENO PSI-2, protein structure initiative; 1.68A {Methanothermobacter marburgensis str} PDB: 2evu_A 3ne2_A* Length = 246 Back     alignment and structure
>3c02_A Aquaglyceroporin; membrane protein, glycerol, water, transport, structural GEN PSI-2, protein structure initiative; HET: BOG; 2.05A {Plasmodium falciparum} Length = 258 Back     alignment and structure
>3c02_A Aquaglyceroporin; membrane protein, glycerol, water, transport, structural GEN PSI-2, protein structure initiative; HET: BOG; 2.05A {Plasmodium falciparum} Length = 258 Back     alignment and structure
>1ldf_A Glycerol uptake facilitator protein; glycerol-conducting membrane channel protein, transport PROT; HET: BOG; 2.10A {Escherichia coli} SCOP: f.19.1.1 PDB: 1fx8_A* 1lda_A* 1ldi_A* Length = 281 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query210
3cn5_A 304 Aquaporin; membrane protein, transmembrane, transp 100.0
3iyz_A 340 Aquaporin-4; water transport, water channel, two-d 99.94
1j4n_A 271 Aquaporin 1; membrane protein, channel protein, tr 99.93
2zz9_A 301 Aquaporin-4; water transport, water channel, two-d 99.92
3c02_A 258 Aquaglyceroporin; membrane protein, glycerol, wate 99.91
3llq_A 256 Aquaporin Z 2; aquaporin tetramer, membrane protei 99.91
3d9s_A 266 Aquaporin-5, AQP-5; aquaglyceroporin, membrane pro 99.91
3gd8_A 223 Aquaporin-4; proton exclusion, structural genomics 99.9
1ldf_A 281 Glycerol uptake facilitator protein; glycerol-cond 99.9
2f2b_A 246 Aquaporin AQPM; protein, integral membrane protein 99.9
2o9g_A 234 Aquaporin Z; integral membrane protein, structural 99.9
2w2e_A 279 AQY1, aquaporin, aquaporin PIP2-7 7; yeast, gating 99.9
2b6o_A 263 Aquaporin-0, lens fiber major intrinsic protein; a 99.89
2f2b_A246 Aquaporin AQPM; protein, integral membrane protein 99.46
2b6o_A263 Aquaporin-0, lens fiber major intrinsic protein; a 99.1
2w2e_A279 AQY1, aquaporin, aquaporin PIP2-7 7; yeast, gating 99.06
2o9g_A234 Aquaporin Z; integral membrane protein, structural 99.05
3d9s_A266 Aquaporin-5, AQP-5; aquaglyceroporin, membrane pro 99.03
3llq_A256 Aquaporin Z 2; aquaporin tetramer, membrane protei 99.01
3cn5_A304 Aquaporin; membrane protein, transmembrane, transp 99.0
2zz9_A301 Aquaporin-4; water transport, water channel, two-d 98.96
3iyz_A340 Aquaporin-4; water transport, water channel, two-d 98.94
3gd8_A223 Aquaporin-4; proton exclusion, structural genomics 98.92
1ldf_A281 Glycerol uptake facilitator protein; glycerol-cond 98.91
3c02_A258 Aquaglyceroporin; membrane protein, glycerol, wate 98.89
1j4n_A271 Aquaporin 1; membrane protein, channel protein, tr 98.89
>3cn5_A Aquaporin; membrane protein, transmembrane, transport, transport protein; 2.05A {Spinacia oleracea} PDB: 3cn6_A 3cll_A 1z98_A 2b5f_A Back     alignment and structure
Probab=100.00  E-value=8.2e-34  Score=254.00  Aligned_cols=127  Identities=66%  Similarity=1.104  Sum_probs=86.6

Q ss_pred             cccccccccccCCCCCCCCCCCCCCCCcchhhccchHHHHHHHHHHHHHHHHHHHHhhhhhcccccCCCCCCCCCCCCcc
Q 028312           50 PMAKDTGVAEHGSYSAKDYTDPPPEPLFDAVELTKWSFYRALIAEFIATLLFLYVTVLTVIGYKSQTDPAKNVDGCAGVG  129 (210)
Q Consensus        50 ~m~~~~~~~~~~~~~~kdy~~pppap~~~~~el~~~sl~Ra~lAEFigTfLfvfi~~gtvi~~~~~~~~~~~~~~~~~~g  129 (210)
                      -|+||++.++++.+++|||+||||+|++|.+|+++|+++|++++||+||++|+|++++++++.....      +++...+
T Consensus        23 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~e~~~~~~~r~~lAEfiGT~lLv~~g~gsv~~~~~~~------~~~~~~g   96 (304)
T 3cn5_A           23 LMSKEVSEEAQAHQHGKDYVDPPPAPFFDLGELKLWSFWRAAIAEFIATLLFLYITVATVIGHSKET------VVCGSVG   96 (304)
T ss_dssp             --------------------------------CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTCC------STTCSCH
T ss_pred             HHHHHhhccccccccCCCccCCCcccccCccccccHHHHHHHHHHHHHHHHHHHHHhHHHeEecccc------CCCCCCC
Confidence            3788865322234568999999999999999999999999999999999999999999988754322      1234457


