Citrus Sinensis ID: 028345

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210
MSSLAFSVGNCSLTKLTTLKTRRLSRHFNKTEVSAIKFSSQQQNSCPPQKLHHLNENPTPFRRREAIGFGLCFGLVDVVLQTQPSSAAEAAAPSPCELTVAPSGLAFCDKVVGVGPEAVKGQLIKAHYVGKLENGKVFDSSYNRGKPLIFRLGVGEVCNQCANKSNRVKSWSLEFDNNQLSFETCFPIFIWWLWFYNGSKTIICQLLPYP
ccccccccccccccccccHHHHHcccccccccHHHHccccccccccccccccccccccccHHHHHHcccccccccHHHHHccccccHHHHccccccccEEcccccEEEEEEcccccccccccEEEEEEEEEEcccccccccccccccEEEEcccccEEccccccccccccHHHHHcccccccEEEccccccccccccccccccccccccc
cccEEEEcccccccccccccccccccccccccccEEEEEccccccccccccccccccccHcHHHHHHHHHHHHHHHHHHHccccHHHHHcccccccccEEcccccEEEEEEEccccccccccEEEEEEEEEcccccEEEEHHHHcccEEEcccccccHHHEccccccEEEEEEEEccccccccccHHHHHHHHHHHccccEEEEEccccc
msslafsvgncsltklttlktrRLSRHFNKTEVSAIKFssqqqnscppqklhhlnenptpfrrreaigFGLCFGLVDVVLqtqpssaaeaaapspceltvapsglafcdkvvgvgpeavKGQLIKAHYvgklengkvfdssynrgkplifrlgvgevcnqcanksnrvkswslefdnnqlsfetcfPIFIWWLWFYNGSKTIICQLLPYP
msslafsvgncsltklttlktrrlsRHFNKTEVSAIKFssqqqnscppqklHHLNENPTPFRRREAIGFGLCFGLVDVVLQTQPSSAAEAAAPSPCELTVAPSGLAFCDKVVGVGPEAVKGQLIKAhyvgklengkvfdssyNRGKPLIFRLGVGEVCNQCANKSNRVKSWSLEFDNNQLSFETCFPIFIWWLWFYNGSKTIICQLLPYP
MSSLAFSVGNCsltklttlktrrlsrHFNKTEVSAIKFSSQQQNSCPPQKLHHLNENPTPFRRREAIGFGLCFGLVDVVLQTQpssaaeaaapspCELTVAPSGLAFCDKVVGVGPEAVKGQLIKAHYVGKLENGKVFDSSYNRGKPLIFRLGVGEVCNQCANKSNRVKSWSLEFDNNQLSFETCFPIFIWWLWFYNGSKTIICQLLPYP
******SVGNCSLTKLTTLKTR****************************************RREAIGFGLCFGLVDVVLQT*************CELTVAPSGLAFCDKVVGVGPEAVKGQLIKAHYVGKLENGKVFDSSYNRGKPLIFRLGVGEVCNQCANKSNRVKSWSLEFDNNQLSFETCFPIFIWWLWFYNGSKTIICQLLP**
****A*S***********************************************************************************************SGLAFCDKVVGVGPEAVKGQLIKAHYVGKLENGKVFDSSYNRGKPLIFRLGVGEVCNQCANKSNRVKSWSLEFDNNQLSFETCFPIFIWWLWFYNGSKTIICQLLPYP
MSSLAFSVGNCSLTKLTTLKTRRLSRHFNKTEVSA*************QKLHHLNENPTPFRRREAIGFGLCFGLVDVVLQTQP***********CELTVAPSGLAFCDKVVGVGPEAVKGQLIKAHYVGKLENGKVFDSSYNRGKPLIFRLGVGEVCNQCANKSNRVKSWSLEFDNNQLSFETCFPIFIWWLWFYNGSKTIICQLLPYP
**SLAFSVGNCSLTKLTTLKTRRLSRH**KTEVSAIKFSSQQQNSCP*QKLHHLNENPTPFRRREAIGFGLCFGLVDVVLQTQPSSAA*AAAPSPCELTVAPSGLAFCDKVVGVGPEAVKGQLIKAHYVGKLENGKVFDSSYNRGKPLIFRLGVGEVCNQCANKSNRVKSWSLEFDNNQLSFETCFPIFIWWLWFYNGSKTIICQLLPYP
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSLAFSVGNCSLTKLTTLKTRRLSRHFNKTEVSAIKFSSQQQNSCPPQKLHHLNENPTPFRRREAIGFGLCFGLVDVVLQTQPSSAAEAAAPSPCELTVAPSGLAFCDKVVGVGPEAVKGQLIKAHYVGKLENGKVFDSSYNRGKPLIFRLGVGEVCNQCANKSNRVKSWSLEFDNNQLSFETCFPIFIWWLWFYNGSKTIICQLLPYP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query210 2.2.26 [Sep-21-2011]
Q9SCY2208 Peptidyl-prolyl cis-trans yes no 0.690 0.697 0.554 2e-34
P5972445 FKBP-type peptidyl-prolyl N/A no 0.214 1.0 0.844 2e-15
Q9SCY3217 Peptidyl-prolyl cis-trans no no 0.447 0.433 0.411 6e-13
P0C1B0479 FK506-binding protein 4 O no no 0.566 0.248 0.317 2e-11
Q06205392 FK506-binding protein 4 O yes no 0.328 0.176 0.450 2e-09
Q6FKH7437 FK506-binding protein 3 O yes no 0.257 0.123 0.509 9e-09
P38911411 FK506-binding nuclear pro no no 0.357 0.182 0.415 1e-08
Q54NB6364 FK506-binding protein 4 O yes no 0.366 0.211 0.437 1e-08
Q6BP84135 FK506-binding protein 2 O yes no 0.185 0.288 0.615 4e-08
Q4WMV5489 FK506-binding protein 4 O yes no 0.280 0.120 0.414 5e-08
>sp|Q9SCY2|FKB13_ARATH Peptidyl-prolyl cis-trans isomerase FKBP13, chloroplastic OS=Arabidopsis thaliana GN=FKBP13 PE=1 SV=2 Back     alignment and function desciption
 Score =  145 bits (365), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 87/157 (55%), Positives = 101/157 (64%), Gaps = 12/157 (7%)

Query: 1   MSSLAFSVGNCSLTKLTTLKTRRLSRHFNKTEVSAIKFSSQQQNSCPPQKLHHLNENPTP 60
           MSSL FSVG CS           ++   NK E  AI   ++Q+ S  P+      +  + 
Sbjct: 1   MSSLGFSVGTCSPPSEKRKCRFLVNNSLNKAE--AINLRNKQKVSSDPE--LSFAQLSSC 56

Query: 61  FRRREAIGFGLCFGLVDVVLQTQPSSAAEAAAPSPCELTVAPSGLAFCDKVVGVGPEAVK 120
            RR   IGFG   GL+D V     S+ AE  +   CE +V+PSGLAFCDKVVG GPEAVK
Sbjct: 57  GRREAIIGFGFSIGLLDNV-----SALAETTS---CEFSVSPSGLAFCDKVVGYGPEAVK 108

Query: 121 GQLIKAHYVGKLENGKVFDSSYNRGKPLIFRLGVGEV 157
           GQLIKAHYVGKLENGKVFDSSYNRGKPL FR+GVGEV
Sbjct: 109 GQLIKAHYVGKLENGKVFDSSYNRGKPLTFRIGVGEV 145
PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. Responsive of the major PPIase activity in the chloroplast thylakoid lumen. Regulates the accumulation of Rieske protein, an essential component of the photosynthetic electron transport chain.
Arabidopsis thaliana (taxid: 3702)
EC: 5EC: .EC: 2EC: .EC: 1EC: .EC: 8
>sp|P59724|FKBP3_VICFA FKBP-type peptidyl-prolyl cis-trans isomerase, chloroplastic (Fragment) OS=Vicia faba PE=1 SV=1 Back     alignment and function description
>sp|Q9SCY3|FK162_ARATH Peptidyl-prolyl cis-trans isomerase FKBP16-2, chloroplastic OS=Arabidopsis thaliana GN=FKBP16-2 PE=1 SV=1 Back     alignment and function description
>sp|P0C1B0|FKBP4_EMENI FK506-binding protein 4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=fpr4 PE=3 SV=2 Back     alignment and function description
>sp|Q06205|FKBP4_YEAST FK506-binding protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FPR4 PE=1 SV=1 Back     alignment and function description
>sp|Q6FKH7|FKBP3_CANGA FK506-binding protein 3 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=FPR3 PE=3 SV=1 Back     alignment and function description
>sp|P38911|FKBP3_YEAST FK506-binding nuclear protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FPR3 PE=1 SV=2 Back     alignment and function description
>sp|Q54NB6|FKBP4_DICDI FK506-binding protein 4 OS=Dictyostelium discoideum GN=fkbp4 PE=1 SV=1 Back     alignment and function description
>sp|Q6BP84|FKBP2_DEBHA FK506-binding protein 2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=FPR2 PE=3 SV=2 Back     alignment and function description
>sp|Q4WMV5|FKBP4_ASPFU FK506-binding protein 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=fpr4 PE=3 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query210
225423557216 PREDICTED: FKBP-type peptidyl-prolyl cis 0.728 0.708 0.656 1e-47
224053655209 predicted protein [Populus trichocarpa] 0.695 0.698 0.598 2e-42
449433461214 PREDICTED: peptidyl-prolyl cis-trans iso 0.719 0.705 0.605 2e-38
255578523188 fk506-binding protein, putative [Ricinus 0.723 0.808 0.588 3e-38
217075256155 unknown [Medicago truncatula] 0.680 0.922 0.556 2e-35
388505380207 unknown [Medicago truncatula] 0.680 0.690 0.569 2e-35
15242472208 FKBP-type peptidyl-prolyl cis-trans isom 0.690 0.697 0.554 1e-32
21535744208 FK506 binding protein 1 [Arabidopsis tha 0.690 0.697 0.547 2e-32
297794691208 predicted protein [Arabidopsis lyrata su 0.690 0.697 0.547 2e-32
224075375131 predicted protein [Populus trichocarpa] 0.447 0.717 0.711 1e-31
>gi|225423557|ref|XP_002272628.1| PREDICTED: FKBP-type peptidyl-prolyl cis-trans isomerase 3, chloroplastic [Vitis vinifera] gi|297738045|emb|CBI27246.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  194 bits (494), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 103/157 (65%), Positives = 116/157 (73%), Gaps = 4/157 (2%)

Query: 1   MSSLAFSVGNCSLTKLTTLKTRRLSRHFNKTEVSAIKFSSQQQNSCPPQKLHHLNENPTP 60
           MSSLAFS+G C+  KL T   R  + + N    S IK  S  Q S  P+ L  +NEN   
Sbjct: 1   MSSLAFSLGYCTPIKLRTSSGRLFASNVNIVAESRIKILSHHQESSSPRPLQ-INENSPL 59

Query: 61  FRRREAIGFGLCFGLVDVVLQTQPSSAAEAAAPSPCELTVAPSGLAFCDKVVGVGPEAVK 120
           F RREAIGFG CF ++DV LQ QPS AA+ A   PCELTVAPSGLAFCDKVVG GPEAV+
Sbjct: 60  FGRREAIGFGFCFSILDVFLQAQPSVAAQTA---PCELTVAPSGLAFCDKVVGTGPEAVE 116

Query: 121 GQLIKAHYVGKLENGKVFDSSYNRGKPLIFRLGVGEV 157
           GQLIKAHYVGKLE+GKVFDSSY+RGKPL FR+GVGEV
Sbjct: 117 GQLIKAHYVGKLESGKVFDSSYDRGKPLTFRIGVGEV 153

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224053655|ref|XP_002297914.1| predicted protein [Populus trichocarpa] gi|222845172|gb|EEE82719.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449433461|ref|XP_004134516.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP13, chloroplastic-like isoform 1 [Cucumis sativus] Back     alignment and taxonomy information
>gi|255578523|ref|XP_002530125.1| fk506-binding protein, putative [Ricinus communis] gi|223530379|gb|EEF32269.1| fk506-binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|217075256|gb|ACJ85988.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|388505380|gb|AFK40756.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|15242472|ref|NP_199380.1| FKBP-type peptidyl-prolyl cis-trans isomerase 3 [Arabidopsis thaliana] gi|21542069|sp|Q9SCY2.2|FKB13_ARATH RecName: Full=Peptidyl-prolyl cis-trans isomerase FKBP13, chloroplastic; Short=PPIase FKBP13; AltName: Full=FK506-binding protein 1; AltName: Full=FK506-binding protein 13; Short=AtFKBP13; AltName: Full=Immunophilin FKBP13; AltName: Full=Rotamase; Flags: Precursor gi|9758671|dbj|BAB09210.1| unnamed protein product [Arabidopsis thaliana] gi|18086457|gb|AAL57682.1| AT5g45680/MRA19_7 [Arabidopsis thaliana] gi|20147125|gb|AAM10279.1| AT5g45680/MRA19_7 [Arabidopsis thaliana] gi|332007900|gb|AED95283.1| FKBP-type peptidyl-prolyl cis-trans isomerase 3 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|21535744|emb|CAD35362.1| FK506 binding protein 1 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297794691|ref|XP_002865230.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297311065|gb|EFH41489.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|224075375|ref|XP_002304608.1| predicted protein [Populus trichocarpa] gi|222842040|gb|EEE79587.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query210
TAIR|locus:2171958208 FKBP13 "AT5G45680" [Arabidopsi 0.690 0.697 0.528 1.4e-32
UNIPROTKB|Q653Z1218 OSJNBb0065C04.47 "Peptidyl-pro 0.461 0.444 0.542 2.6e-22
UNIPROTKB|A8J3L4194 FKB16-2a "Peptidyl-prolyl cis- 0.414 0.448 0.452 3e-14
UNIPROTKB|Q6Z8J5230 P0431B06.35 "Peptidyl-prolyl c 0.295 0.269 0.483 2.1e-13
TAIR|locus:2135287217 PnsL4 "AT4G39710" [Arabidopsis 0.295 0.285 0.516 2.7e-13
ASPGD|ASPL0000009645479 FKBP5 [Emericella nidulans (ta 0.252 0.110 0.537 5.9e-13
UNIPROTKB|P0C1B0479 fpr4 "FK506-binding protein 4" 0.252 0.110 0.537 5.9e-13
UNIPROTKB|P73037201 ytfC "Peptidyl-prolyl cis-tran 0.285 0.298 0.483 8.2e-12
UNIPROTKB|Q9RTC6152 DR_1839 "Peptidyl-prolyl cis-t 0.214 0.296 0.555 2.4e-11
UNIPROTKB|Q7NMC5161 glr0841 "Peptidyl-prolyl cis-t 0.280 0.366 0.508 2.8e-11
TAIR|locus:2171958 FKBP13 "AT5G45680" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 356 (130.4 bits), Expect = 1.4e-32, P = 1.4e-32
 Identities = 83/157 (52%), Positives = 93/157 (59%)

Query:     1 MSSLAFSVGNCXXXXXXXXXXXXXXXHFNKTEVSAIKFSSQQQNSCPPQKLHHLNENPTP 60
             MSSL FSVG C                 NK E  AI   ++Q+ S  P+      +  + 
Sbjct:     1 MSSLGFSVGTCSPPSEKRKCRFLVNNSLNKAE--AINLRNKQKVSSDPEL--SFAQLSSC 56

Query:    61 FRRREAIGFGLCFGLVDVVLQTQXXXXXXXXXXXXCELTVAPSGLAFCDKVVGVGPEAVK 120
              RR   IGFG   GL+D V                CE +V+PSGLAFCDKVVG GPEAVK
Sbjct:    57 GRREAIIGFGFSIGLLDNV--------SALAETTSCEFSVSPSGLAFCDKVVGYGPEAVK 108

Query:   121 GQLIKAHYVGKLENGKVFDSSYNRGKPLIFRLGVGEV 157
             GQLIKAHYVGKLENGKVFDSSYNRGKPL FR+GVGEV
Sbjct:   109 GQLIKAHYVGKLENGKVFDSSYNRGKPLTFRIGVGEV 145
GO:0003755 "peptidyl-prolyl cis-trans isomerase activity" evidence=ISS;IDA
GO:0005528 "FK506 binding" evidence=ISS;IBA
GO:0006457 "protein folding" evidence=IEA
GO:0009507 "chloroplast" evidence=ISM;IDA
GO:0009543 "chloroplast thylakoid lumen" evidence=ISS;IDA
GO:0016020 "membrane" evidence=IBA
GO:0018208 "peptidyl-proline modification" evidence=IBA
GO:0031977 "thylakoid lumen" evidence=IDA
GO:0005515 "protein binding" evidence=IPI
GO:0006636 "unsaturated fatty acid biosynthetic process" evidence=RCA
GO:0010103 "stomatal complex morphogenesis" evidence=RCA
GO:0015995 "chlorophyll biosynthetic process" evidence=RCA
GO:0016117 "carotenoid biosynthetic process" evidence=RCA
GO:0019288 "isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway" evidence=RCA
UNIPROTKB|Q653Z1 OSJNBb0065C04.47 "Peptidyl-prolyl cis-trans isomerase" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|A8J3L4 FKB16-2a "Peptidyl-prolyl cis-trans isomerase" [Chlamydomonas reinhardtii (taxid:3055)] Back     alignment and assigned GO terms
UNIPROTKB|Q6Z8J5 P0431B06.35 "Peptidyl-prolyl cis-trans isomerase" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2135287 PnsL4 "AT4G39710" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ASPGD|ASPL0000009645 FKBP5 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
UNIPROTKB|P0C1B0 fpr4 "FK506-binding protein 4" [Aspergillus nidulans FGSC A4 (taxid:227321)] Back     alignment and assigned GO terms
UNIPROTKB|P73037 ytfC "Peptidyl-prolyl cis-trans isomerase" [Synechocystis sp. PCC 6803 substr. Kazusa (taxid:1111708)] Back     alignment and assigned GO terms
UNIPROTKB|Q9RTC6 DR_1839 "Peptidyl-prolyl cis-trans isomerase" [Deinococcus radiodurans R1 (taxid:243230)] Back     alignment and assigned GO terms
UNIPROTKB|Q7NMC5 glr0841 "Peptidyl-prolyl cis-trans isomerase" [Gloeobacter violaceus PCC 7421 (taxid:251221)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9SCY2FKB13_ARATH5, ., 2, ., 1, ., 80.55410.69040.6971yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer5.2.10.921
4th Layer5.2.1.80.914

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00030084001
RecName- Full=Peptidyl-prolyl cis-trans isomerase; EC=5.2.1.8; (216 aa)
(Vitis vinifera)
Predicted Functional Partners:
GSVIVG00006210001
RecName- Full=Peptidyl-prolyl cis-trans isomerase; EC=5.2.1.8; (257 aa)
  ••    0.451

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query210
COG0545205 COG0545, FkpA, FKBP-type peptidyl-prolyl cis-trans 5e-18
pfam0025494 pfam00254, FKBP_C, FKBP-type peptidyl-prolyl cis-t 1e-14
COG1047174 COG1047, SlpA, FKBP-type peptidyl-prolyl cis-trans 4e-08
PRK11570206 PRK11570, PRK11570, peptidyl-prolyl cis-trans isom 7e-06
PRK15095156 PRK15095, PRK15095, FKBP-type peptidyl-prolyl cis- 2e-05
PRK10902269 PRK10902, PRK10902, FKBP-type peptidyl-prolyl cis- 2e-05
>gnl|CDD|223619 COG0545, FkpA, FKBP-type peptidyl-prolyl cis-trans isomerases 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
 Score = 78.2 bits (193), Expect = 5e-18
 Identities = 25/55 (45%), Positives = 30/55 (54%)

Query: 99  TVAPSGLAFCDKVVGVGPEAVKGQLIKAHYVGKLENGKVFDSSYNRGKPLIFRLG 153
              PSGL +     G G    KG  +  HY G L +G VFDSSY+RG+P  F LG
Sbjct: 97  KTLPSGLQYKVLKAGDGAAPKKGDTVTVHYTGTLIDGTVFDSSYDRGQPAEFPLG 151

Length = 205
>gnl|CDD|215821 pfam00254, FKBP_C, FKBP-type peptidyl-prolyl cis-trans isomerase Back     alignment and domain information
>gnl|CDD|223976 COG1047, SlpA, FKBP-type peptidyl-prolyl cis-trans isomerases 2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|183207 PRK11570, PRK11570, peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>gnl|CDD|237908 PRK15095, PRK15095, FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>gnl|CDD|236791 PRK10902, PRK10902, FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 210
COG0545205 FkpA FKBP-type peptidyl-prolyl cis-trans isomerase 99.87
KOG0544108 consensus FKBP-type peptidyl-prolyl cis-trans isom 99.83
KOG0552226 consensus FKBP-type peptidyl-prolyl cis-trans isom 99.77
PRK11570206 peptidyl-prolyl cis-trans isomerase; Provisional 99.74
KOG0549188 consensus FKBP-type peptidyl-prolyl cis-trans isom 99.73
TIGR03516177 ppisom_GldI peptidyl-prolyl isomerase, gliding mot 99.66
PRK10902269 FKBP-type peptidyl-prolyl cis-trans isomerase; Pro 99.63
PRK15095156 FKBP-type peptidyl-prolyl cis-trans isomerase; Pro 99.45
PF0025494 FKBP_C: FKBP-type peptidyl-prolyl cis-trans isomer 99.43
COG1047174 SlpA FKBP-type peptidyl-prolyl cis-trans isomerase 99.35
PRK10737 196 FKBP-type peptidyl-prolyl cis-trans isomerase; Pro 99.17
KOG0543 397 consensus FKBP-type peptidyl-prolyl cis-trans isom 98.74
KOG0543 397 consensus FKBP-type peptidyl-prolyl cis-trans isom 98.7
TIGR00115 408 tig trigger factor. Trigger factor is a ribosome-a 97.37
PRK01490 435 tig trigger factor; Provisional 97.25
COG0544 441 Tig FKBP-type peptidyl-prolyl cis-trans isomerase 97.24
KOG0545 329 consensus Aryl-hydrocarbon receptor-interacting pr 96.35
KOG0544108 consensus FKBP-type peptidyl-prolyl cis-trans isom 88.41
>COG0545 FkpA FKBP-type peptidyl-prolyl cis-trans isomerases 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=99.87  E-value=3.1e-22  Score=168.42  Aligned_cols=94  Identities=31%  Similarity=0.458  Sum_probs=86.4

Q ss_pred             CCCCCCeeeCCCCcEEEEEEcCCCcCCCCCCEEEEEEEEEeCCCcEEecccCCCCCEEEEecCCcccccccccccccchh
Q 028345           92 APSPCELTVAPSGLAFCDKVVGVGPEAVKGQLIKAHYVGKLENGKVFDSSYNRGKPLIFRLGVGEVCNQCANKSNRVKSW  171 (210)
Q Consensus        92 ~~~~~~~~~~~sGl~~~~l~~G~G~~p~~Gd~V~vhY~g~l~dG~vFDSS~~~g~P~~F~lG~g~VIpGlee~~~~~kG~  171 (210)
                      +...+.++++++||+|++++.|+|+.|+.+|+|.|||+|+|.||++||||+++|+|+.|.+|  +||+          ||
T Consensus        90 ~~k~~~v~~~~sgl~y~~~~~G~G~~~~~~~~V~vhY~G~l~~G~vFDsS~~rg~p~~f~l~--~vI~----------Gw  157 (205)
T COG0545          90 NAKEKGVKTLPSGLQYKVLKAGDGAAPKKGDTVTVHYTGTLIDGTVFDSSYDRGQPAEFPLG--GVIP----------GW  157 (205)
T ss_pred             hcccCCceECCCCcEEEEEeccCCCCCCCCCEEEEEEEEecCCCCccccccccCCCceeecC--Ceee----------hH
Confidence            34667799999999999999999999999999999999999999999999999999999998  8999          88


Q ss_pred             HHhhhcCceee---EEecCcccchhhhcC
Q 028345          172 SLEFDNNQLSF---ETCFPIFIWWLWFYN  197 (210)
Q Consensus       172 ~~g~~~m~vG~---~~i~pe~ay~~~~~~  197 (210)
                      ++||.+|++|+   ++|||++||..=.-.
T Consensus       158 ~egl~~M~vG~k~~l~IP~~laYG~~g~~  186 (205)
T COG0545         158 DEGLQGMKVGGKRKLTIPPELAYGERGVP  186 (205)
T ss_pred             HHHHhhCCCCceEEEEeCchhccCcCCCC
Confidence            99999999996   789999999876533

>KOG0544 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0552 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11570 peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>KOG0549 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03516 ppisom_GldI peptidyl-prolyl isomerase, gliding motility-associated Back     alignment and domain information
>PRK10902 FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>PRK15095 FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>PF00254 FKBP_C: FKBP-type peptidyl-prolyl cis-trans isomerase; InterPro: IPR001179 Synonym(s): Peptidylprolyl cis-trans isomerase FKBP-type peptidylprolyl isomerases (5 Back     alignment and domain information
>COG1047 SlpA FKBP-type peptidyl-prolyl cis-trans isomerases 2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10737 FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00115 tig trigger factor Back     alignment and domain information
>PRK01490 tig trigger factor; Provisional Back     alignment and domain information
>COG0544 Tig FKBP-type peptidyl-prolyl cis-trans isomerase (trigger factor) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0544 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query210
1u79_A129 Crystal Structure Of Atfkbp13 Length = 129 3e-27
3vaw_A209 Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C 7e-07
4dz2_A113 Crystal Structure Of A Peptidyl-Prolyl Cis-Trans Is 8e-07
3uf8_A209 Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C 9e-07
4dz3_A113 Crystal Structure Of A Peptidyl-Prolyl Cis-Trans Is 9e-07
4ggq_C209 Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C 9e-07
1kt0_A 457 Structure Of The Large Fkbp-like Protein, Fkbp51, I 1e-06
3uqa_A209 Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C 2e-06
2ke0_A117 Solution Structure Of Peptidyl-Prolyl Cis-Trans Iso 2e-06
2y78_A133 Crystal Structure Of Bpss1823, A Mip-Like Chaperone 2e-06
3o5e_A144 Fk1 Domain Of Fkbp51, Crystal Form Vi Length = 144 2e-06
4drh_A144 Co-crystal Structure Of The Ppiase Domain Of Fkbp51 2e-06
3o5d_A 264 Crystal Structure Of A Fragment Of Fkbp51 Comprisin 2e-06
3uqi_A108 Crystallographic Structure Of Fkbp12 From Aedes Aeg 3e-06
3o5l_A128 Fk1 Domain Mutant A19t Of Fkbp51, Crystal Form I Le 3e-06
1kt1_A 457 Structure Of The Large Fkbp-Like Protein, Fkbp51, I 3e-06
3o5g_A128 Fk1 Domain Of Fkbp51, Crystal Form I Length = 128 3e-06
3uqb_A209 Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C 9e-06
2lgo_A130 Solution Nmr Structure Of A Fkbp-Type Peptidyl-Prol 1e-05
1c9h_A107 Crystal Structure Of Fkbp12.6 In Complex With Rapam 1e-05
1r9h_A135 Structural Genomics Of C.Elegans: Fkbp-Type Peptidy 3e-05
1yat_A113 Improved Calcineurin Inhibition By Yeast Fkbp12-Dru 3e-05
2pbc_A102 Fk506-Binding Protein 2 Length = 102 3e-05
2ki3_A126 Structural And Biochemical Characterization Of Fk50 4e-05
1jvw_A167 Trypanosoma Cruzi Macrophage Infectivity Potentiato 5e-05
2vn1_A129 Crystal Structure Of The Fk506-Binding Domain Of Pl 5e-05
2ofn_A135 Solution Structure Of Fk506-Binding Domain (Fkbd)of 5e-05
2ppo_A107 Crystal Structure Of E60a Mutant Of Fkbp12 Length = 9e-05
1fkb_A107 Atomic Structure Of The Rapamycin Human Immunophili 9e-05
3h9r_B109 Crystal Structure Of The Kinase Domain Of Type I Ac 1e-04
2ppp_A107 Crystal Structure Of E60q Mutant Of Fkbp12 Length = 1e-04
2fap_A107 The Structure Of The Immunophilin-Immunosuppressant 1e-04
2dg4_A107 Fk506-Binding Protein Mutant Wf59 Complexed With Ra 1e-04
2dg9_A107 Fk506-Binding Protein Mutant Wl59 Complexed With Ra 1e-04
1fkk_A107 Atomic Structure Of Fkbp12, An Immunophilin Binding 2e-04
1tco_C107 Ternary Complex Of A Calcineurin A Fragment, Calcin 2e-04
1bkf_A107 Fk506 Binding Protein Fkbp Mutant R42kH87V COMPLEX 3e-04
1eym_A107 Fk506 Binding Protein Mutant, Homodimeric Complex L 4e-04
1bl4_A107 Fkbp Mutant F36v Complexed With Remodeled Synthetic 6e-04
>pdb|1U79|A Chain A, Crystal Structure Of Atfkbp13 Length = 129 Back     alignment and structure 
Iteration: 1

 Score =  118 bits (295), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 56/62 (90%), Positives = 59/62 (95%)
Query: 96  CELTVAPSGLAFCDKVVGVGPEAVKGQLIKAHYVGKLENGKVFDSSYNRGKPLIFRLGVG 155
           CE +V+PSGLAFCDKVVG GPEAVKGQLIKAHYVGKLENGKVFDSSYNRGKPL FR+GVG
Sbjct: 5   CEFSVSPSGLAFCDKVVGYGPEAVKGQLIKAHYVGKLENGKVFDSSYNRGKPLTFRIGVG 64
Query: 156 EV 157
           EV
Sbjct: 65  EV 66
>pdb|3VAW|A Chain A, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase With Surface Mutation V3i From Burkholderia Pseudomallei Complexed With Fk506 Length = 209 Back     alignment and structure
>pdb|4DZ2|A Chain A, Crystal Structure Of A Peptidyl-Prolyl Cis-Trans Isomerase With Surface Mutation R92g From Burkholderia Pseudomallei Complexed With Fk506 Length = 113 Back     alignment and structure
>pdb|3UF8|A Chain A, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase With A G95a Surface Mutation From Burkholderia Pseudomallei Complexed With Fk506 Length = 209 Back     alignment and structure
>pdb|4DZ3|A Chain A, Crystal Structure Of A Peptidyl-Prolyl Cis-Trans Isomerase With Surface Mutation M61h From Burkholderia Pseudomallei Complexed With Fk506 Length = 113 Back     alignment and structure
>pdb|4GGQ|C Chain C, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase From Burkholderia Pseudomallei Complexed With Cj40 Length = 209 Back     alignment and structure
>pdb|1KT0|A Chain A, Structure Of The Large Fkbp-like Protein, Fkbp51, Involved In Steroid Receptor Complexes Length = 457 Back     alignment and structure
>pdb|3UQA|A Chain A, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase With Surface Mutation A54e From Burkholderia Pseudomallei Complexed With Fk506 Length = 209 Back     alignment and structure
>pdb|2KE0|A Chain A, Solution Structure Of Peptidyl-Prolyl Cis-Trans Isomerase From Burkholderia Pseudomallei Length = 117 Back     alignment and structure
>pdb|2Y78|A Chain A, Crystal Structure Of Bpss1823, A Mip-Like Chaperone From Burkholderia Pseudomallei Length = 133 Back     alignment and structure
>pdb|3O5E|A Chain A, Fk1 Domain Of Fkbp51, Crystal Form Vi Length = 144 Back     alignment and structure
>pdb|4DRH|A Chain A, Co-crystal Structure Of The Ppiase Domain Of Fkbp51, Rapamycin And The Frb Fragment Of Mtor At Low Ph Length = 144 Back     alignment and structure
>pdb|3O5D|A Chain A, Crystal Structure Of A Fragment Of Fkbp51 Comprising The Fk1 And Fk2 Domains Length = 264 Back     alignment and structure
>pdb|3UQI|A Chain A, Crystallographic Structure Of Fkbp12 From Aedes Aegypti Length = 108 Back     alignment and structure
>pdb|3O5L|A Chain A, Fk1 Domain Mutant A19t Of Fkbp51, Crystal Form I Length = 128 Back     alignment and structure
>pdb|1KT1|A Chain A, Structure Of The Large Fkbp-Like Protein, Fkbp51, Involved In Steroid Receptor Complexes Length = 457 Back     alignment and structure
>pdb|3O5G|A Chain A, Fk1 Domain Of Fkbp51, Crystal Form I Length = 128 Back     alignment and structure
>pdb|3UQB|A Chain A, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase With Surface Mutation D44g From Burkholderia Pseudomallei Complexed With Fk506 Length = 209 Back     alignment and structure
>pdb|2LGO|A Chain A, Solution Nmr Structure Of A Fkbp-Type Peptidyl-Prolyl Cis-Trans Isomerase From Giardia Lamblia, Seattle Structural Genomics Center For Infectious Disease Target Gilaa.00840.A Length = 130 Back     alignment and structure
>pdb|1C9H|A Chain A, Crystal Structure Of Fkbp12.6 In Complex With Rapamycin Length = 107 Back     alignment and structure
>pdb|1R9H|A Chain A, Structural Genomics Of C.Elegans: Fkbp-Type Peptidylprolyl Isomerase Length = 135 Back     alignment and structure
>pdb|1YAT|A Chain A, Improved Calcineurin Inhibition By Yeast Fkbp12-Drug Complexes. Crystallographic And Functional Analysis Length = 113 Back     alignment and structure
>pdb|2PBC|A Chain A, Fk506-Binding Protein 2 Length = 102 Back     alignment and structure
>pdb|2KI3|A Chain A, Structural And Biochemical Characterization Of Fk506 Binding Domain From Plasmodium Vivax Length = 126 Back     alignment and structure
>pdb|1JVW|A Chain A, Trypanosoma Cruzi Macrophage Infectivity Potentiator (Tcmip) Length = 167 Back     alignment and structure
>pdb|2VN1|A Chain A, Crystal Structure Of The Fk506-Binding Domain Of Plasmodium Falciparum Fkbp35 In Complex With Fk506 Length = 129 Back     alignment and structure
>pdb|2OFN|A Chain A, Solution Structure Of Fk506-Binding Domain (Fkbd)of Fkbp35 From Plasmodium Falciparum Length = 135 Back     alignment and structure
>pdb|2PPO|A Chain A, Crystal Structure Of E60a Mutant Of Fkbp12 Length = 107 Back     alignment and structure
>pdb|1FKB|A Chain A, Atomic Structure Of The Rapamycin Human Immunophilin Fkbp- 12 Complex Length = 107 Back     alignment and structure
>pdb|3H9R|B Chain B, Crystal Structure Of The Kinase Domain Of Type I Activin Receptor (Acvr1) In Complex With Fkbp12 And Dorsomorphin Length = 109 Back     alignment and structure
>pdb|2PPP|A Chain A, Crystal Structure Of E60q Mutant Of Fkbp12 Length = 107 Back     alignment and structure
>pdb|2FAP|A Chain A, The Structure Of The Immunophilin-Immunosuppressant Fkbp12- (C16)-Ethoxy Rapamycin Complex Interacting With Huma Length = 107 Back     alignment and structure
>pdb|2DG4|A Chain A, Fk506-Binding Protein Mutant Wf59 Complexed With Rapamycin Length = 107 Back     alignment and structure
>pdb|2DG9|A Chain A, Fk506-Binding Protein Mutant Wl59 Complexed With Rapamycin Length = 107 Back     alignment and structure
>pdb|1FKK|A Chain A, Atomic Structure Of Fkbp12, An Immunophilin Binding Protein Length = 107 Back     alignment and structure
>pdb|1TCO|C Chain C, Ternary Complex Of A Calcineurin A Fragment, Calcineurin B, Fkbp12 And The Immunosuppressant Drug Fk506 (tacrolimus) Length = 107 Back     alignment and structure
>pdb|1BKF|A Chain A, Fk506 Binding Protein Fkbp Mutant R42kH87V COMPLEX WITH Immunosuppressant Fk506 Length = 107 Back     alignment and structure
>pdb|1EYM|A Chain A, Fk506 Binding Protein Mutant, Homodimeric Complex Length = 107 Back     alignment and structure
>pdb|1BL4|A Chain A, Fkbp Mutant F36v Complexed With Remodeled Synthetic Ligand Length = 107 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query210
1u79_A129 FKBP-type peptidyl-prolyl CIS-trans isomerase 3; T 2e-28
3uf8_A209 Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- 1e-23
2y78_A133 Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, 4e-22
3o5q_A128 Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 4e-21
1yat_A113 FK506 binding protein; HET: FK5; 2.50A {Saccharomy 5e-21
2pbc_A102 FK506-binding protein 2; endoplasmic reticulum, is 6e-21
3o5e_A144 Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 8e-21
2lgo_A130 FKBP; infectious disease, isomerase, giardiasis, s 1e-20
2ppn_A107 FK506-binding protein 1A; high resolution protein 1e-19
3b7x_A134 FK506-binding protein 6; isomerase, repeat, rotama 2e-19
1r9h_A135 FKB-6, FK506 binding protein family; structural ge 2e-19
2vn1_A129 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR 2e-18
2f4e_A180 ATFKBP42; FKBP-like, alpha-beta, signaling protein 9e-18
4dip_A125 Peptidyl-prolyl CIS-trans isomerase FKBP14; struct 2e-17
1q1c_A 280 FK506-binding protein 4; rotamase, TPR repeat, nuc 2e-17
1q1c_A280 FK506-binding protein 4; rotamase, TPR repeat, nuc 9e-05
3jxv_A 356 70 kDa peptidyl-prolyl isomerase; FKBP- binding do 2e-17
3jxv_A356 70 kDa peptidyl-prolyl isomerase; FKBP- binding do 8e-12
3jxv_A 356 70 kDa peptidyl-prolyl isomerase; FKBP- binding do 3e-08
3kz7_A119 FK506-binding protein 3; FKPB ppiase rapamycin, is 1e-16
1kt0_A 457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 9e-15
1kt0_A 457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 3e-04
1jvw_A167 Macrophage infectivity potentiator; chagas disease 2e-14
1q6h_A224 FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; 6e-14
1fd9_A213 Protein (macrophage infectivity potentiator prote; 7e-14
2jwx_A157 FKBP38NTD, FK506-binding protein 8 variant; apopto 1e-12
2awg_A118 38 kDa FK-506 binding protein; FKBP-type, ppiase, 4e-12
2d9f_A135 FK506-binding protein 8 variant; FKBP, rapamycin, 2e-11
3oe2_A219 Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, 1e-10
4dt4_A169 FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; 2e-09
2if4_A 338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 1e-08
2k8i_A171 SLYD, peptidyl-prolyl CIS-trans isomerase; ppiase, 6e-07
1ix5_A151 FKBP; ppiase, isomerase; NMR {Methanothermococcust 2e-06
2kfw_A 196 FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD 3e-06
2kr7_A151 FKBP-type peptidyl-prolyl CIS-trans isomerase SLY; 2e-05
>1u79_A FKBP-type peptidyl-prolyl CIS-trans isomerase 3; TFKBP13, FK-506 binding protein; 1.85A {Arabidopsis thaliana} SCOP: d.26.1.1 PDB: 1y0o_A Length = 129 Back     alignment and structure
 Score =  102 bits (257), Expect = 2e-28
 Identities = 56/63 (88%), Positives = 59/63 (93%)

Query: 95  PCELTVAPSGLAFCDKVVGVGPEAVKGQLIKAHYVGKLENGKVFDSSYNRGKPLIFRLGV 154
            CE +V+PSGLAFCDKVVG GPEAVKGQLIKAHYVGKLENGKVFDSSYNRGKPL FR+GV
Sbjct: 4   SCEFSVSPSGLAFCDKVVGYGPEAVKGQLIKAHYVGKLENGKVFDSSYNRGKPLTFRIGV 63

Query: 155 GEV 157
           GEV
Sbjct: 64  GEV 66
>3uf8_A Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- isomerase; ssgcid, seattle structural genomics center for in disease; HET: FK5; 1.50A {Burkholderia pseudomallei} PDB: 4ggq_C* 3vaw_A* 3uqa_A* 4g50_A* 4fn2_A* 3uqb_A* 1euv_B 3v60_A 3v61_A 3v62_A* Length = 209 Back     alignment and structure
>2y78_A Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, virulence; HET: SO4 GOL; 0.91A {Burkholderia pseudomallei} PDB: 2ke0_A 2ko7_A* 2l2s_A* 4dz2_A* 4dz3_A* Length = 133 Back     alignment and structure
>3o5q_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 0.96A {Homo sapiens} PDB: 3o5m_A 3o5l_A 3o5o_A 3o5p_A 3o5r_A* 4drq_A* 3o5j_A 3o5g_A 3o5i_A 3o5k_A Length = 128 Back     alignment and structure
>1yat_A FK506 binding protein; HET: FK5; 2.50A {Saccharomyces cerevisiae} SCOP: d.26.1.1 Length = 113 Back     alignment and structure
>2pbc_A FK506-binding protein 2; endoplasmic reticulum, isomerase, polymorphism, rotamase, structural genomics, structural genomics consortium, SGC; 1.80A {Homo sapiens} Length = 102 Back     alignment and structure
>3o5e_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 1.60A {Homo sapiens} PDB: 3o5f_A Length = 144 Back     alignment and structure
>2lgo_A FKBP; infectious disease, isomerase, giardiasis, ssgcid, structura genomics, seattle structural genomics center for infectious; NMR {Giardia lamblia} Length = 130 Back     alignment and structure
>2ppn_A FK506-binding protein 1A; high resolution protein structure, isomerase; 0.92A {Homo sapiens} SCOP: d.26.1.1 PDB: 1b6c_A 1a7x_A 1d7h_A 1d7i_A 1d7j_A* 1f40_A* 1fap_A* 1d6o_A* 1fkd_A* 1fkf_A* 1fkg_A* 1fkh_A* 1fki_A* 1fkj_A* 1fkr_A 1fks_A 1fkt_A 1j4h_A* 1j4i_A* 1j4r_A* ... Length = 107 Back     alignment and structure
>3b7x_A FK506-binding protein 6; isomerase, repeat, rotamase, TPR repeat, williams-beuren syndrome, structural genomics consortium, SGC; 2.10A {Homo sapiens} Length = 134 Back     alignment and structure
>1r9h_A FKB-6, FK506 binding protein family; structural genomics, peptidylprolyl isomerase, PSI, protein structure initiative; 1.80A {Caenorhabditis elegans} SCOP: d.26.1.1 Length = 135 Back     alignment and structure
>2vn1_A 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR repeat; HET: FK5; 2.35A {Plasmodium falciparum} PDB: 2ofn_A 2ki3_A 3ihz_A* 3ni6_A 3pa7_A Length = 129 Back     alignment and structure
>2f4e_A ATFKBP42; FKBP-like, alpha-beta, signaling protein; 2.32A {Arabidopsis thaliana} Length = 180 Back     alignment and structure
>4dip_A Peptidyl-prolyl CIS-trans isomerase FKBP14; structural genomics, structural genomics consortium, SGC, PE prolyl CIS-trans isomerase; 1.82A {Homo sapiens} Length = 125 Back     alignment and structure
>1q1c_A FK506-binding protein 4; rotamase, TPR repeat, nuclear protein, phosphorylation, isomerase; 1.90A {Homo sapiens} SCOP: d.26.1.1 d.26.1.1 PDB: 1n1a_A 1rot_A 1rou_A Length = 280 Back     alignment and structure
>1q1c_A FK506-binding protein 4; rotamase, TPR repeat, nuclear protein, phosphorylation, isomerase; 1.90A {Homo sapiens} SCOP: d.26.1.1 d.26.1.1 PDB: 1n1a_A 1rot_A 1rou_A Length = 280 Back     alignment and structure
>3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Length = 356 Back     alignment and structure
>3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Length = 356 Back     alignment and structure
>3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Length = 356 Back     alignment and structure
>3kz7_A FK506-binding protein 3; FKPB ppiase rapamycin, isomerase, nucleus, phosphoprotein, R isomerase-inhibitor complex; HET: RAP; 1.95A {Mus musculus} PDB: 1pbk_A* Length = 119 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Length = 457 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Length = 457 Back     alignment and structure
>1jvw_A Macrophage infectivity potentiator; chagas disease, X-RAY rotamase, isomeras; 1.70A {Trypanosoma cruzi} SCOP: d.26.1.1 Length = 167 Back     alignment and structure
>1q6h_A FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; chaperone, peptidyl-prolyl isomerase, heat shock protein, FK family; HET: MSE; 1.97A {Escherichia coli} SCOP: d.26.1.1 PDB: 1q6i_A* 1q6u_A Length = 224 Back     alignment and structure
>1fd9_A Protein (macrophage infectivity potentiator prote; FKBP domain, long alpha helix, dimerisation VIA helical INTE isomerase; 2.41A {Legionella pneumophila} SCOP: d.26.1.1 PDB: 2uz5_A 2vcd_A* Length = 213 Back     alignment and structure
>2jwx_A FKBP38NTD, FK506-binding protein 8 variant; apoptosis, beta barrel, central helix, with flexible N-terminal extension, isomerase; NMR {Homo sapiens} Length = 157 Back     alignment and structure
>2awg_A 38 kDa FK-506 binding protein; FKBP-type, ppiase, BCL-2 inhibitor, SHH signalling antagonist, structural genomics consortium, SGC; 1.60A {Homo sapiens} PDB: 2f2d_A 3ey6_A Length = 118 Back     alignment and structure
>2d9f_A FK506-binding protein 8 variant; FKBP, rapamycin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 135 Back     alignment and structure
>3oe2_A Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, FK506; HET: TAR SRT; 1.60A {Pseudomonas syringae PV} Length = 219 Back     alignment and structure
>4dt4_A FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; FKBP domain, IF domain, chaperone, peptidyl-prolyl isomerase isomerase; 1.35A {Escherichia coli} Length = 169 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Length = 338 Back     alignment and structure
>2k8i_A SLYD, peptidyl-prolyl CIS-trans isomerase; ppiase, chaperone, rotamase; NMR {Escherichia coli} Length = 171 Back     alignment and structure
>1ix5_A FKBP; ppiase, isomerase; NMR {Methanothermococcusthermolithotrophicus} SCOP: d.26.1.1 Length = 151 Back     alignment and structure
>2kfw_A FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD; protein, cobalt, copper, cytoplasm, metal- binding, nickel, rotamase, zinc; NMR {Escherichia coli} Length = 196 Back     alignment and structure
>2kr7_A FKBP-type peptidyl-prolyl CIS-trans isomerase SLY; protein, rotamase; NMR {Helicobacter pylori} Length = 151 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query210
2lkn_A165 AH receptor-interacting protein; FKBP-type domain, 99.83
2y78_A133 Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, 99.79
1u79_A129 FKBP-type peptidyl-prolyl CIS-trans isomerase 3; T 99.79
1yat_A113 FK506 binding protein; HET: FK5; 2.50A {Saccharomy 99.78
2lgo_A130 FKBP; infectious disease, isomerase, giardiasis, s 99.76
3kz7_A119 FK506-binding protein 3; FKPB ppiase rapamycin, is 99.75
2f4e_A180 ATFKBP42; FKBP-like, alpha-beta, signaling protein 99.75
3uf8_A209 Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- 99.75
3o5e_A144 Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 99.74
3o5q_A128 Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 99.74
1jvw_A167 Macrophage infectivity potentiator; chagas disease 99.73
2ppn_A107 FK506-binding protein 1A; high resolution protein 99.73
3b7x_A134 FK506-binding protein 6; isomerase, repeat, rotama 99.73
3oe2_A219 Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, 99.73
1fd9_A213 Protein (macrophage infectivity potentiator prote; 99.72
4dip_A125 Peptidyl-prolyl CIS-trans isomerase FKBP14; struct 99.72
1r9h_A135 FKB-6, FK506 binding protein family; structural ge 99.71
1q6h_A224 FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; 99.71
2vn1_A129 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR 99.71
2jwx_A157 FKBP38NTD, FK506-binding protein 8 variant; apopto 99.68
2awg_A118 38 kDa FK-506 binding protein; FKBP-type, ppiase, 99.66
2if4_A 338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 99.65
2d9f_A135 FK506-binding protein 8 variant; FKBP, rapamycin, 99.64
1q1c_A 280 FK506-binding protein 4; rotamase, TPR repeat, nuc 99.62
1kt0_A 457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.59
2pbc_A102 FK506-binding protein 2; endoplasmic reticulum, is 99.56
3jxv_A 356 70 kDa peptidyl-prolyl isomerase; FKBP- binding do 99.56
3jxv_A356 70 kDa peptidyl-prolyl isomerase; FKBP- binding do 99.5
4dt4_A169 FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; 99.47
3pr9_A157 FKBP-type peptidyl-prolyl CIS-trans isomerase; FKB 99.43
1ix5_A151 FKBP; ppiase, isomerase; NMR {Methanothermococcust 99.38
3prb_A 231 FKBP-type peptidyl-prolyl CIS-trans isomerase; cha 99.36
2kr7_A151 FKBP-type peptidyl-prolyl CIS-trans isomerase SLY; 99.36
2kfw_A 196 FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD 99.33
2k8i_A171 SLYD, peptidyl-prolyl CIS-trans isomerase; ppiase, 99.32
1p5q_A 336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.27
1q1c_A280 FK506-binding protein 4; rotamase, TPR repeat, nuc 99.27
1hxv_A113 Trigger factor; FKBP fold, ppiase, chaperone; NMR 99.23
3cgm_A158 SLYD, peptidyl-prolyl CIS-trans isomerase; chapero 99.13
1kt0_A 457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 98.61
1w26_A 432 Trigger factor, TF; chaperone, protein folding, ri 98.55
1t11_A 392 Trigger factor, TF; helix-turn-helix, four-helix-b 98.35
3gty_X 433 Trigger factor, TF; chaperone-client complex, cell 94.65
>2lkn_A AH receptor-interacting protein; FKBP-type domain, immunophilin homolog, protein binding; NMR {Homo sapiens} Back     alignment and structure
Probab=99.83  E-value=3e-21  Score=157.72  Aligned_cols=84  Identities=20%  Similarity=0.189  Sum_probs=75.6

Q ss_pred             eeCCCCcEEEEEEcCCCcCC--CCCCEEEEEEEEEeC--CCcEEecccCCCCCEEEEecCCcccccccccccccchhHHh
Q 028345           99 TVAPSGLAFCDKVVGVGPEA--VKGQLIKAHYVGKLE--NGKVFDSSYNRGKPLIFRLGVGEVCNQCANKSNRVKSWSLE  174 (210)
Q Consensus        99 ~~~~sGl~~~~l~~G~G~~p--~~Gd~V~vhY~g~l~--dG~vFDSS~~~g~P~~F~lG~g~VIpGlee~~~~~kG~~~g  174 (210)
                      +++++||+|+++++|+|..|  ..||+|.|||+|++.  ||++||||+++++|+.|.+|.++||+          ||++|
T Consensus         6 ~~~~~Gv~~~vl~~G~G~~p~~~~G~~V~vhY~g~l~d~~G~~FDsS~~rg~P~~f~lG~g~vI~----------Gwd~g   75 (165)
T 2lkn_A            6 RLREDGIQKRVIQEGRGELPDFQDGTKATFHYRTLHSDDEGTVLDDSRARGKPMELIIGKKFKLP----------VWETI   75 (165)
T ss_dssp             HHHTTSCCCCEEECCSSCCCCCCTTCEEEEECEEECSSSSCCEEEESTTTTCCEEEESSSSCSCS----------HHHHH
T ss_pred             cccCCCeEEEEEECCcCCCCCCCCCCEEEEEEEEEEeCCCccEEEecccCCCCEEEEecCCCccH----------HHHHH
Confidence            34679999999999999764  579999999999996  49999999999999999999999999          78888


Q ss_pred             hhcCceee---EEecCcccch
Q 028345          175 FDNNQLSF---ETCFPIFIWW  192 (210)
Q Consensus       175 ~~~m~vG~---~~i~pe~ay~  192 (210)
                      +.+|++|+   ++|+|++||.
T Consensus        76 l~~M~~Ge~~~~~ipp~laYG   96 (165)
T 2lkn_A           76 VCTMREGEIAQFLCDIKHVVL   96 (165)
T ss_dssp             HTTCCTTCEEEEECCHHHHSS
T ss_pred             HhcCccCceEEEEECHHHhcC
Confidence            88888774   7899999997
>2y78_A Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, virulence; HET: SO4 GOL; 0.91A {Burkholderia pseudomallei} PDB: 2ke0_A 2ko7_A* 2l2s_A* 4dz2_A* 4dz3_A* Back     alignment and structure
>1u79_A FKBP-type peptidyl-prolyl CIS-trans isomerase 3; TFKBP13, FK-506 binding protein; 1.85A {Arabidopsis thaliana} SCOP: d.26.1.1 PDB: 1y0o_A Back     alignment and structure
>1yat_A FK506 binding protein; HET: FK5; 2.50A {Saccharomyces cerevisiae} SCOP: d.26.1.1 Back     alignment and structure
>2lgo_A FKBP; infectious disease, isomerase, giardiasis, ssgcid, structura genomics, seattle structural genomics center for infectious; NMR {Giardia lamblia} Back     alignment and structure
>3kz7_A FK506-binding protein 3; FKPB ppiase rapamycin, isomerase, nucleus, phosphoprotein, R isomerase-inhibitor complex; HET: RAP; 1.95A {Mus musculus} SCOP: d.26.1.1 PDB: 1pbk_A* Back     alignment and structure
>2f4e_A ATFKBP42; FKBP-like, alpha-beta, signaling protein; 2.32A {Arabidopsis thaliana} Back     alignment and structure
>3uf8_A Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- isomerase; ssgcid, seattle structural genomics center for in disease; HET: FK5; 1.50A {Burkholderia pseudomallei} PDB: 4ggq_C* 3vaw_A* 3uqa_A* 4g50_A* 4fn2_A* 3uqb_A* 4giv_A* 1euv_B 3v60_A 3v61_A 3v62_A* Back     alignment and structure
>3o5e_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 1.60A {Homo sapiens} PDB: 3o5f_A Back     alignment and structure
>3o5q_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 0.96A {Homo sapiens} PDB: 3o5m_A 3o5l_A 3o5o_A 3o5p_A 3o5r_A* 4drk_A* 4drm_A* 4drn_A* 4dro_A* 4drp_A* 4drq_A* 3o5j_A 3o5g_A 3o5i_A 3o5k_A Back     alignment and structure
>1jvw_A Macrophage infectivity potentiator; chagas disease, X-RAY rotamase, isomeras; 1.70A {Trypanosoma cruzi} SCOP: d.26.1.1 Back     alignment and structure
>2ppn_A FK506-binding protein 1A; high resolution protein structure, isomerase; 0.92A {Homo sapiens} SCOP: d.26.1.1 PDB: 1b6c_A 1a7x_A 1d7h_A 1d7i_A 1d7j_A* 1f40_A* 1fap_A* 1d6o_A* 1fkd_A* 1fkf_A* 1fkg_A* 1fkh_A* 1fki_A* 1fkj_A* 1fkr_A 1fks_A 1fkt_A 1j4h_A* 1j4i_A* 1j4r_A* ... Back     alignment and structure
>3b7x_A FK506-binding protein 6; isomerase, repeat, rotamase, TPR repeat, williams-beuren syndrome, structural genomics consortium, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>3oe2_A Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, FK506; HET: TAR SRT; 1.60A {Pseudomonas syringae PV} SCOP: d.26.1.0 Back     alignment and structure
>1fd9_A Protein (macrophage infectivity potentiator prote; FKBP domain, long alpha helix, dimerisation VIA helical INTE isomerase; 2.41A {Legionella pneumophila} SCOP: d.26.1.1 PDB: 2uz5_A 2vcd_A* Back     alignment and structure
>4dip_A Peptidyl-prolyl CIS-trans isomerase FKBP14; structural genomics, structural genomics consortium, SGC, PE prolyl CIS-trans isomerase; 1.82A {Homo sapiens} Back     alignment and structure
>1r9h_A FKB-6, FK506 binding protein family; structural genomics, peptidylprolyl isomerase, PSI, protein structure initiative; 1.80A {Caenorhabditis elegans} SCOP: d.26.1.1 Back     alignment and structure
>1q6h_A FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; chaperone, peptidyl-prolyl isomerase, heat shock protein, FK family; HET: MSE; 1.97A {Escherichia coli} SCOP: d.26.1.1 PDB: 1q6i_A* 1q6u_A Back     alignment and structure
>2vn1_A 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR repeat; HET: FK5; 2.35A {Plasmodium falciparum} PDB: 2ofn_A 2ki3_A 3ihz_A* 3ni6_A 3pa7_A Back     alignment and structure
>2jwx_A FKBP38NTD, FK506-binding protein 8 variant; apoptosis, beta barrel, central helix, with flexible N-terminal extension, isomerase; NMR {Homo sapiens} Back     alignment and structure
>2awg_A 38 kDa FK-506 binding protein; FKBP-type, ppiase, BCL-2 inhibitor, SHH signalling antagonist, structural genomics consortium, SGC; 1.60A {Homo sapiens} PDB: 2f2d_A 3ey6_A Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2d9f_A FK506-binding protein 8 variant; FKBP, rapamycin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1q1c_A FK506-binding protein 4; rotamase, TPR repeat, nuclear protein, phosphorylation, isomerase; 1.90A {Homo sapiens} SCOP: d.26.1.1 d.26.1.1 PDB: 1n1a_A 1rot_A 1rou_A Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2pbc_A FK506-binding protein 2; endoplasmic reticulum, isomerase, polymorphism, rotamase, structural genomics, structural genomics consortium, SGC; 1.80A {Homo sapiens} Back     alignment and structure
>3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Back     alignment and structure
>3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Back     alignment and structure
>4dt4_A FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; FKBP domain, IF domain, chaperone, peptidyl-prolyl isomerase isomerase; 1.35A {Escherichia coli} Back     alignment and structure
>3pr9_A FKBP-type peptidyl-prolyl CIS-trans isomerase; FKBP protein, chaperone; 1.95A {Methanocaldococcus jannaschii} SCOP: d.26.1.0 PDB: 3pra_A Back     alignment and structure
>1ix5_A FKBP; ppiase, isomerase; NMR {Methanothermococcusthermolithotrophicus} SCOP: d.26.1.1 Back     alignment and structure
>3prb_A FKBP-type peptidyl-prolyl CIS-trans isomerase; chaperone; 2.20A {Methanocaldococcus jannaschii} PDB: 3prd_A Back     alignment and structure
>2kr7_A FKBP-type peptidyl-prolyl CIS-trans isomerase SLY; protein, rotamase; NMR {Helicobacter pylori} Back     alignment and structure
>2kfw_A FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD; protein, cobalt, copper, cytoplasm, metal- binding, nickel, rotamase, zinc; NMR {Escherichia coli} Back     alignment and structure
>2k8i_A SLYD, peptidyl-prolyl CIS-trans isomerase; ppiase, chaperone, rotamase; NMR {Escherichia coli} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>1q1c_A FK506-binding protein 4; rotamase, TPR repeat, nuclear protein, phosphorylation, isomerase; 1.90A {Homo sapiens} SCOP: d.26.1.1 d.26.1.1 PDB: 1n1a_A 1rot_A 1rou_A Back     alignment and structure
>1hxv_A Trigger factor; FKBP fold, ppiase, chaperone; NMR {Mycoplasma genitalium} SCOP: d.26.1.1 Back     alignment and structure
>3cgm_A SLYD, peptidyl-prolyl CIS-trans isomerase; chaperone function, two domain P rotamase; 2.41A {Thermus thermophilus} PDB: 3cgn_A 3luo_A* Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>1w26_A Trigger factor, TF; chaperone, protein folding, ribosome associated protein, nascent chain, cell division, isomerase; 2.7A {Escherichia coli} SCOP: a.223.1.1 d.241.2.1 d.26.1.1 PDB: 2vrh_A 1w2b_5 Back     alignment and structure
>1t11_A Trigger factor, TF; helix-turn-helix, four-helix-bundle, ppiase, chaperone; 2.50A {Vibrio cholerae} SCOP: a.223.1.1 d.241.2.1 d.26.1.1 PDB: 1l1p_A Back     alignment and structure
>3gty_X Trigger factor, TF; chaperone-client complex, cell cycle, cell division, chapero isomerase, rotamase, ribonucleoprotein, binding; 3.40A {Thermotoga maritima} PDB: 3gu0_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 210
d1u79a_125 d.26.1.1 (A:) FKBP13 {Thale cress (Arabidopsis tha 5e-12
d1ix5a_151 d.26.1.1 (A:) Archaeal FKBP {Archaeon Methanococcu 2e-09
d1q6ha_210 d.26.1.1 (A:) Peptidyl-prolyl cis-trans isomerase 1e-07
d1q1ca1120 d.26.1.1 (A:21-140) FKBP52, N-terminal domains {Hu 3e-07
d1r9ha_118 d.26.1.1 (A:) FKB-6, N-terminal domain {Caenorhabd 6e-07
d1kt1a2111 d.26.1.1 (A:28-138) FKBP51, N-terminal domains {Mo 9e-07
d1fd9a_204 d.26.1.1 (A:) Macrophage infectivity potentiator p 2e-06
d1yata_113 d.26.1.1 (A:) Calcineurin (FKBP12.6) {Baker's yeas 2e-05
d1pbka_116 d.26.1.1 (A:) FKBP25 {Human (Homo sapiens) [TaxId: 2e-04
>d1u79a_ d.26.1.1 (A:) FKBP13 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 125 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: FKBP-like
superfamily: FKBP-like
family: FKBP immunophilin/proline isomerase
domain: FKBP13
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

 Score = 58.7 bits (141), Expect = 5e-12
 Identities = 56/66 (84%), Positives = 59/66 (89%)

Query: 96  CELTVAPSGLAFCDKVVGVGPEAVKGQLIKAHYVGKLENGKVFDSSYNRGKPLIFRLGVG 155
           CE +V+PSGLAFCDKVVG GPEAVKGQLIKAHYVGKLENGKVFDSSYNRGKPL FR+GVG
Sbjct: 1   CEFSVSPSGLAFCDKVVGYGPEAVKGQLIKAHYVGKLENGKVFDSSYNRGKPLTFRIGVG 60

Query: 156 EVCNQC 161
           EV    
Sbjct: 61  EVIKGW 66
>d1ix5a_ d.26.1.1 (A:) Archaeal FKBP {Archaeon Methanococcus thermolithotrophicus [TaxId: 2186]} Length = 151 Back     information, alignment and structure
>d1q6ha_ d.26.1.1 (A:) Peptidyl-prolyl cis-trans isomerase FkpA {Escherichia coli [TaxId: 562]} Length = 210 Back     information, alignment and structure
>d1q1ca1 d.26.1.1 (A:21-140) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 120 Back     information, alignment and structure
>d1r9ha_ d.26.1.1 (A:) FKB-6, N-terminal domain {Caenorhabditis elegans [TaxId: 6239]} Length = 118 Back     information, alignment and structure
>d1kt1a2 d.26.1.1 (A:28-138) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 111 Back     information, alignment and structure
>d1fd9a_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Legionella pneumophila [TaxId: 446]} Length = 204 Back     information, alignment and structure
>d1yata_ d.26.1.1 (A:) Calcineurin (FKBP12.6) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 113 Back     information, alignment and structure
>d1pbka_ d.26.1.1 (A:) FKBP25 {Human (Homo sapiens) [TaxId: 9606]} Length = 116 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query210
d1u79a_125 FKBP13 {Thale cress (Arabidopsis thaliana) [TaxId: 99.83
d1q6ha_210 Peptidyl-prolyl cis-trans isomerase FkpA {Escheric 99.78
d1q1ca1120 FKBP52, N-terminal domains {Human (Homo sapiens) [ 99.78
d1r9ha_118 FKB-6, N-terminal domain {Caenorhabditis elegans [ 99.78
d1fd9a_204 Macrophage infectivity potentiator protein (MIP) { 99.78
d1yata_113 Calcineurin (FKBP12.6) {Baker's yeast (Saccharomyc 99.78
d2ppna1107 FK-506 binding protein (FKBP12), an immunophilin { 99.77
d1kt1a2111 FKBP51, N-terminal domains {Monkey (Saimiri bolivi 99.76
d1pbka_116 FKBP25 {Human (Homo sapiens) [TaxId: 9606]} 99.7
d1jvwa_160 Macrophage infectivity potentiator protein (MIP) { 99.69
d1ix5a_151 Archaeal FKBP {Archaeon Methanococcus thermolithot 99.43
d1kt1a3115 FKBP51, N-terminal domains {Monkey (Saimiri bolivi 99.4
d1q1ca2117 FKBP52, N-terminal domains {Human (Homo sapiens) [ 99.25
d1hxva_85 Trigger factor PPIase domain {Mycoplasma genitaliu 98.69
d1t11a3113 Trigger factor PPIase domain {Vibrio cholerae [Tax 97.63
d1l1pa_106 Trigger factor PPIase domain {Escherichia coli [Ta 97.6
>d1u79a_ d.26.1.1 (A:) FKBP13 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: FKBP-like
superfamily: FKBP-like
family: FKBP immunophilin/proline isomerase
domain: FKBP13
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

Probab=99.83  E-value=4.8e-21  Score=146.74  Aligned_cols=96  Identities=60%  Similarity=0.848  Sum_probs=83.9

Q ss_pred             CCeeeCCCCcEEEEEEcCCCcCCCCCCEEEEEEEEEeCCCcEEecccCCCCCEEEEecCCcccccccccccccchhHHhh
Q 028345           96 CELTVAPSGLAFCDKVVGVGPEAVKGQLIKAHYVGKLENGKVFDSSYNRGKPLIFRLGVGEVCNQCANKSNRVKSWSLEF  175 (210)
Q Consensus        96 ~~~~~~~sGl~~~~l~~G~G~~p~~Gd~V~vhY~g~l~dG~vFDSS~~~g~P~~F~lG~g~VIpGlee~~~~~kG~~~g~  175 (210)
                      |+++++||||+|+++++|+|+.|+.||+|.|||++++.||++||+|+++++|+.|.+|.+++|+||++++.   | .+++
T Consensus         1 ~~~~~~psGl~y~~~~~G~G~~p~~gd~V~v~y~g~l~~G~~fdss~~~~~p~~~~~g~~~~i~g~~~~i~---g-~~~l   76 (125)
T d1u79a_           1 CEFSVSPSGLAFCDKVVGYGPEAVKGQLIKAHYVGKLENGKVFDSSYNRGKPLTFRIGVGEVIKGWDQGIL---G-SDGI   76 (125)
T ss_dssp             CCCEECTTSCEEEEEECCSSCBCCTTCEEEEEEEEECTTSCEEEEHHHHTSCEEEETTSSSSCHHHHHHHH---C-BTTB
T ss_pred             CCcEECCCCCEEEEEEeccCCCCCCCCEEEEEEEeeecCCcEEecccccCcceeEecCccccccchhhhcc---c-hhhc
Confidence            78999999999999999999999999999999999999999999999988999999999999997776531   1 2456


Q ss_pred             hcCceee---EEecCcccchhhh
Q 028345          176 DNNQLSF---ETCFPIFIWWLWF  195 (210)
Q Consensus       176 ~~m~vG~---~~i~pe~ay~~~~  195 (210)
                      +.|++|+   +.|||++||..-.
T Consensus        77 ~~M~~G~k~~v~iP~~laYG~~G   99 (125)
T d1u79a_          77 PPMLTGGKRTLRIPPELAYGDRG   99 (125)
T ss_dssp             CCCBTTCEEEEEECGGGTTGGGC
T ss_pred             ccccCCCEEEEEECHHHCCCCCC
Confidence            6677775   7899999997654
>d1q6ha_ d.26.1.1 (A:) Peptidyl-prolyl cis-trans isomerase FkpA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q1ca1 d.26.1.1 (A:21-140) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r9ha_ d.26.1.1 (A:) FKB-6, N-terminal domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1fd9a_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1yata_ d.26.1.1 (A:) Calcineurin (FKBP12.6) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ppna1 d.26.1.1 (A:1-107) FK-506 binding protein (FKBP12), an immunophilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a2 d.26.1.1 (A:28-138) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1pbka_ d.26.1.1 (A:) FKBP25 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jvwa_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1ix5a_ d.26.1.1 (A:) Archaeal FKBP {Archaeon Methanococcus thermolithotrophicus [TaxId: 2186]} Back     information, alignment and structure
>d1kt1a3 d.26.1.1 (A:139-253) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1q1ca2 d.26.1.1 (A:141-257) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxva_ d.26.1.1 (A:) Trigger factor PPIase domain {Mycoplasma genitalium [TaxId: 2097]} Back     information, alignment and structure
>d1t11a3 d.26.1.1 (A:135-247) Trigger factor PPIase domain {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1l1pa_ d.26.1.1 (A:) Trigger factor PPIase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure