Citrus Sinensis ID: 028378
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 210 | ||||||
| 224086343 | 293 | predicted protein [Populus trichocarpa] | 0.838 | 0.600 | 0.651 | 1e-62 | |
| 356555761 | 292 | PREDICTED: SNF1-related protein kinase r | 0.819 | 0.589 | 0.690 | 2e-62 | |
| 255563760 | 307 | snf1-kinase beta subunit, plants, putati | 0.819 | 0.560 | 0.663 | 4e-62 | |
| 62900625 | 289 | RecName: Full=SNF1-related protein kinas | 0.819 | 0.595 | 0.657 | 6e-61 | |
| 388495250 | 287 | unknown [Medicago truncatula] | 0.823 | 0.602 | 0.657 | 2e-60 | |
| 32364488 | 287 | AKIN beta2 [Medicago truncatula] | 0.823 | 0.602 | 0.657 | 2e-60 | |
| 359496111 | 301 | PREDICTED: SNF1-related protein kinase r | 0.814 | 0.568 | 0.639 | 3e-60 | |
| 217073870 | 190 | unknown [Medicago truncatula] | 0.823 | 0.910 | 0.657 | 1e-59 | |
| 356532768 | 303 | PREDICTED: SNF1-related protein kinase r | 0.819 | 0.567 | 0.625 | 3e-59 | |
| 224137216 | 261 | predicted protein [Populus trichocarpa] | 0.680 | 0.547 | 0.739 | 2e-58 |
| >gi|224086343|ref|XP_002307855.1| predicted protein [Populus trichocarpa] gi|222853831|gb|EEE91378.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 244 bits (624), Expect = 1e-62, Method: Compositional matrix adjust.
Identities = 125/192 (65%), Positives = 144/192 (75%), Gaps = 16/192 (8%)
Query: 1 MGNVNARED--GSNSPSGVEEGESNNSVQEEGIIV-----------PDGLMGQSPPHSPR 47
MGNVN RE+ G+ SPS V GE S E ++ P +MG SPPHSPR
Sbjct: 1 MGNVNGREEEEGAISPSSVGGGEGERSDSSEVMVASDESHVSYPAPPPEMMGHSPPHSPR 60
Query: 48 ATHSPLMFTPQVPVVPLQRPDEMQIPNLSWMQTSSGYEDMGDGVGIPTMITWSHDGCEVA 107
ATHSPL+FTPQVPV PLQRPDE+QIP+ SWMQTS GYE+M + GIPTMITWS+ G EVA
Sbjct: 61 ATHSPLLFTPQVPVAPLQRPDEIQIPSHSWMQTSLGYEEMCNEHGIPTMITWSYGGKEVA 120
Query: 108 VEGSWDNWKTRIALQRSGKDFTIMKVLPSGVYQYRFLVDGLWKYAPDLPSTQDDDGNVYN 167
VEGSWD+WKTRI LQRSGKD+TIMKVLPSGVYQYRF+VDG W+Y+PDLP +DD GN +N
Sbjct: 121 VEGSWDDWKTRIPLQRSGKDYTIMKVLPSGVYQYRFIVDGQWRYSPDLPWAKDDAGNAHN 180
Query: 168 ILDLQVNITFIP 179
LDLQ F+P
Sbjct: 181 TLDLQ---DFVP 189
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|356555761|ref|XP_003546198.1| PREDICTED: SNF1-related protein kinase regulatory subunit beta-2-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|255563760|ref|XP_002522881.1| snf1-kinase beta subunit, plants, putative [Ricinus communis] gi|223537866|gb|EEF39481.1| snf1-kinase beta subunit, plants, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|62900625|sp|Q9SCY5.1|KINB2_ARATH RecName: Full=SNF1-related protein kinase regulatory subunit beta-2; Short=AKIN subunit beta-2; Short=AKINB2; Short=AKINbeta2 gi|13430672|gb|AAK25958.1|AF360248_1 putative kinase [Arabidopsis thaliana] gi|6686784|emb|CAB64719.1| AKIN beta2 [Arabidopsis thaliana] gi|56744220|gb|AAW28550.1| At4g16360 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|388495250|gb|AFK35691.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|32364488|gb|AAO61677.1| AKIN beta2 [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|359496111|ref|XP_002270146.2| PREDICTED: SNF1-related protein kinase regulatory subunit beta-2-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|217073870|gb|ACJ85295.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|356532768|ref|XP_003534943.1| PREDICTED: SNF1-related protein kinase regulatory subunit beta-2-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|224137216|ref|XP_002322502.1| predicted protein [Populus trichocarpa] gi|222867132|gb|EEF04263.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 210 | ||||||
| TAIR|locus:2178963 | 320 | AKINBETA1 "AT5G21170" [Arabido | 0.557 | 0.365 | 0.512 | 9e-34 | |
| DICTYBASE|DDB_G0281089 | 347 | prkab "AMP-activated protein k | 0.380 | 0.230 | 0.437 | 1.1e-15 | |
| UNIPROTKB|E1B986 | 272 | PRKAB2 "Uncharacterized protei | 0.576 | 0.444 | 0.333 | 1.8e-14 | |
| UNIPROTKB|O43741 | 272 | PRKAB2 "5'-AMP-activated prote | 0.576 | 0.444 | 0.333 | 1.8e-14 | |
| UNIPROTKB|E2R145 | 272 | PRKAB2 "Uncharacterized protei | 0.576 | 0.444 | 0.333 | 2.3e-14 | |
| UNIPROTKB|F1SDB6 | 272 | PRKAB2 "Uncharacterized protei | 0.576 | 0.444 | 0.326 | 3.8e-14 | |
| POMBASE|SPCC1919.03c | 298 | amk2 "AMP-activated protein ki | 0.4 | 0.281 | 0.4 | 4.4e-14 | |
| MGI|MGI:1336185 | 271 | Prkab2 "protein kinase, AMP-ac | 0.576 | 0.446 | 0.326 | 6.2e-14 | |
| RGD|620905 | 271 | Prkab2 "protein kinase, AMP-ac | 0.576 | 0.446 | 0.326 | 6.2e-14 | |
| UNIPROTKB|G3V9X3 | 271 | Prkab2 "5'-AMP-activated prote | 0.576 | 0.446 | 0.326 | 6.2e-14 |
| TAIR|locus:2178963 AKINBETA1 "AT5G21170" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 317 (116.6 bits), Expect = 9.0e-34, Sum P(2) = 9.0e-34
Identities = 62/121 (51%), Positives = 83/121 (68%)
Query: 59 VPVVPLQRPDEMQIPNLSWMQTSSGYEDMGDGVGIPTMITWSHDGCEVAVEGSWDNWKTR 118
VPV PLQR + N+ W Q+ +++ + GIPT+ITW+ G +VAVEGSWDNW++R
Sbjct: 104 VPVAPLQRANAPPPNNIQWNQSQRVFDNPPEQ-GIPTIITWNQGGNDVAVEGSWDNWRSR 162
Query: 119 IALQRSGKDFTIMKVLPSGVYQYRFLVDGLWKYAPDLPSTQDDDGNVYNILDLQVNITFI 178
LQ+SGKD +I+ VLPSG+Y Y+ +VDG KY PDLP D+ GNV NILD+ F+
Sbjct: 163 KKLQKSGKDHSILFVLPSGIYHYKVIVDGESKYIPDLPFVADEVGNVCNILDVH---NFV 219
Query: 179 P 179
P
Sbjct: 220 P 220
|
|
| DICTYBASE|DDB_G0281089 prkab "AMP-activated protein kinase beta subunit" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1B986 PRKAB2 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|O43741 PRKAB2 "5'-AMP-activated protein kinase subunit beta-2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2R145 PRKAB2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1SDB6 PRKAB2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| POMBASE|SPCC1919.03c amk2 "AMP-activated protein kinase beta subunit Amk2" [Schizosaccharomyces pombe (taxid:4896)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1336185 Prkab2 "protein kinase, AMP-activated, beta 2 non-catalytic subunit" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|620905 Prkab2 "protein kinase, AMP-activated, beta 2 non-catalytic subunit" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G3V9X3 Prkab2 "5'-AMP-activated protein kinase subunit beta-2" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| grail3.0024005201 | hypothetical protein (293 aa) | |||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 210 | |||
| cd02859 | 80 | cd02859, E_set_AMPKbeta_like_N, N-terminal Early s | 3e-26 | |
| cd11294 | 83 | cd11294, E_set_Esterase_like_N, N-terminal Early s | 1e-05 | |
| cd07184 | 86 | cd07184, E_set_Isoamylase_like_N, N-terminal Early | 2e-04 |
| >gnl|CDD|199889 cd02859, E_set_AMPKbeta_like_N, N-terminal Early set domain, a glycogen binding domain, associated with the catalytic domain of AMP-activated protein kinase beta subunit | Back alignment and domain information |
|---|
Score = 96.1 bits (240), Expect = 3e-26
Identities = 35/79 (44%), Positives = 50/79 (63%), Gaps = 2/79 (2%)
Query: 94 PTMITWSHDGC-EVAVEGSWDNWKTRIALQRSGK-DFTIMKVLPSGVYQYRFLVDGLWKY 151
P W G EV V GS+DNW+ I L++SG +F+ LP G Y+Y+F+VDG W +
Sbjct: 1 PVTFRWPGPGGKEVYVTGSFDNWQQPIPLEKSGDGEFSATVELPPGRYEYKFIVDGEWVH 60
Query: 152 APDLPSTQDDDGNVYNILD 170
PDLP+ D+ GN+ N+L+
Sbjct: 61 DPDLPTVTDEFGNLNNVLE 79
|
E or "early" set domains are associated with the catalytic domain of AMP-activated protein kinase beta subunit glycogen binding domain at the N-terminal end. AMPK is a metabolic stress sensing protein that senses AMP/ATP and has recently been found to act as a glycogen sensor as well. The protein functions as an alpha-beta-gamma heterotrimer. This N-terminal domain is the glycogen binding domain of the beta subunit. This domain is also a member of the CBM48 (Carbohydrate Binding Module 48) family whose members include pullulanase, maltooligosyl trehalose synthase, starch branching enzyme, glycogen branching enzyme, glycogen debranching enzyme, and isoamylase. Length = 80 |
| >gnl|CDD|199894 cd11294, E_set_Esterase_like_N, N-terminal Early set domain associated with the catalytic domain of putative esterases | Back alignment and domain information |
|---|
| >gnl|CDD|199892 cd07184, E_set_Isoamylase_like_N, N-terminal Early set domain associated with the catalytic domain of isoamylase-like (also called glycogen 6-glucanohydrolase) proteins | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 210 | |||
| cd02859 | 79 | AMPKbeta_GBD_like AMP-activated protein kinase (AM | 99.94 | |
| KOG1616 | 289 | consensus Protein involved in Snf1 protein kinase | 99.88 | |
| cd02861 | 82 | E_set_proteins_like E or "early" set-like proteins | 99.81 | |
| cd02858 | 85 | Esterase_N_term Esterase N-terminal domain. Estera | 99.32 | |
| cd02688 | 83 | E_set E or "early" set of sugar utilizing enzymes | 98.88 | |
| PF02922 | 85 | CBM_48: Carbohydrate-binding module 48 (Isoamylase | 98.65 | |
| cd02854 | 99 | Glycogen_branching_enzyme_like_N_term Glycogen bra | 98.59 | |
| PF00686 | 96 | CBM_20: Starch binding domain; InterPro: IPR002044 | 97.87 | |
| cd02855 | 106 | Glycogen_branching_enzyme_N_term Glycogen branchin | 97.85 | |
| cd02860 | 100 | Pullulanase_N_term Pullulanase domain N-terminus. | 97.81 | |
| cd05808 | 95 | CBM20_alpha_amylase Alpha-amylase, C-terminal CBM2 | 97.78 | |
| COG0296 | 628 | GlgB 1,4-alpha-glucan branching enzyme [Carbohydra | 97.69 | |
| cd05818 | 92 | CBM20_water_dikinase Phosphoglucan water dikinase | 97.55 | |
| cd02856 | 103 | Glycogen_debranching_enzyme_N_term Glycogen_debran | 97.54 | |
| PRK12313 | 633 | glycogen branching enzyme; Provisional | 97.48 | |
| cd05820 | 103 | CBM20_novamyl Novamyl (also known as acarviose tra | 97.46 | |
| PRK12568 | 730 | glycogen branching enzyme; Provisional | 97.44 | |
| cd05809 | 99 | CBM20_beta_amylase Beta-amylase, C-terminal CBM20 | 97.4 | |
| cd05814 | 120 | CBM20_Prei4 Prei4, N-terminal CBM20 (carbohydrate- | 97.37 | |
| PLN02447 | 758 | 1,4-alpha-glucan-branching enzyme | 97.33 | |
| cd05811 | 106 | CBM20_glucoamylase Glucoamylase (glucan1,4-alpha-g | 97.29 | |
| PRK14705 | 1224 | glycogen branching enzyme; Provisional | 97.21 | |
| PRK05402 | 726 | glycogen branching enzyme; Provisional | 97.13 | |
| PRK14706 | 639 | glycogen branching enzyme; Provisional | 97.12 | |
| cd02852 | 119 | Isoamylase_N_term Isoamylase N-terminus domain. Is | 97.05 | |
| cd05813 | 95 | CBM20_genethonin_1 Genethonin-1, C-terminal CBM20 | 96.99 | |
| TIGR02402 | 542 | trehalose_TreZ malto-oligosyltrehalose trehalohydr | 96.9 | |
| cd05807 | 101 | CBM20_CGTase CGTase, C-terminal CBM20 (carbohydrat | 96.84 | |
| cd05816 | 99 | CBM20_DPE2_repeat2 Disproportionating enzyme 2 (DP | 96.84 | |
| cd02853 | 85 | MTHase_N_term Maltooligosyl trehalose synthase (MT | 96.75 | |
| cd05817 | 100 | CBM20_DSP Dual-specificity phosphatase (DSP), N-te | 96.74 | |
| TIGR01515 | 613 | branching_enzym alpha-1,4-glucan:alpha-1,4-glucan | 96.73 | |
| cd05467 | 96 | CBM20 The family 20 carbohydrate-binding module (C | 96.64 | |
| cd05810 | 97 | CBM20_alpha_MTH Glucan 1,4-alpha-maltotetraohydrol | 96.52 | |
| PRK05402 | 726 | glycogen branching enzyme; Provisional | 96.33 | |
| PF11806 | 122 | DUF3327: Domain of unknown function (DUF3327); Int | 95.78 | |
| PF03423 | 87 | CBM_25: Carbohydrate binding domain (family 25); I | 95.54 | |
| TIGR02104 | 605 | pulA_typeI pullulanase, type I. Pullulan is an unu | 95.47 | |
| cd05815 | 101 | CBM20_DPE2_repeat1 Disproportionating enzyme 2 (DP | 95.19 | |
| PLN02960 | 897 | alpha-amylase | 94.4 | |
| cd05806 | 112 | CBM20_laforin Laforin protein tyrosine phosphatase | 94.31 | |
| PRK10439 | 411 | enterobactin/ferric enterobactin esterase; Provisi | 93.82 | |
| PLN02950 | 909 | 4-alpha-glucanotransferase | 92.97 | |
| TIGR02100 | 688 | glgX_debranch glycogen debranching enzyme GlgX. Th | 92.94 | |
| TIGR02102 | 1111 | pullulan_Gpos pullulanase, extracellular, Gram-pos | 92.58 | |
| PLN02950 | 909 | 4-alpha-glucanotransferase | 92.1 | |
| PLN02316 | 1036 | synthase/transferase | 91.57 | |
| cd02857 | 116 | CD_pullulan_degrading_enzymes_N_term CD and pullul | 91.33 | |
| TIGR02103 | 898 | pullul_strch alpha-1,6-glucosidases, pullulanase-t | 91.19 | |
| PRK03705 | 658 | glycogen debranching enzyme; Provisional | 90.87 | |
| PLN02316 | 1036 | synthase/transferase | 89.97 | |
| PF02903 | 120 | Alpha-amylase_N: Alpha amylase, N-terminal ig-like | 88.47 | |
| PRK14510 | 1221 | putative bifunctional 4-alpha-glucanotransferase/g | 84.84 | |
| PF01357 | 82 | Pollen_allerg_1: Pollen allergen; InterPro: IPR007 | 84.65 | |
| PLN02877 | 970 | alpha-amylase/limit dextrinase | 83.36 |
| >cd02859 AMPKbeta_GBD_like AMP-activated protein kinase (AMPK) beta subunit glycogen binding domain (GBD) | Back alignment and domain information |
|---|
Probab=99.94 E-value=1.8e-26 Score=169.89 Aligned_cols=79 Identities=52% Similarity=1.028 Sum_probs=75.1
Q ss_pred ceeEEEEEcCCCCeEEEEeecCCCccceeeeeeCCcEEEEEEcCCceEEEEEEEcCeeecCCCCCeeeCCCCCeeEEEE
Q 028378 92 GIPTMITWSHDGCEVAVEGSWDNWKTRIALQRSGKDFTIMKVLPSGVYQYRFLVDGLWKYAPDLPSTQDDDGNVYNILD 170 (210)
Q Consensus 92 ~vpv~F~w~~~g~~V~V~GSFdnW~~~ipM~rs~~~f~i~l~Lp~G~YqYKFiVDG~W~~Dp~~P~~~D~~G~~NNvI~ 170 (210)
.++|+|+|..++++|+|+|||++|+..++|+|+++.|++++.||+|.|+|||+|||+|++||+++++.|++|+.||+|+
T Consensus 1 ~~~v~f~~~~~a~~V~v~G~F~~W~~~~pm~~~~~~~~~~~~L~~g~y~YkF~Vdg~w~~d~~~~~~~d~~G~~NN~i~ 79 (79)
T cd02859 1 MVPTTFVWPGGGKEVYVTGSFDNWKKKIPLEKSGKGFSATLRLPPGKYQYKFIVDGEWRHSPDLPTETDDEGNVNNVID 79 (79)
T ss_pred CeEEEEEEcCCCcEEEEEEEcCCCCccccceECCCCcEEEEEcCCCCEEEEEEECCEEEeCCCCCccCCCCCcEeeeEC
Confidence 3789999999999999999999999779999987779999999999999999999999999999999999999999984
|
AMPK is a metabolic stress sensing protein that senses AMP/ATP and has recently been found to act as a glycogen sensor as well. The protein functions as a alpha-beta-gamma heterotrimer. This domain is the glycogen binding domain of the beta subunit. |
| >KOG1616 consensus Protein involved in Snf1 protein kinase complex assembly [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >cd02861 E_set_proteins_like E or "early" set-like proteins | Back alignment and domain information |
|---|
| >cd02858 Esterase_N_term Esterase N-terminal domain | Back alignment and domain information |
|---|
| >cd02688 E_set E or "early" set of sugar utilizing enzymes which may be related to the immunoglobulin and/or fibronectin type III superfamilies | Back alignment and domain information |
|---|
| >PF02922 CBM_48: Carbohydrate-binding module 48 (Isoamylase N-terminal domain); InterPro: IPR004193 O-Glycosyl hydrolases 3 | Back alignment and domain information |
|---|
| >cd02854 Glycogen_branching_enzyme_like_N_term Glycogen branching enzyme-like N-terminus domain | Back alignment and domain information |
|---|
| >PF00686 CBM_20: Starch binding domain; InterPro: IPR002044 O-Glycosyl hydrolases 3 | Back alignment and domain information |
|---|
| >cd02855 Glycogen_branching_enzyme_N_term Glycogen branching enzyme N-terminus domain | Back alignment and domain information |
|---|
| >cd02860 Pullulanase_N_term Pullulanase domain N-terminus | Back alignment and domain information |
|---|
| >cd05808 CBM20_alpha_amylase Alpha-amylase, C-terminal CBM20 (carbohydrate-binding module, family 20) domain | Back alignment and domain information |
|---|
| >COG0296 GlgB 1,4-alpha-glucan branching enzyme [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >cd05818 CBM20_water_dikinase Phosphoglucan water dikinase (also known as alpha-glucan water dikinase), N-terminal CBM20 (carbohydrate-binding module, family 20) domain | Back alignment and domain information |
|---|
| >cd02856 Glycogen_debranching_enzyme_N_term Glycogen_debranching_enzyme N-terminal domain | Back alignment and domain information |
|---|
| >PRK12313 glycogen branching enzyme; Provisional | Back alignment and domain information |
|---|
| >cd05820 CBM20_novamyl Novamyl (also known as acarviose transferase, ATase, maltogenic alpha-amylase, glucan 1,4-alpha-maltohydrolase, and AcbD), C-terminal CBM20 (carbohydrate-binding module, family 20) domain | Back alignment and domain information |
|---|
| >PRK12568 glycogen branching enzyme; Provisional | Back alignment and domain information |
|---|
| >cd05809 CBM20_beta_amylase Beta-amylase, C-terminal CBM20 (carbohydrate-binding module, family 20) domain | Back alignment and domain information |
|---|
| >cd05814 CBM20_Prei4 Prei4, N-terminal CBM20 (carbohydrate-binding module, family 20) domain | Back alignment and domain information |
|---|
| >PLN02447 1,4-alpha-glucan-branching enzyme | Back alignment and domain information |
|---|
| >cd05811 CBM20_glucoamylase Glucoamylase (glucan1,4-alpha-glucosidase), C-terminal CBM20 (carbohydrate-binding module, family 20) domain | Back alignment and domain information |
|---|
| >PRK14705 glycogen branching enzyme; Provisional | Back alignment and domain information |
|---|
| >PRK05402 glycogen branching enzyme; Provisional | Back alignment and domain information |
|---|
| >PRK14706 glycogen branching enzyme; Provisional | Back alignment and domain information |
|---|
| >cd02852 Isoamylase_N_term Isoamylase N-terminus domain | Back alignment and domain information |
|---|
| >cd05813 CBM20_genethonin_1 Genethonin-1, C-terminal CBM20 (carbohydrate-binding module, family 20) domain | Back alignment and domain information |
|---|
| >TIGR02402 trehalose_TreZ malto-oligosyltrehalose trehalohydrolase | Back alignment and domain information |
|---|
| >cd05807 CBM20_CGTase CGTase, C-terminal CBM20 (carbohydrate-binding module, family 20) domain | Back alignment and domain information |
|---|
| >cd05816 CBM20_DPE2_repeat2 Disproportionating enzyme 2 (DPE2), N-terminal CBM20 (carbohydrate-binding module, family 20) domain, repeat 2 | Back alignment and domain information |
|---|
| >cd02853 MTHase_N_term Maltooligosyl trehalose synthase (MTSase) N-terminus domain | Back alignment and domain information |
|---|
| >cd05817 CBM20_DSP Dual-specificity phosphatase (DSP), N-terminal CBM20 (carbohydrate-binding module, family 20) domain | Back alignment and domain information |
|---|
| >TIGR01515 branching_enzym alpha-1,4-glucan:alpha-1,4-glucan 6-glycosyltransferase | Back alignment and domain information |
|---|
| >cd05467 CBM20 The family 20 carbohydrate-binding module (CBM20), also known as the starch-binding domain, is found in a large number of starch degrading enzymes including alpha-amylase, beta-amylase, glucoamylase, and CGTase (cyclodextrin glucanotransferase) | Back alignment and domain information |
|---|
| >cd05810 CBM20_alpha_MTH Glucan 1,4-alpha-maltotetraohydrolase (alpha-MTH), C-terminal CBM20 (carbohydrate-binding module, family 20) domain | Back alignment and domain information |
|---|
| >PRK05402 glycogen branching enzyme; Provisional | Back alignment and domain information |
|---|
| >PF11806 DUF3327: Domain of unknown function (DUF3327); InterPro: IPR021764 This entry represents the N-terminal domain of enterochelin esterase | Back alignment and domain information |
|---|
| >PF03423 CBM_25: Carbohydrate binding domain (family 25); InterPro: IPR005085 A carbohydrate-binding module (CBM) is defined as a contiguous amino acid sequence within a carbohydrate-active enzyme with a discreet fold having carbohydrate-binding activity | Back alignment and domain information |
|---|
| >TIGR02104 pulA_typeI pullulanase, type I | Back alignment and domain information |
|---|
| >cd05815 CBM20_DPE2_repeat1 Disproportionating enzyme 2 (DPE2), N-terminal CBM20 (carbohydrate-binding module, family 20) domain, repeat 1 | Back alignment and domain information |
|---|
| >PLN02960 alpha-amylase | Back alignment and domain information |
|---|
| >cd05806 CBM20_laforin Laforin protein tyrosine phosphatase, N-terminal CBM20 (carbohydrate-binding module, family 20) domain | Back alignment and domain information |
|---|
| >PRK10439 enterobactin/ferric enterobactin esterase; Provisional | Back alignment and domain information |
|---|
| >PLN02950 4-alpha-glucanotransferase | Back alignment and domain information |
|---|
| >TIGR02100 glgX_debranch glycogen debranching enzyme GlgX | Back alignment and domain information |
|---|
| >TIGR02102 pullulan_Gpos pullulanase, extracellular, Gram-positive | Back alignment and domain information |
|---|
| >PLN02950 4-alpha-glucanotransferase | Back alignment and domain information |
|---|
| >PLN02316 synthase/transferase | Back alignment and domain information |
|---|
| >cd02857 CD_pullulan_degrading_enzymes_N_term CD and pullulan-degrading enzymes N-terminus domain | Back alignment and domain information |
|---|
| >TIGR02103 pullul_strch alpha-1,6-glucosidases, pullulanase-type | Back alignment and domain information |
|---|
| >PRK03705 glycogen debranching enzyme; Provisional | Back alignment and domain information |
|---|
| >PLN02316 synthase/transferase | Back alignment and domain information |
|---|
| >PF02903 Alpha-amylase_N: Alpha amylase, N-terminal ig-like domain; InterPro: IPR004185 O-Glycosyl hydrolases 3 | Back alignment and domain information |
|---|
| >PRK14510 putative bifunctional 4-alpha-glucanotransferase/glycogen debranching enzyme; Provisional | Back alignment and domain information |
|---|
| >PF01357 Pollen_allerg_1: Pollen allergen; InterPro: IPR007117 Expansins are unusual proteins that mediate cell wall extension in plants [] | Back alignment and domain information |
|---|
| >PLN02877 alpha-amylase/limit dextrinase | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 210 | ||||
| 2f15_A | 96 | Glycogen-Binding Domain Of The Amp-Activated Protei | 3e-13 | ||
| 1z0m_A | 96 | The Glycogen-Binding Domain Of The Amp-Activated Pr | 1e-10 | ||
| 1z0n_A | 96 | The Glycogen-Binding Domain Of The Amp-Activated Pr | 5e-10 | ||
| 2qlv_B | 252 | Crystal Structure Of The Heterotrimer Core Of The S | 3e-06 |
| >pdb|2F15|A Chain A, Glycogen-Binding Domain Of The Amp-Activated Protein Kinase Beta2 Subunit Length = 96 | Back alignment and structure |
|
| >pdb|1Z0M|A Chain A, The Glycogen-Binding Domain Of The Amp-Activated Protein Kinase Beta1 Subunit Length = 96 | Back alignment and structure |
| >pdb|1Z0N|A Chain A, The Glycogen-Binding Domain Of The Amp-Activated Protein Kinase Length = 96 | Back alignment and structure |
| >pdb|2QLV|B Chain B, Crystal Structure Of The Heterotrimer Core Of The S. Cerevisiae Ampk Homolog Snf1 Length = 252 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 210 | |||
| 1z0n_A | 96 | 5'-AMP-activated protein kinase, beta-1 subunit; b | 1e-24 | |
| 2qlv_B | 252 | Protein SIP2, protein SPM2; heterotrimer, ATP-bind | 4e-23 | |
| 3nme_A | 294 | Ptpkis1 protein, SEX4 glucan phosphatase; dual spe | 2e-19 | |
| 4aee_A | 696 | Alpha amylase, catalytic region; hydrolase, hypert | 7e-07 |
| >1z0n_A 5'-AMP-activated protein kinase, beta-1 subunit; beta sandwich, sugar binding protein; HET: BCD; 1.49A {Rattus norvegicus} SCOP: b.1.18.21 PDB: 1z0m_A* 2f15_A Length = 96 | Back alignment and structure |
|---|
Score = 91.9 bits (228), Expect = 1e-24
Identities = 29/88 (32%), Positives = 47/88 (53%), Gaps = 1/88 (1%)
Query: 85 EDMGDGVGIPTMITWSHDGCEVAVEGSWDNWKTRIALQRSGKDFTIMKVLPSGVYQYRFL 144
+ PT+ W+ G EV + GS++NW +++ + RS +F + LP G +QY+F
Sbjct: 3 NEKAPAQARPTVFRWTGGGKEVYLSGSFNNW-SKLPMTRSQNNFVAILDLPEGEHQYKFF 61
Query: 145 VDGLWKYAPDLPSTQDDDGNVYNILDLQ 172
VDG W + P P G V NI+ ++
Sbjct: 62 VDGQWTHDPSEPIVTSQLGTVNNIIQVK 89
|
| >2qlv_B Protein SIP2, protein SPM2; heterotrimer, ATP-binding, carbohydrate metabolism, kinase, membrane, nucleotide-binding, nucleus; 2.60A {Saccharomyces cerevisiae} SCOP: b.1.18.21 d.353.1.1 Length = 252 | Back alignment and structure |
|---|
| >3nme_A Ptpkis1 protein, SEX4 glucan phosphatase; dual specificity phosphatase, carbohydrate BIND hydrolase; 2.40A {Arabidopsis thaliana} Length = 294 | Back alignment and structure |
|---|
| >4aee_A Alpha amylase, catalytic region; hydrolase, hyperthermostable, cyclodextrin hydrolase, GH13; 2.28A {Staphylothermus marinus} Length = 696 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 210 | |||
| 1z0n_A | 96 | 5'-AMP-activated protein kinase, beta-1 subunit; b | 99.94 | |
| 2qlv_B | 252 | Protein SIP2, protein SPM2; heterotrimer, ATP-bind | 99.92 | |
| 3nme_A | 294 | Ptpkis1 protein, SEX4 glucan phosphatase; dual spe | 99.9 | |
| 4aee_A | 696 | Alpha amylase, catalytic region; hydrolase, hypert | 99.69 | |
| 4aef_A | 645 | Neopullulanase (alpha-amylase II); hydrolase, ther | 99.3 | |
| 2z0b_A | 131 | GDE5, KIAA1434, putative glycerophosphodiester pho | 98.48 | |
| 3c8d_A | 403 | Enterochelin esterase; alpha-beta-alpha sandwich, | 98.12 | |
| 1ac0_A | 108 | Glucoamylase; hydrolase, starch binding domain; HE | 98.08 | |
| 1m7x_A | 617 | 1,4-alpha-glucan branching enzyme; alpha/beta barr | 97.66 | |
| 3aml_A | 755 | OS06G0726400 protein; starch-branching, transferas | 97.52 | |
| 3k1d_A | 722 | 1,4-alpha-glucan-branching enzyme; mycobacterium t | 97.51 | |
| 2laa_A | 104 | Beta/alpha-amylase; SBD, CBM25, hydrolase; NMR {Pa | 97.02 | |
| 2bhu_A | 602 | Maltooligosyltrehalose trehalohydrolase; alpha-amy | 96.63 | |
| 3vgf_A | 558 | Malto-oligosyltrehalose trehalohydrolase; alpha/be | 96.61 | |
| 1bf2_A | 750 | Isoamylase; hydrolase, glycosidase, debranching en | 96.54 | |
| 2vn4_A | 599 | Glucoamylase; hydrolase, carbohydrate binding, gly | 96.48 | |
| 1wzl_A | 585 | Alpha-amylase II; pullulan, GH-13, alpha-amylase f | 96.46 | |
| 2wsk_A | 657 | Glycogen debranching enzyme; carbohydrate metaboli | 96.42 | |
| 2vr5_A | 718 | Glycogen operon protein GLGX; hydrolase, glycosida | 96.28 | |
| 3bmv_A | 683 | Cyclomaltodextrin glucanotransferase; glycosidase, | 96.06 | |
| 1cyg_A | 680 | Cyclodextrin glucanotransferase; glycosyltransfera | 96.04 | |
| 1j0h_A | 588 | Neopullulanase; beta-alpha-barrels, hydrolase; 1.9 | 96.02 | |
| 1d3c_A | 686 | Cyclodextrin glycosyltransferase; alpha-amylase, p | 95.81 | |
| 1qho_A | 686 | Alpha-amylase; glycoside hydrolase, starch degrada | 95.8 | |
| 2e8y_A | 718 | AMYX protein, pullulanase; multiple domain, beta-a | 95.6 | |
| 4aio_A | 884 | Limit dextrinase; hydrolase, pullulanase, glycosid | 95.24 | |
| 1ea9_C | 583 | Cyclomaltodextrinase; hydrolase, glycosidase; 3.2A | 95.16 | |
| 1vem_A | 516 | Beta-amylase; beta-alpha-barrels, optimum PH, hydr | 95.03 | |
| 2fhf_A | 1083 | Pullulanase; multiple domain, beta-alpha-barrel, a | 95.03 | |
| 2ya0_A | 714 | Putative alkaline amylopullulanase; hydrolase, gly | 94.44 | |
| 3faw_A | 877 | Reticulocyte binding protein; TIM barrel, beta bar | 94.39 | |
| 3m07_A | 618 | Putative alpha amylase; IDP00968, csgid, structura | 94.37 | |
| 2wan_A | 921 | Pullulanase; hydrolase, glycoside hydrolase, polys | 94.31 | |
| 1ji1_A | 637 | Alpha-amylase I; beta/alpha barrel, hydrolase; 1.6 | 93.74 | |
| 1gcy_A | 527 | Glucan 1,4-alpha-maltotetrahydrolase; beta-alpha-b | 93.33 | |
| 2wan_A | 921 | Pullulanase; hydrolase, glycoside hydrolase, polys | 92.2 | |
| 2ya1_A | 1014 | Putative alkaline amylopullulanase; hydrolase, gly | 91.93 | |
| 2c3v_A | 102 | Alpha-amylase G-6; carbohydrate-binding module, st | 88.22 | |
| 4fch_A | 221 | Outer membrane protein SUSE; starch binding, extra | 82.05 |
| >1z0n_A 5'-AMP-activated protein kinase, beta-1 subunit; beta sandwich, sugar binding protein; HET: BCD; 1.49A {Rattus norvegicus} SCOP: b.1.18.21 PDB: 1z0m_A* 2f15_A | Back alignment and structure |
|---|
Probab=99.94 E-value=1.1e-26 Score=175.77 Aligned_cols=89 Identities=33% Similarity=0.686 Sum_probs=78.9
Q ss_pred CCCCCCCceeEEEEEcCCCCeEEEEeecCCCccceeeeeeCCcEEEEEEcCCceEEEEEEEcCeeecCCCCCeeeCCCCC
Q 028378 85 EDMGDGVGIPTMITWSHDGCEVAVEGSWDNWKTRIALQRSGKDFTIMKVLPSGVYQYRFLVDGLWKYAPDLPSTQDDDGN 164 (210)
Q Consensus 85 ~~~~~~~~vpv~F~w~~~g~~V~V~GSFdnW~~~ipM~rs~~~f~i~l~Lp~G~YqYKFiVDG~W~~Dp~~P~~~D~~G~ 164 (210)
++++++++++|+|+|.+.|++|+|+|+||+|+ +++|+|+++.|++++.|++|.|+|||+|||+|++||.++++.|..|+
T Consensus 3 ~~~~~~~~~~v~F~wap~a~~V~v~GdFn~W~-~~~m~~~~g~w~~~v~l~~G~~~YKf~VdG~~~~DP~~~~~~d~~G~ 81 (96)
T 1z0n_A 3 NEKAPAQARPTVFRWTGGGKEVYLSGSFNNWS-KLPMTRSQNNFVAILDLPEGEHQYKFFVDGQWTHDPSEPIVTSQLGT 81 (96)
T ss_dssp -------CEEEEEEECSCCSCEEEEEGGGTTC-CEECEEETTEEEEEEEECSEEEEEEEEETTEEECCTTSCEEECTTSC
T ss_pred cccCCCCceEEEEEECCCCcEEEEEEEeCCCc-cccCEECCCEEEEEEEccCCCEEEEEEECCeEEcCCCCCeEECCCCC
Confidence 35577889999999999999999999999999 79999988899999999999999999999999999999999999999
Q ss_pred eeEEEEcCCC
Q 028378 165 VYNILDLQVN 174 (210)
Q Consensus 165 ~NNvI~V~d~ 174 (210)
.||+|.|.+.
T Consensus 82 ~Nnvi~V~~~ 91 (96)
T 1z0n_A 82 VNNIIQVKKT 91 (96)
T ss_dssp EEEEEEECSC
T ss_pred EeEEEEEcCC
Confidence 9999999754
|
| >2qlv_B Protein SIP2, protein SPM2; heterotrimer, ATP-binding, carbohydrate metabolism, kinase, membrane, nucleotide-binding, nucleus; 2.60A {Saccharomyces cerevisiae} SCOP: b.1.18.21 d.353.1.1 | Back alignment and structure |
|---|
| >3nme_A Ptpkis1 protein, SEX4 glucan phosphatase; dual specificity phosphatase, carbohydrate BIND hydrolase; 2.40A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >4aee_A Alpha amylase, catalytic region; hydrolase, hyperthermostable, cyclodextrin hydrolase, GH13; 2.28A {Staphylothermus marinus} | Back alignment and structure |
|---|
| >4aef_A Neopullulanase (alpha-amylase II); hydrolase, thermostability, high temperature; 2.34A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >2z0b_A GDE5, KIAA1434, putative glycerophosphodiester phosphodiesterase; CBM20 domain, starch-binding, hydrolase, STR genomics, NPPSFA; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3c8d_A Enterochelin esterase; alpha-beta-alpha sandwich, IROD, iron aquisition, structural genomics, PSI-2, protein structure initiative; HET: CIT; 1.80A {Shigella flexneri 2a str} SCOP: b.1.18.20 c.69.1.2 PDB: 2b20_A 3c87_A* 3c8h_A 3mga_A* | Back alignment and structure |
|---|
| >1ac0_A Glucoamylase; hydrolase, starch binding domain; HET: GLC BGC GLO; NMR {Aspergillus niger} SCOP: b.3.1.1 PDB: 1acz_A* 1kul_A 1kum_A | Back alignment and structure |
|---|
| >1m7x_A 1,4-alpha-glucan branching enzyme; alpha/beta barrel, beta sandwich, transferase; 2.30A {Escherichia coli} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 3o7y_A* 3o7z_A* | Back alignment and structure |
|---|
| >3aml_A OS06G0726400 protein; starch-branching, transferase; HET: EPE; 1.70A {Oryza sativa japonica group} PDB: 3amk_A | Back alignment and structure |
|---|
| >3k1d_A 1,4-alpha-glucan-branching enzyme; mycobacterium tuberculosis H37RV, mesophilic human pathogen, RV1326C gene, glycosyl transferase; 2.33A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2laa_A Beta/alpha-amylase; SBD, CBM25, hydrolase; NMR {Paenibacillus polymyxa} PDB: 2lab_A | Back alignment and structure |
|---|
| >2bhu_A Maltooligosyltrehalose trehalohydrolase; alpha-amylase, protein-carbohydrate complex, desiccation resistance; HET: TRS PGE; 1.1A {Deinococcus radiodurans} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 2bhy_A* 2bhz_A* 2bxy_A* 2bxz_A* 2by0_A* 2by1_A* 2by2_A* 2by3_A* | Back alignment and structure |
|---|
| >3vgf_A Malto-oligosyltrehalose trehalohydrolase; alpha/beta barrel, alpha-amylas hydrolase; HET: GLC FLC; 2.30A {Sulfolobus solfataricus} PDB: 3vge_A* 3vgd_A* 3vgb_A* 1eh9_A* 3vgh_A* 3vgg_A* 1eha_A | Back alignment and structure |
|---|
| >1bf2_A Isoamylase; hydrolase, glycosidase, debranching enzyme; 2.00A {Pseudomonas amyloderamosa} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 | Back alignment and structure |
|---|
| >2vn4_A Glucoamylase; hydrolase, carbohydrate binding, glycoside hydrolase family 15, amyloglucosidase; HET: MAN NAG BTB; 1.85A {Hypocrea jecorina} PDB: 2vn7_A* | Back alignment and structure |
|---|
| >1wzl_A Alpha-amylase II; pullulan, GH-13, alpha-amylase family, hydrolase; 2.00A {Thermoactinomyces vulgaris} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1ji2_A 1bvz_A 1vfk_A* 3a6o_A* 1wzm_A 1jf6_A 1wzk_A 2d2o_A* 1jib_A* 1jl8_A* 1vb9_A* 1g1y_A* 1vfo_A* 1vfm_A* 1vfu_A* 1jf5_A | Back alignment and structure |
|---|
| >2wsk_A Glycogen debranching enzyme; carbohydrate metabolism, hydrolase, glycosidase, ISO-amylase glycosyl hydrolase, glycogen metabolism; 2.25A {Escherichia coli k-12} | Back alignment and structure |
|---|
| >2vr5_A Glycogen operon protein GLGX; hydrolase, glycosidase, glycosyl hydrolase, glycogen debraching; HET: GLC A16; 2.8A {Sulfolobus solfataricus} PDB: 2vnc_A* 2vuy_A | Back alignment and structure |
|---|
| >3bmv_A Cyclomaltodextrin glucanotransferase; glycosidase, thermostable, family 13 glycosyl hydrolas; 1.60A {Thermoanaerobacterium thermosulfurigenorganism_taxid} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 3bmw_A* 1ciu_A 1a47_A 1pj9_A* 1cgt_A | Back alignment and structure |
|---|
| >1cyg_A Cyclodextrin glucanotransferase; glycosyltransferase; 2.50A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 | Back alignment and structure |
|---|
| >1j0h_A Neopullulanase; beta-alpha-barrels, hydrolase; 1.90A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1j0i_A* 1j0j_A* 1j0k_A* 1sma_A 1gvi_A* | Back alignment and structure |
|---|
| >1d3c_A Cyclodextrin glycosyltransferase; alpha-amylase, product complex, oligosaccharide, family 13 glycosyl hydrolase, transglycosylation; HET: GLC; 1.78A {Bacillus circulans} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 1cxf_A* 1cxk_A* 1cdg_A* 1cxe_A* 1cxh_A* 1cxi_A* 2cxg_A* 1cgv_A* 2dij_A* 1cgy_A* 1kck_A* 1cgx_A* 1cxl_A* 1cgw_A* 1tcm_A 1kcl_A* 1eo5_A* 1eo7_A* 1dtu_A* 1ot1_A* ... | Back alignment and structure |
|---|
| >1qho_A Alpha-amylase; glycoside hydrolase, starch degradation; HET: MAL ABD; 1.70A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 1qhp_A* | Back alignment and structure |
|---|
| >2e8y_A AMYX protein, pullulanase; multiple domain, beta-alpha-barrel, alpha-amylase-family, HY; 2.11A {Bacillus subtilis} PDB: 2e8z_A* 2e9b_A* | Back alignment and structure |
|---|
| >4aio_A Limit dextrinase; hydrolase, pullulanase, glycoside hydrolase family 13; 1.90A {Hordeum vulgare} PDB: 2x4c_A* 2y4s_A* 2y5e_A* 2x4b_A | Back alignment and structure |
|---|
| >1ea9_C Cyclomaltodextrinase; hydrolase, glycosidase; 3.2A {Bacillus SP} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 | Back alignment and structure |
|---|
| >1vem_A Beta-amylase; beta-alpha-barrels, optimum PH, hydrolase; HET: GLC; 1.85A {Bacillus cereus} SCOP: b.3.1.1 c.1.8.1 PDB: 1b90_A* 1j0y_A* 1j0z_A* 1j10_A* 1b9z_A* 1j12_A* 1j18_A* 1j11_A* 5bca_A 1veo_A* 1itc_A* 1ven_A* 1vep_A* 1cqy_A | Back alignment and structure |
|---|
| >2fhf_A Pullulanase; multiple domain, beta-alpha-barrel, alpha-amylase-family, complex with maltotetraose, hydrolase; HET: GLC; 1.65A {Klebsiella aerogenes} SCOP: b.1.18.2 b.1.18.2 b.3.1.3 b.71.1.1 c.1.8.1 PDB: 2fh6_A* 2fh8_A* 2fhb_A* 2fhc_A* 2fgz_A* | Back alignment and structure |
|---|
| >2ya0_A Putative alkaline amylopullulanase; hydrolase, glycoside hydrolase; 1.85A {Streptococcus pneumoniae} PDB: 2ya2_A* | Back alignment and structure |
|---|
| >3faw_A Reticulocyte binding protein; TIM barrel, beta barrel, hydrolase, cell WALL, peptidoglycan-anchor, secreted; 2.10A {Streptococcus agalactiae COH1} PDB: 3fax_A* | Back alignment and structure |
|---|
| >3m07_A Putative alpha amylase; IDP00968, csgid, structural genomics, center for structural genomics of infectious diseases, unknown function; HET: BTB PG4 PGE; 1.40A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >2wan_A Pullulanase; hydrolase, glycoside hydrolase, polysaccharide, amylase, starch, carbohydrate; 1.65A {Bacillus acidopullulyticus} | Back alignment and structure |
|---|
| >1ji1_A Alpha-amylase I; beta/alpha barrel, hydrolase; 1.60A {Thermoactinomyces vulgaris} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1uh3_A* 2d0f_A* 1izj_A 1uh4_A* 1uh2_A* 2d0g_A* 2d0h_A* 1izk_A | Back alignment and structure |
|---|
| >1gcy_A Glucan 1,4-alpha-maltotetrahydrolase; beta-alpha-barrel, beta sheet; 1.60A {Pseudomonas stutzeri} SCOP: b.71.1.1 c.1.8.1 PDB: 1jdc_A* 1jda_A* 1jdd_A* 1qi5_A* 1qi3_A* 1qi4_A* 2amg_A 1qpk_A* | Back alignment and structure |
|---|
| >2wan_A Pullulanase; hydrolase, glycoside hydrolase, polysaccharide, amylase, starch, carbohydrate; 1.65A {Bacillus acidopullulyticus} | Back alignment and structure |
|---|
| >2ya1_A Putative alkaline amylopullulanase; hydrolase, glycoside hydrolase; HET: BGC GLC; 2.25A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >2c3v_A Alpha-amylase G-6; carbohydrate-binding module, starch binding, carbohydrate binding, glycoside hydrolase, amylose, amylopectin; HET: TYI; 1.39A {Bacillus halodurans} PDB: 2c3v_B* 2c3w_A* 2c3x_A* | Back alignment and structure |
|---|
| >4fch_A Outer membrane protein SUSE; starch binding, extracellular, carbohydrate-B protein; HET: GLC; 1.30A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 210 | ||||
| d1z0na1 | 87 | b.1.18.21 (A:77-163) 5'-AMP-activated protein kina | 4e-23 | |
| d2qlvb1 | 87 | b.1.18.21 (B:161-247) SIP2 {Saccharomyces cerevisi | 9e-18 |
| >d1z0na1 b.1.18.21 (A:77-163) 5'-AMP-activated protein kinase subunit beta-1 {Rattus norvegicus [TaxId: 10116]} Length = 87 | Back information, alignment and structure |
|---|
class: All beta proteins fold: Immunoglobulin-like beta-sandwich superfamily: E set domains family: AMPK-beta glycogen binding domain-like domain: 5'-AMP-activated protein kinase subunit beta-1 species: Rattus norvegicus [TaxId: 10116]
Score = 86.9 bits (215), Expect = 4e-23
Identities = 29/79 (36%), Positives = 45/79 (56%), Gaps = 1/79 (1%)
Query: 94 PTMITWSHDGCEVAVEGSWDNWKTRIALQRSGKDFTIMKVLPSGVYQYRFLVDGLWKYAP 153
PT+ W+ G EV + GS++NW ++ + RS +F + LP G +QY+F VDG W + P
Sbjct: 3 PTVFRWTGGGKEVYLSGSFNNWS-KLPMTRSQNNFVAILDLPEGEHQYKFFVDGQWTHDP 61
Query: 154 DLPSTQDDDGNVYNILDLQ 172
P G V NI+ ++
Sbjct: 62 SEPIVTSQLGTVNNIIQVK 80
|
| >d2qlvb1 b.1.18.21 (B:161-247) SIP2 {Saccharomyces cerevisiae [TaxId: 4932]} Length = 87 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 210 | |||
| d1z0na1 | 87 | 5'-AMP-activated protein kinase subunit beta-1 {Ra | 99.95 | |
| d2qlvb1 | 87 | SIP2 {Saccharomyces cerevisiae [TaxId: 4932]} | 99.95 | |
| d2bhua1 | 97 | Glycosyltrehalose trehalohydrolase, N-terminal dom | 98.58 | |
| d1m7xa1 | 110 | 1,4-alpha-glucan branching enzyme, N-terminal doma | 98.46 | |
| d1kula_ | 108 | Glucoamylase, granular starch-binding domain {Aspe | 97.94 | |
| d1cyga2 | 106 | Cyclodextrin glycosyltransferase, C-terminal domai | 97.75 | |
| d3bmva2 | 105 | Cyclodextrin glycosyltransferase, C-terminal domai | 97.74 | |
| d1qhoa2 | 110 | Cyclodextrin glycosyltransferase, C-terminal domai | 97.65 | |
| d1vema1 | 99 | beta-amylase {Bacillus cereus [TaxId: 1396]} | 97.43 | |
| d1eh9a1 | 90 | Glycosyltrehalose trehalohydrolase, N-terminal dom | 97.21 | |
| d2fhfa1 | 115 | Pullulanase PulA {Klebsiella pneumoniae [TaxId: 57 | 95.95 | |
| d1bf2a1 | 162 | Isoamylase, N-terminal domain N {Pseudomonas amylo | 95.8 | |
| d3c8da1 | 145 | Enterochelin esterase {Shigella flexneri 2a str. 2 | 91.96 | |
| d1wzla1 | 120 | Maltogenic amylase, N-terminal domain N {Thermoact | 83.24 | |
| d1ji1a1 | 122 | Maltogenic amylase, N-terminal domain N {Thermoact | 80.29 | |
| d1j0ha1 | 123 | Neopullulanase, N-terminal domain {Bacillus stearo | 80.02 |
| >d1z0na1 b.1.18.21 (A:77-163) 5'-AMP-activated protein kinase subunit beta-1 {Rattus norvegicus [TaxId: 10116]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: Immunoglobulin-like beta-sandwich superfamily: E set domains family: AMPK-beta glycogen binding domain-like domain: 5'-AMP-activated protein kinase subunit beta-1 species: Rattus norvegicus [TaxId: 10116]
Probab=99.95 E-value=1.3e-28 Score=181.59 Aligned_cols=81 Identities=36% Similarity=0.737 Sum_probs=77.3
Q ss_pred ceeEEEEEcCCCCeEEEEeecCCCccceeeeeeCCcEEEEEEcCCceEEEEEEEcCeeecCCCCCeeeCCCCCeeEEEEc
Q 028378 92 GIPTMITWSHDGCEVAVEGSWDNWKTRIALQRSGKDFTIMKVLPSGVYQYRFLVDGLWKYAPDLPSTQDDDGNVYNILDL 171 (210)
Q Consensus 92 ~vpv~F~w~~~g~~V~V~GSFdnW~~~ipM~rs~~~f~i~l~Lp~G~YqYKFiVDG~W~~Dp~~P~~~D~~G~~NNvI~V 171 (210)
++||+|+|+++|++|+|+|||++|++ .+|.++++.|++++.|++|.|+|||+|||+|++|+++|++.|..|+.||+|.|
T Consensus 1 ~~P~~f~w~~~a~~V~v~Gsfn~W~~-~~~~~~~g~~~~tl~L~~G~y~YKFiVDG~w~~d~~~~~~~d~~G~~Nnvi~V 79 (87)
T d1z0na1 1 ARPTVFRWTGGGKEVYLSGSFNNWSK-LPMTRSQNNFVAILDLPEGEHQYKFFVDGQWTHDPSEPIVTSQLGTVNNIIQV 79 (87)
T ss_dssp CEEEEEEECSCCSCEEEEEGGGTTCC-EECEEETTEEEEEEEECSEEEEEEEEETTEEECCTTSCEEECTTSCEEEEEEE
T ss_pred CCCEEEEEcCCCEEEEEEEEeCCCCc-cccccCCCcEEEEEECCCceEEEEEEECCEEEeCCCCCeeECCCCCEEEEEEE
Confidence 47999999999999999999999985 78999999999999999999999999999999999999999999999999999
Q ss_pred CC
Q 028378 172 QV 173 (210)
Q Consensus 172 ~d 173 (210)
.+
T Consensus 80 ~~ 81 (87)
T d1z0na1 80 KK 81 (87)
T ss_dssp CS
T ss_pred CC
Confidence 74
|
| >d2qlvb1 b.1.18.21 (B:161-247) SIP2 {Saccharomyces cerevisiae [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2bhua1 b.1.18.2 (A:14-110) Glycosyltrehalose trehalohydrolase, N-terminal domain N {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d1m7xa1 b.1.18.2 (A:117-226) 1,4-alpha-glucan branching enzyme, N-terminal domain N {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1kula_ b.3.1.1 (A:) Glucoamylase, granular starch-binding domain {Aspergillus niger [TaxId: 5061]} | Back information, alignment and structure |
|---|
| >d1cyga2 b.3.1.1 (A:575-680) Cyclodextrin glycosyltransferase, C-terminal domain {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d3bmva2 b.3.1.1 (A:579-683) Cyclodextrin glycosyltransferase, C-terminal domain {Thermoanaerobacterium [TaxId: 28895]} | Back information, alignment and structure |
|---|
| >d1qhoa2 b.3.1.1 (A:577-686) Cyclodextrin glycosyltransferase, C-terminal domain {Bacillus stearothermophilus, maltogenic alpha-amylase [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1vema1 b.3.1.1 (A:418-516) beta-amylase {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1eh9a1 b.1.18.2 (A:1-90) Glycosyltrehalose trehalohydrolase, N-terminal domain N {Archaeon Sulfolobus solfataricus, km1 [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2fhfa1 b.1.18.2 (A:288-402) Pullulanase PulA {Klebsiella pneumoniae [TaxId: 573]} | Back information, alignment and structure |
|---|
| >d1bf2a1 b.1.18.2 (A:1-162) Isoamylase, N-terminal domain N {Pseudomonas amyloderamosa [TaxId: 32043]} | Back information, alignment and structure |
|---|
| >d3c8da1 b.1.18.20 (A:6-150) Enterochelin esterase {Shigella flexneri 2a str. 2457T [TaxId: 198215]} | Back information, alignment and structure |
|---|
| >d1wzla1 b.1.18.2 (A:1-120) Maltogenic amylase, N-terminal domain N {Thermoactinomyces vulgaris, TVAII [TaxId: 2026]} | Back information, alignment and structure |
|---|
| >d1ji1a1 b.1.18.2 (A:1-122) Maltogenic amylase, N-terminal domain N {Thermoactinomyces vulgaris, TVAI [TaxId: 2026]} | Back information, alignment and structure |
|---|
| >d1j0ha1 b.1.18.2 (A:1-123) Neopullulanase, N-terminal domain {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|