Q ss_pred             hhHHHHHHHHHHHHHHHHhcCCCCcccChHHHHHHHHhccCcchhhHHHHHHH
Q 028312          130 ILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMWGQRA  182 (210)
Q Consensus       130 ~l~iAlafGl~I~vlIy~~g~ISGgHlNPAVTfal~l~gkis~~r~~~YiiAQ  182 (210)
                      ++.++|+||+++++++|++++|||||+|||||+++++.|+++|.++++|++||
T Consensus        97 ~l~iala~Glav~~~v~~~g~iSGaHlNPAVTla~~l~g~~~~~~~~~YiiAQ  149 (304)
T 3cn5_A           97 LLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVELLRALVYMIAQ  149 (304)
T ss_dssp             HHHHHHHHHHHHHHHHHHHTTTTCCCCSHHHHHHHHHTTSSCHHHHHHHHHHH
T ss_pred             ceeehhhhhhhhheeeeEeeccCCCccCcHHHHHHHHhCCCCHHHHHHHHHHH
Confidence            89999999999999999999999999999999999999999999999999999
>3iyz_A Aquaporin-4; water transport, water channel, two-dimensional C membrane protein, baculovirus expression system, glycoprote membrane; 10.00A {Rattus norvegicus} Back     alignment and structure
>1j4n_A Aquaporin 1; membrane protein, channel protein, transmembrane helices; HET: BNG; 2.20A {Bos taurus} SCOP: f.19.1.1 PDB: 1h6i_A 1fqy_A 1ih5_A Back     alignment and structure
>2zz9_A Aquaporin-4; water transport, water channel, two-dimensional crystal, electron diffraction, electron microscopy, membrane protein; HET: PEE; 2.80A {Rattus norvegicus} PDB: 2d57_A Back     alignment and structure
>3c02_A Aquaglyceroporin; membrane protein, glycerol, water, transport, structural GEN PSI-2, protein structure initiative; HET: BOG; 2.05A {Plasmodium falciparum} Back     alignment and structure
>3llq_A Aquaporin Z 2; aquaporin tetramer, membrane protein, water channel, structu genomics, PSI-2, protein structure initiative; 2.01A {Agrobacterium tumefaciens str} Back     alignment and structure
>3d9s_A Aquaporin-5, AQP-5; aquaglyceroporin, membrane protein, water transport, X-RAY diffraction, lipid, phosphatidylserine, PSF, NPA, AR/R, water channel; HET: PS6; 2.00A {Homo sapiens} Back     alignment and structure
>3gd8_A Aquaporin-4; proton exclusion, structural genomics protein structure initiative, center for structures of MEMB proteins, CSMP, glycoprotein; HET: BOG; 1.80A {Homo sapiens} Back     alignment and structure
>1ldf_A Glycerol uptake facilitator protein; glycerol-conducting membrane channel protein, transport PROT; HET: BOG; 2.10A {Escherichia coli} SCOP: f.19.1.1 PDB: 1fx8_A* 1lda_A* 1ldi_A* Back     alignment and structure
>2f2b_A Aquaporin AQPM; protein, integral membrane protein, channel, structural GENO PSI-2, protein structure initiative; 1.68A {Methanothermobacter marburgensis str} PDB: 2evu_A 3ne2_A* Back     alignment and structure
>2o9g_A Aquaporin Z; integral membrane protein, structural genomics, P protein structure initiative, center for structures of MEMB proteins, CSMP; HET: BOG; 1.90A {Escherichia coli} PDB: 2o9f_A* 2o9d_A* 2o9e_A 1rc2_B* 2abm_A* 3nk5_A* 3nka_A* 3nkc_A* Back     alignment and structure
>2w2e_A AQY1, aquaporin, aquaporin PIP2-7 7; yeast, gating, membrane protein; HET: BOG; 1.15A {Komagataella pastoris} PDB: 2w1p_A* Back     alignment and structure
>2b6o_A Aquaporin-0, lens fiber major intrinsic protein; aquaporin-0 junctions, AQP0, lens MIP, lipid-protein interac membrane, lipid bilayer; HET: MC3; 1.90A {Ovis aries} SCOP: f.19.1.1 PDB: 1ymg_A* 2b6p_A 2c32_A 1sor_A 3m9i_A* Back     alignment and structure
>2f2b_A Aquaporin AQPM; protein, integral membrane protein, channel, structural GENO PSI-2, protein structure initiative; 1.68A {Methanothermobacter marburgensis str} PDB: 2evu_A 3ne2_A* Back     alignment and structure
>2b6o_A Aquaporin-0, lens fiber major intrinsic protein; aquaporin-0 junctions, AQP0, lens MIP, lipid-protein interac membrane, lipid bilayer; HET: MC3; 1.90A {Ovis aries} SCOP: f.19.1.1 PDB: 1ymg_A* 2b6p_A 2c32_A 1sor_A 3m9i_A* Back     alignment and structure
>2w2e_A AQY1, aquaporin, aquaporin PIP2-7 7; yeast, gating, membrane protein; HET: BOG; 1.15A {Komagataella pastoris} PDB: 2w1p_A* Back     alignment and structure
>2o9g_A Aquaporin Z; integral membrane protein, structural genomics, P protein structure initiative, center for structures of MEMB proteins, CSMP; HET: BOG; 1.90A {Escherichia coli} PDB: 2o9f_A* 2o9d_A* 2o9e_A 1rc2_B* 2abm_A* 3nk5_A* 3nka_A* 3nkc_A* Back     alignment and structure
>3d9s_A Aquaporin-5, AQP-5; aquaglyceroporin, membrane protein, water transport, X-RAY diffraction, lipid, phosphatidylserine, PSF, NPA, AR/R, water channel; HET: PS6; 2.00A {Homo sapiens} Back     alignment and structure
>3llq_A Aquaporin Z 2; aquaporin tetramer, membrane protein, water channel, structu genomics, PSI-2, protein structure initiative; 2.01A {Agrobacterium tumefaciens str} Back     alignment and structure
>3cn5_A Aquaporin; membrane protein, transmembrane, transport, transport protein; 2.05A {Spinacia oleracea} PDB: 3cn6_A 3cll_A 1z98_A 2b5f_A Back     alignment and structure
>2zz9_A Aquaporin-4; water transport, water channel, two-dimensional crystal, electron diffraction, electron microscopy, membrane protein; HET: PEE; 2.80A {Rattus norvegicus} PDB: 2d57_A Back     alignment and structure
>3iyz_A Aquaporin-4; water transport, water channel, two-dimensional C membrane protein, baculovirus expression system, glycoprote membrane; 10.00A {Rattus norvegicus} Back     alignment and structure
>3gd8_A Aquaporin-4; proton exclusion, structural genomics protein structure initiative, center for structures of MEMB proteins, CSMP, glycoprotein; HET: BOG; 1.80A {Homo sapiens} Back     alignment and structure
>1ldf_A Glycerol uptake facilitator protein; glycerol-conducting membrane channel protein, transport PROT; HET: BOG; 2.10A {Escherichia coli} SCOP: f.19.1.1 PDB: 1fx8_A* 1lda_A* 1ldi_A* Back     alignment and structure
>3c02_A Aquaglyceroporin; membrane protein, glycerol, water, transport, structural GEN PSI-2, protein structure initiative; HET: BOG; 2.05A {Plasmodium falciparum} Back     alignment and structure
>1j4n_A Aquaporin 1; membrane protein, channel protein, transmembrane helices; HET: BNG; 2.20A {Bos taurus} SCOP: f.19.1.1 PDB: 1h6i_A 1fqy_A 1ih5_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 210
d1j4na_ 249 f.19.1.1 (A:) Aquaporin-1 {Cow (Bos taurus) [TaxId 5e-23
d1ymga1 234 f.19.1.1 (A:6-239) Aquaporin-0 {Cow (Bos taurus) [ 2e-18
d1fx8a_ 254 f.19.1.1 (A:) Glycerol uptake facilitator protein 4e-14
d1fx8a_254 f.19.1.1 (A:) Glycerol uptake facilitator protein 0.004
d1rc2a_ 231 f.19.1.1 (A:) Aquaporin Z {Escherichia coli [TaxId 9e-14
>d1j4na_ f.19.1.1 (A:) Aquaporin-1 {Cow (Bos taurus) [TaxId: 9913]} Length = 249 Back     information, alignment and structure

class: Membrane and cell surface proteins and peptides
fold: Aquaporin-like
superfamily: Aquaporin-like
family: Aquaporin-like
domain: Aquaporin-1
species: Cow (Bos taurus) [TaxId: 9913]

 Score = 91.0 bits (225), Expect = 5e-23
 Identities = 36/100 (36%), Positives = 60/100 (60%), Gaps = 2/100 (2%)

Query: 79  AVELTKWSFYRALIAEFIATLLFLYVTVLTVIGYKSQTDPAKNVDGCAGVGILGIAWAFG 138
           A E  K  F+RA++AEF+A +LF+++++ + +G+        N    A    + ++ AFG
Sbjct: 2   ASEFKKKLFWRAVVAEFLAMILFIFISIGSALGFHYPI--KSNQTTGAVQDNVKVSLAFG 59

Query: 139 GMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMW 178
             I  L      ISG H+NPAVT GL L+ ++S++RA+M+
Sbjct: 60  LSIATLAQSVGHISGAHLNPAVTLGLLLSCQISVLRAIMY 99
>d1ymga1 f.19.1.1 (A:6-239) Aquaporin-0 {Cow (Bos taurus) [TaxId: 9913]} Length = 234 Back     information, alignment and structure
>d1fx8a_ f.19.1.1 (A:) Glycerol uptake facilitator protein GlpF {Escherichia coli [TaxId: 562]} Length = 254 Back     information, alignment and structure
>d1fx8a_ f.19.1.1 (A:) Glycerol uptake facilitator protein GlpF {Escherichia coli [TaxId: 562]} Length = 254 Back     information, alignment and structure
>d1rc2a_ f.19.1.1 (A:) Aquaporin Z {Escherichia coli [TaxId: 562]} Length = 231 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query210
d1j4na_ 249 Aquaporin-1 {Cow (Bos taurus) [TaxId: 9913]} 99.92
d1ymga1 234 Aquaporin-0 {Cow (Bos taurus) [TaxId: 9913]} 99.91
d1rc2a_ 231 Aquaporin Z {Escherichia coli [TaxId: 562]} 99.89
d1fx8a_ 254 Glycerol uptake facilitator protein GlpF {Escheric 99.87
d1fx8a_254 Glycerol uptake facilitator protein GlpF {Escheric 99.04
d1rc2a_231 Aquaporin Z {Escherichia coli [TaxId: 562]} 99.02
d1ymga1234 Aquaporin-0 {Cow (Bos taurus) [TaxId: 9913]} 98.94
d1j4na_249 Aquaporin-1 {Cow (Bos taurus) [TaxId: 9913]} 98.8
>d1j4na_ f.19.1.1 (A:) Aquaporin-1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
class: Membrane and cell surface proteins and peptides
fold: Aquaporin-like
superfamily: Aquaporin-like
family: Aquaporin-like
domain: Aquaporin-1
species: Cow (Bos taurus) [TaxId: 9913]

Probab=99.92  E-value=6.1e-25  Score=187.62  Aligned_cols=101  Identities=35%  Similarity=0.580  Sum_probs=88.0

Q ss_pred             hhccchHHHHHHHHHHHHHHHHHHHHhhhhhcccccCCCCCCCCCCCCcchhHHHHHHHHHHHHHHHHhcCCCCcccChH
Q 028312           80 VELTKWSFYRALIAEFIATLLFLYVTVLTVIGYKSQTDPAKNVDGCAGVGILGIAWAFGGMIFVLVYCTAGISGGHINPA  159 (210)
Q Consensus        80 ~el~~~sl~Ra~lAEFigTfLfvfi~~gtvi~~~~~~~~~~~~~~~~~~g~l~iAlafGl~I~vlIy~~g~ISGgHlNPA  159 (210)
                      .|+++.++||++++||+||++|+|++++++++......  .+.+.....+.+.++++||+++++++|+++++||||+|||
T Consensus         3 ~~~~~~~~wr~~~aEf~gTfllvf~~~gs~~~~~~~~~--~~~~~~~~~~~l~ial~~G~~v~~~i~~~g~iSGaH~NPA   80 (249)
T d1j4na_           3 SEFKKKLFWRAVVAEFLAMILFIFISIGSALGFHYPIK--SNQTTGAVQDNVKVSLAFGLSIATLAQSVGHISGAHLNPA   80 (249)
T ss_dssp             STTHHHHHHHHHHHHHHHHHHHHHHHHHHHHGGGCCCS--SCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCHH
T ss_pred             hHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHhhhcccc--ccccCCccccHHHHHHHHHHHHHHHHHHhhccccceeCch
Confidence            68899999999999999999999999998876543221  1122334456789999999999999999999999999999


Q ss_pred             HHHHHHHhccCcchhhHHHHHHH
Q 028312          160 VTFGLFLARKVSLVRAVMWGQRA  182 (210)
Q Consensus       160 VTfal~l~gkis~~r~~~YiiAQ  182 (210)
                      ||+++++.|+++|.++++|+++|
T Consensus        81 VTla~~~~g~i~~~~~~~Yi~aQ  103 (249)
T d1j4na_          81 VTLGLLLSCQISVLRAIMYIIAQ  103 (249)
T ss_dssp             HHHHHHHTTSSCHHHHHHHHHHH
T ss_pred             hHHHHHhccccchhheeeeeeHH
Confidence            99999999999999999999999
>d1ymga1 f.19.1.1 (A:6-239) Aquaporin-0 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1rc2a_ f.19.1.1 (A:) Aquaporin Z {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fx8a_ f.19.1.1 (A:) Glycerol uptake facilitator protein GlpF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fx8a_ f.19.1.1 (A:) Glycerol uptake facilitator protein GlpF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rc2a_ f.19.1.1 (A:) Aquaporin Z {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ymga1 f.19.1.1 (A:6-239) Aquaporin-0 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1j4na_ f.19.1.1 (A:) Aquaporin-1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure