Citrus Sinensis ID: 028404

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------21
MTHPCIQATAAAAAKSNQNGGAQRKQNAPKNDDVEVEEDDDRPMLSSQALAALQEFLSEQNQTSETAQNKTESDSDEVALVSEDWRLSQFWYDAVTAETVAQEAVSLCSDSDSRVACIACPTLYAYLKKIRPEVSPKILEYDMRFEQYGSDFAFYDYNQPQDLPLELKHAFSVVVVDPPYLSKECLEKVSETVSFLARPGDSKLLLLTG
cccHHHHHHHHHHHHHHcccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccHHHHHHHHHHHHHHcccccccEEEEEccHHHHHHHHHcccccccEEccccccccccccccccccccccccHHHHcccccEEEEccccccHHHHHHHHHHHHHHcccccccEEEEcc
cccHHHHHHHHHHHHHccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHccccccccccHHHHHHHHHHHHHHccccccEEEEEEcHHHHHHHHHccccccEEEEEEccHHcEccccEEEEEccccHcccHHHHccccEEEEccccccHHHHHHHHHHHHHHHcccccEEEEEcc
MTHPCIQATAAAAAKsnqnggaqrkqnapknddveveedddrpmLSSQALAALQEFLSEQnqtsetaqnktesdsdevALVSEDWRLSQFWYDAVTAETVAQEAVSLcsdsdsrvaciaCPTLYAYLKKirpevspkiLEYDMRFeqygsdfafydynqpqdlplelKHAFsvvvvdppylskeCLEKVSETVSFlarpgdsklllltg
MTHPCIQATAAAaaksnqnggaqrkqnapkndDVEVEEDDDRPMLSSQALAALQEFLSEQNQTsetaqnktesdsdEVALVSEDWRLSQFWYDAVTAETVAQEAVSLCSDSDSRVACIACPTLYAYLKKIRPEVSPKILEYDMRFEQYGSDFAFYDYNQPQDLPLELKHAFSVVVVDPPYLSKECLEKVSETvsflarpgdsklllltg
MTHPCIQataaaaaKSNQNGGAQRKQNAPKNddveveedddRPMLSSQALAALQEFLSEQNQTSETAQNKTESDSDEVALVSEDWRLSQFWYDavtaetvaqeavSLCSDSDSRVACIACPTLYAYLKKIRPEVSPKILEYDMRFEQYGSDFAFYDYNQPQDLPLELKHAFSVVVVDPPYLSKECLEKVSETVSFLARPGDSKLLLLTG
******************************************************************************ALVSEDWRLSQFWYDAVTAETVAQEAVSLCSDSDSRVACIACPTLYAYLKKIRPEVSPKILEYDMRFEQYGSDFAFYDYNQPQDLPLELKHAFSVVVVDPPYLSKECLEKVSETVSFLA************
****C**************************************MLSSQALAALQEFLS*********************LVSEDWRLSQFWYDAVTAETVAQEAVSLCSDSDSRVACIACPTLYAYLKKIRPEVSPKILEYDMRFEQYGSDFAFYDYNQPQDLPLELKHAFSVVVVDPPYLSKECLEKVSETVSFLARPGDSKLLLLTG
*******************************************MLSSQALAALQEFLS********************ALVSEDWRLSQFWYDAVTAETVAQEAVSLCSDSDSRVACIACPTLYAYLKKIRPEVSPKILEYDMRFEQYGSDFAFYDYNQPQDLPLELKHAFSVVVVDPPYLSKECLEKVSETVSFLARPGDSKLLLLTG
****CIQATAAAAA****************************PMLSSQALAALQEFLSEQNQTSETAQNKTESDSDEVALVSEDWRLSQFWYDAVTAETVAQEAVSLCSDSDSRVACIACPTLYAYLKKIRPEVSPKILEYDMRFEQYGSDFAFYDYNQPQDLPLELKHAFSVVVVDPPYLSKECLEKVSETVSFLARPGDSKLLLLTG
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTHPCIQATAAAAAKSNQNGGAQRKQNAPKNDDVEVEEDDDRPMLSSQALAALQEFLSEQNQTSETAQNKTESDSDEVALVSEDWRLSQFWYDAVTAETVAQEAVSLCSDSDSRVACIACPTLYAYLKKIRPEVSPKILEYDMRFEQYGSDFAFYDYNQPQDLPLELKHAFSVVVVDPPYLSKECLEKVSETVSFLARPGDSKLLLLTG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query209 2.2.26 [Sep-21-2011]
Q8WVE0214 N(6)-adenine-specific DNA yes no 0.784 0.766 0.482 7e-40
Q9CY45214 N(6)-adenine-specific DNA yes no 0.784 0.766 0.482 2e-38
Q6GN98220 N(6)-adenine-specific DNA N/A no 0.803 0.763 0.462 2e-37
Q17QF2226 N(6)-adenine-specific DNA yes no 0.789 0.730 0.454 8e-36
Q5ZKT6213 N(6)-adenine-specific DNA yes no 0.775 0.760 0.461 2e-34
Q86A24211 N(6)-adenine-specific DNA yes no 0.751 0.744 0.389 2e-25
Q5WRN3218 N(6)-adenine-specific DNA yes no 0.779 0.747 0.357 2e-25
Q9VMH7223 N(6)-adenine-specific DNA yes no 0.803 0.753 0.351 8e-23
Q6NYP8166 N(6)-adenine-specific DNA yes no 0.569 0.716 0.437 8e-22
P53200248 N(6)-adenine-specific DNA yes no 0.746 0.629 0.373 2e-20
>sp|Q8WVE0|N6MT2_HUMAN N(6)-adenine-specific DNA methyltransferase 2 OS=Homo sapiens GN=N6AMT2 PE=2 SV=1 Back     alignment and function desciption
 Score =  163 bits (413), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 84/174 (48%), Positives = 112/174 (64%), Gaps = 10/174 (5%)

Query: 38  EDDDRPMLSSQALAALQEFLSEQNQTSETAQNKTESDSDEVALVSEDWRLSQFWYDAVTA 97
           EDD+ P LS+ ALAALQEF +EQ Q  E      E D   + ++ E+W+LSQFWY   TA
Sbjct: 5   EDDETPQLSAHALAALQEFYAEQKQQIEPG----EDDKYNIGIIEENWQLSQFWYSQETA 60

Query: 98  ETVAQEAVSLCSDSDSRVACIACPTLYAYLKKI-RPEVSPKILEYDMRFEQYGSDFAFYD 156
             +AQEA++   +   R+AC++ P++Y  L+++ R   S  I EYD RF  YG +F FYD
Sbjct: 61  LQLAQEAIAAVGEG-GRIACVSAPSVYQKLRELCRENFSIYIFEYDKRFAMYGEEFIFYD 119

Query: 157 YNQPQDLPLELK-HAFSVVVVDPPYLSKECLEKVSETVSFLARPGDSKLLLLTG 209
           YN P DLP  +  H+F +V+ DPPYLS+ECL K SETV +L R    K+LL TG
Sbjct: 120 YNNPLDLPERIAAHSFDIVIADPPYLSEECLRKTSETVKYLTR---GKILLCTG 170
Putative DNA methyltransferase.
Homo sapiens (taxid: 9606)
EC: 2EC: .EC: 1EC: .EC: 1EC: .EC: -
>sp|Q9CY45|N6MT2_MOUSE N(6)-adenine-specific DNA methyltransferase 2 OS=Mus musculus GN=N6amt2 PE=2 SV=1 Back     alignment and function description
>sp|Q6GN98|N6MT2_XENLA N(6)-adenine-specific DNA methyltransferase 2 OS=Xenopus laevis GN=n6amt2 PE=2 SV=1 Back     alignment and function description
>sp|Q17QF2|N6MT2_BOVIN N(6)-adenine-specific DNA methyltransferase 2 OS=Bos taurus GN=N6AMT2 PE=2 SV=1 Back     alignment and function description
>sp|Q5ZKT6|N6MT2_CHICK N(6)-adenine-specific DNA methyltransferase 2 OS=Gallus gallus GN=N6AMT2 PE=2 SV=1 Back     alignment and function description
>sp|Q86A24|N6MT2_DICDI N(6)-adenine-specific DNA methyltransferase 2 homolog OS=Dictyostelium discoideum GN=DDB_G0272708 PE=3 SV=1 Back     alignment and function description
>sp|Q5WRN3|N6MT2_CAEEL N(6)-adenine-specific DNA methyltransferase 2 homolog OS=Caenorhabditis elegans GN=M142.8 PE=3 SV=1 Back     alignment and function description
>sp|Q9VMH7|N6MT2_DROME N(6)-adenine-specific DNA methyltransferase 2 homolog OS=Drosophila melanogaster GN=CG9154 PE=2 SV=2 Back     alignment and function description
>sp|Q6NYP8|N6MT2_DANRE N(6)-adenine-specific DNA methyltransferase 2 OS=Danio rerio GN=n6amt2 PE=2 SV=1 Back     alignment and function description
>sp|P53200|AML1_YEAST N(6)-adenine-specific DNA methyltransferase-like 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AML1 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query209
359481089224 PREDICTED: N(6)-adenine-specific DNA met 0.789 0.736 0.708 1e-64
296089294203 unnamed protein product [Vitis vinifera] 0.727 0.748 0.716 4e-60
449526848242 PREDICTED: N(6)-adenine-specific DNA met 0.794 0.685 0.676 6e-60
224139948221 predicted protein [Populus trichocarpa] 0.818 0.773 0.653 9e-60
449451189242 PREDICTED: N(6)-adenine-specific DNA met 0.794 0.685 0.676 1e-59
297820680248 hypothetical protein ARALYDRAFT_907327 [ 0.861 0.725 0.627 7e-59
255581584239 conserved hypothetical protein [Ricinus 0.770 0.673 0.666 2e-58
18410963248 nucleic acid binding / methyltransferase 0.861 0.725 0.606 2e-57
356530663236 PREDICTED: N(6)-adenine-specific DNA met 0.794 0.703 0.639 7e-57
356500399235 PREDICTED: N(6)-adenine-specific DNA met 0.789 0.702 0.627 5e-56
>gi|359481089|ref|XP_002265324.2| PREDICTED: N(6)-adenine-specific DNA methyltransferase 2-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  251 bits (640), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 124/175 (70%), Positives = 144/175 (82%), Gaps = 10/175 (5%)

Query: 37  EEDDDRPMLSSQALAALQEFLSEQNQTSETAQNKTESDSDEVALVSEDWRLSQFWYDAVT 96
           + DDD P LSS+A+AAL++FLSEQ QT          D+D V+LVSEDWRLSQFWYD  T
Sbjct: 9   DSDDDTPRLSSEAMAALRQFLSEQTQT--------HVDADSVSLVSEDWRLSQFWYDPQT 60

Query: 97  AETVAQEAVSLCSDSDS--RVACIACPTLYAYLKKIRPEVSPKILEYDMRFEQYGSDFAF 154
           AETV++E ++LC  SDS  RVAC+ACPTLYAYLKKI P VS ++LEYD RFEQYGSDF F
Sbjct: 61  AETVSKEVLTLCDSSDSLVRVACVACPTLYAYLKKIDPNVSLQLLEYDKRFEQYGSDFTF 120

Query: 155 YDYNQPQDLPLELKHAFSVVVVDPPYLSKECLEKVSETVSFLARPGDSKLLLLTG 209
           YDYNQP++LP ELKHAF VVV DPPYLSKECLEKV++T+SFLARPG+S LLLLTG
Sbjct: 121 YDYNQPEELPPELKHAFQVVVADPPYLSKECLEKVAQTISFLARPGESFLLLLTG 175

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|296089294|emb|CBI39066.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449526848|ref|XP_004170425.1| PREDICTED: N(6)-adenine-specific DNA methyltransferase 2-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|224139948|ref|XP_002323354.1| predicted protein [Populus trichocarpa] gi|222867984|gb|EEF05115.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449451189|ref|XP_004143344.1| PREDICTED: N(6)-adenine-specific DNA methyltransferase 2-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|297820680|ref|XP_002878223.1| hypothetical protein ARALYDRAFT_907327 [Arabidopsis lyrata subsp. lyrata] gi|297324061|gb|EFH54482.1| hypothetical protein ARALYDRAFT_907327 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|255581584|ref|XP_002531597.1| conserved hypothetical protein [Ricinus communis] gi|223528793|gb|EEF30800.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|18410963|ref|NP_567065.1| nucleic acid binding / methyltransferase [Arabidopsis thaliana] gi|16648683|gb|AAL25534.1| AT3g58470/F14P22_60 [Arabidopsis thaliana] gi|22137250|gb|AAM91470.1| AT3g58470/F14P22_60 [Arabidopsis thaliana] gi|332646265|gb|AEE79786.1| nucleic acid binding / methyltransferase [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|356530663|ref|XP_003533900.1| PREDICTED: N(6)-adenine-specific DNA methyltransferase 2-like [Glycine max] Back     alignment and taxonomy information
>gi|356500399|ref|XP_003519019.1| PREDICTED: N(6)-adenine-specific DNA methyltransferase 2-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query209
TAIR|locus:2076411248 AT3G58470 [Arabidopsis thalian 0.794 0.669 0.573 1.8e-48
UNIPROTKB|Q8WVE0214 N6AMT2 "N(6)-adenine-specific 0.760 0.742 0.443 7.4e-34
RGD|1306762224 N6amt2 "N-6 adenine-specific D 0.760 0.709 0.455 9.5e-34
MGI|MGI:1915293214 N6amt2 "N-6 adenine-specific D 0.760 0.742 0.443 8.5e-33
UNIPROTKB|E2R958214 N6AMT2 "Uncharacterized protei 0.760 0.742 0.426 1.8e-32
UNIPROTKB|Q17QF2226 N6AMT2 "N(6)-adenine-specific 0.765 0.707 0.431 9.8e-32
UNIPROTKB|Q5ZKT6213 N6AMT2 "N(6)-adenine-specific 0.775 0.760 0.431 3.3e-31
DICTYBASE|DDB_G0272708211 DDB_G0272708 "N(6)-adenine-spe 0.727 0.720 0.371 1.4e-23
FB|FBgn0031777223 CG9154 [Drosophila melanogaste 0.779 0.730 0.362 1e-22
WB|WBGene00043057218 M142.8 [Caenorhabditis elegans 0.765 0.733 0.335 1.6e-22
TAIR|locus:2076411 AT3G58470 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 506 (183.2 bits), Expect = 1.8e-48, P = 1.8e-48
 Identities = 98/171 (57%), Positives = 124/171 (72%)

Query:    44 MLSSQALAALQEFLSEQNQTSETAQNKTE----SDSDEVALVSEDWRLSQFWYDXXXXXX 99
             +LSSQALAAL+EFL++QN+T  +    +      +SD+V LV+EDWRLSQFWY+      
Sbjct:    29 VLSSQALAALREFLADQNKTVASTPPASSVAGGEESDKVELVTEDWRLSQFWYEPETAET 88

Query:   100 XXXXXXSLCSDSDS-RVACIACPTLYAYLKKIRPEVSPKILEYDMRFEQYGSDFAFYDYN 158
                   +L       RVACIACPTLY YLKK  P +  ++LEYDMRFE+YG +F FYDYN
Sbjct:    89 VADEVVTLSQRIPGCRVACIACPTLYVYLKKRDPSLQVQLLEYDMRFERYGKEFTFYDYN 148

Query:   159 QPQDLPLELKHAFSVVVVDPPYLSKECLEKVSETVSFLARPGDSKLLLLTG 209
             +P+DLPL+LKH F ++V DPPYLS+ECLE+VS+T+ FLA P DS LLLLTG
Sbjct:   149 EPEDLPLQLKHCFHIIVADPPYLSRECLERVSQTILFLASPVDSLLLLLTG 199
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0005737 "cytoplasm" evidence=ISM
GO:0008168 "methyltransferase activity" evidence=IEA
GO:0032259 "methylation" evidence=IEA
UNIPROTKB|Q8WVE0 N6AMT2 "N(6)-adenine-specific DNA methyltransferase 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|1306762 N6amt2 "N-6 adenine-specific DNA methyltransferase 2 (putative)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:1915293 N6amt2 "N-6 adenine-specific DNA methyltransferase 2 (putative)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E2R958 N6AMT2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q17QF2 N6AMT2 "N(6)-adenine-specific DNA methyltransferase 2" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZKT6 N6AMT2 "N(6)-adenine-specific DNA methyltransferase 2" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0272708 DDB_G0272708 "N(6)-adenine-specific DNA methyltransferase" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
FB|FBgn0031777 CG9154 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
WB|WBGene00043057 M142.8 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.1.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
gw1.XVI.2010.1
hypothetical protein (221 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query209
pfam10237161 pfam10237, N6-adenineMlase, Probable N6-adenine me 8e-51
>gnl|CDD|220643 pfam10237, N6-adenineMlase, Probable N6-adenine methyltransferase Back     alignment and domain information 
 Score =  161 bits (409), Expect = 8e-51
 Identities = 60/125 (48%), Positives = 83/125 (66%), Gaps = 3/125 (2%)

Query: 86  RLSQFWYDAVTAETVAQEAVSLCSDSDSRVACIACPTLYAYLKKIR-PEVSPKILEYDMR 144
           +LSQFWY   TAE +A+  +    D  + +AC++ P++YA LK+   P  +  +LEYD R
Sbjct: 1   QLSQFWYSDETAEKLAKALLEGA-DEGTVIACVSAPSVYAALKERPIPTKNVYLLEYDKR 59

Query: 145 FEQYGSDFAFYDYNQPQDLPLELKHAFSVVVVDPPYLSKECLEKVSETVSFLARPGDSKL 204
           F  YG +F FYDYN+P +LP +LK  F  V+ DPP+LS+ECL K + T+  L +P DSKL
Sbjct: 60  FAVYGGEFVFYDYNKPLELPEQLKGKFDRVIADPPFLSEECLTKTAITIKLLLKP-DSKL 118

Query: 205 LLLTG 209
           LL TG
Sbjct: 119 LLCTG 123

This is a protein of approximately 200 residues which is conserved from plants to humans. It contains a highly conserved QFW motif close to the N-terminus and a DPPF motif in the centre. The DPPF motif is characteristic of N-6 adenine-specific DNA methylases, and this family is found in eukaryotes. Length = 161

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 209
KOG3350217 consensus Uncharacterized conserved protein [Funct 100.0
PF10237162 N6-adenineMlase: Probable N6-adenine methyltransfe 100.0
PF01861243 DUF43: Protein of unknown function DUF43; InterPro 98.74
KOG4399 325 consensus C2HC-type Zn-finger protein [General fun 97.83
COG1568354 Predicted methyltransferases [General function pre 97.61
TIGR03704251 PrmC_rel_meth putative protein-(glutamine-N5) meth 97.5
PRK14967223 putative methyltransferase; Provisional 97.22
TIGR03534251 RF_mod_PrmC protein-(glutamine-N5) methyltransfera 97.18
PRK09328275 N5-glutamine S-adenosyl-L-methionine-dependent met 97.0
PRK15128396 23S rRNA m(5)C1962 methyltransferase; Provisional 96.47
TIGR00537179 hemK_rel_arch HemK-related putative methylase. The 96.36
PRK10901427 16S rRNA methyltransferase B; Provisional 96.15
PRK11805307 N5-glutamine S-adenosyl-L-methionine-dependent met 95.87
TIGR01177329 conserved hypothetical protein TIGR01177. This fam 95.59
PF05175170 MTS: Methyltransferase small domain; InterPro: IPR 95.57
TIGR00536284 hemK_fam HemK family putative methylases. The gene 95.51
TIGR03533284 L3_gln_methyl protein-(glutamine-N5) methyltransfe 95.5
PRK14966423 unknown domain/N5-glutamine S-adenosyl-L-methionin 95.21
PRK11783702 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi 95.02
PRK14968188 putative methyltransferase; Provisional 94.94
PRK09489342 rsmC 16S ribosomal RNA m2G1207 methyltransferase; 94.6
KOG2671421 consensus Putative RNA methylase [Replication, rec 93.96
PHA03412241 putative methyltransferase; Provisional 93.92
PRK11524 284 putative methyltransferase; Provisional 93.49
cd02440107 AdoMet_MTases S-adenosylmethionine-dependent methy 93.46
PRK14902444 16S rRNA methyltransferase B; Provisional 93.15
PRK14903431 16S rRNA methyltransferase B; Provisional 93.13
TIGR00563426 rsmB ribosomal RNA small subunit methyltransferase 93.04
PRK14901434 16S rRNA methyltransferase B; Provisional 93.01
PRK01544 506 bifunctional N5-glutamine S-adenosyl-L-methionine- 91.97
PF03602183 Cons_hypoth95: Conserved hypothetical protein 95; 91.9
PF01170179 UPF0020: Putative RNA methylase family UPF0020; In 91.63
COG0742187 N6-adenine-specific methylase [DNA replication, re 91.33
PRK00312212 pcm protein-L-isoaspartate O-methyltransferase; Re 91.02
TIGR00446264 nop2p NOL1/NOP2/sun family putative RNA methylase. 90.37
COG2263198 Predicted RNA methylase [Translation, ribosomal st 90.12
PF13659117 Methyltransf_26: Methyltransferase domain; PDB: 3G 90.0
COG1041347 Predicted DNA modification methylase [DNA replicat 89.41
PRK14904445 16S rRNA methyltransferase B; Provisional 89.41
PF10672286 Methyltrans_SAM: S-adenosylmethionine-dependent me 89.07
COG2890280 HemK Methylase of polypeptide chain release factor 88.84
PRK10909199 rsmD 16S rRNA m(2)G966-methyltransferase; Provisio 88.81
PRK00811283 spermidine synthase; Provisional 87.68
PRK15001378 SAM-dependent 23S ribosomal RNA mG1835 methyltrans 87.63
PHA03411 279 putative methyltransferase; Provisional 87.14
TIGR00417270 speE spermidine synthase. the SpeE subunit of sper 85.97
PRK13168443 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewe 85.8
TIGR00438188 rrmJ cell division protein FtsJ. 84.93
TIGR02085374 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransfer 84.68
TIGR00095189 RNA methyltransferase, RsmD family. This model rep 83.26
PRK03612 521 spermidine synthase; Provisional 83.21
KOG3420185 consensus Predicted RNA methylase [Translation, ri 82.89
TIGR00477195 tehB tellurite resistance protein TehB. Part of a 82.59
TIGR00080215 pimt protein-L-isoaspartate(D-aspartate) O-methylt 82.37
PRK05134233 bifunctional 3-demethylubiquinone-9 3-methyltransf 82.26
COG1092393 Predicted SAM-dependent methyltransferases [Genera 81.62
PRK00517250 prmA ribosomal protein L11 methyltransferase; Revi 81.23
PF12847112 Methyltransf_18: Methyltransferase domain; PDB: 3G 81.15
PRK01581 374 speE spermidine synthase; Validated 80.02
>KOG3350 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information 
Probab=100.00  E-value=1.2e-63  Score=423.56  Aligned_cols=170  Identities=51%  Similarity=0.859  Sum_probs=155.8

Q ss_pred             CCcCCCCCCCCCCHHHHHHHHHHHHHHHhhhHhhhcccCCCCcccccCcccccccccccChHHHHHHHHHHHhhcCCCCC
Q 028404           34 VEVEEDDDRPMLSSQALAALQEFLSEQNQTSETAQNKTESDSDEVALVSEDWRLSQFWYDAVTAETVAQEAVSLCSDSDS  113 (209)
Q Consensus        34 ~~~~~ddd~~~LSa~tLaAL~eF~~E~~~~~~~f~~~~~~~~~~~~~~~EDwqlSQFWYSd~Ta~~La~~l~~~a~~~~~  113 (209)
                      |++.+|||+|+|||+|||||+||++||+++++.+++.    ...|..++||||||||||+++|++.||.+++.+++ +++
T Consensus         1 ~sD~e~Dd~~~LsA~aLAaL~eF~aEq~k~~e~~~~~----~~~i~~~~eDwQlsqfwy~~eta~~La~e~v~~s~-e~~   75 (217)
T KOG3350|consen    1 DSDVEDDDDLQLSADALAALNEFLAEQQKRIEEEENQ----SDIIEKIGEDWQLSQFWYSDETARKLAAERVEASG-EGS   75 (217)
T ss_pred             CCccccCcccccCHHHHHHHHHHHHHHHhhhhccCch----hhhhhhcccchhhhhhhcCHHHHHHHHHHHHhhcc-cCc
Confidence            4566778999999999999999999999998776522    24688999999999999999999999999999998 889


Q ss_pred             eEEEEeCchHHHHHHhh---CCCCCceEEeecccccccCCcceeecCCCCCCchHhhcccccEEEECCCCCCHHHHHHHH
Q 028404          114 RVACIACPTLYAYLKKI---RPEVSPKILEYDMRFEQYGSDFAFYDYNQPQDLPLELKHAFSVVVVDPPYLSKECLEKVS  190 (209)
Q Consensus       114 rIaclstPSly~~Lk~~---~~~~~~~LLE~D~RF~~~g~~FvfYDyn~P~~lp~~lk~~fD~Vv~DPPFlseec~~K~A  190 (209)
                      |||||||||||...++.   .|..+++|||||+||+.||.+|+|||||.|+++|.+|++.||+||+|||||++||+.|++
T Consensus        76 rIacvS~Psly~y~k~re~~~~~~~v~lfEfDkRFe~yg~eFvfYDyN~p~dlp~~lk~~fdiivaDPPfL~~eCl~Kts  155 (217)
T KOG3350|consen   76 RIACVSCPSLYVYQKKREIEIPHDQVYLFEFDKRFELYGTEFVFYDYNCPLDLPDELKAHFDIIVADPPFLSEECLAKTS  155 (217)
T ss_pred             eEEEEeCchHHhhhhhhhccCCceeEEEEEehhhHHhccceeEEeccCCCCCCHHHHHhcccEEEeCCccccchhhhhhH
Confidence            99999999988655543   477899999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHhcCCCCCcEEEecC
Q 028404          191 ETVSFLARPGDSKLLLLTG  209 (209)
Q Consensus       191 ~Tik~L~k~~~~kiilcTG  209 (209)
                      +|||.|.++ ..|||||||
T Consensus       156 ~tik~L~r~-~~kvilCtG  173 (217)
T KOG3350|consen  156 ETIKRLQRN-QKKVILCTG  173 (217)
T ss_pred             HHHHHHhcC-CceEEEech
Confidence            999999998 559999999

>PF10237 N6-adenineMlase: Probable N6-adenine methyltransferase; InterPro: IPR019369 This family of proteins, which are of approximately 200 residues in length, contain a highly conserved Glu-Phe-Trp (QFW) motif close to the N terminus and an Asp/Asn-Pro-Pro-Tyr/Phe motif in the centre Back     alignment and domain information
>PF01861 DUF43: Protein of unknown function DUF43; InterPro: IPR002723 This family of prokaryotic proteins have not been characterised Back     alignment and domain information
>KOG4399 consensus C2HC-type Zn-finger protein [General function prediction only] Back     alignment and domain information
>COG1568 Predicted methyltransferases [General function prediction only] Back     alignment and domain information
>TIGR03704 PrmC_rel_meth putative protein-(glutamine-N5) methyltransferase, unknown substrate-specific Back     alignment and domain information
>PRK14967 putative methyltransferase; Provisional Back     alignment and domain information
>TIGR03534 RF_mod_PrmC protein-(glutamine-N5) methyltransferase, release factor-specific Back     alignment and domain information
>PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PRK15128 23S rRNA m(5)C1962 methyltransferase; Provisional Back     alignment and domain information
>TIGR00537 hemK_rel_arch HemK-related putative methylase Back     alignment and domain information
>PRK10901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK11805 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>TIGR01177 conserved hypothetical protein TIGR01177 Back     alignment and domain information
>PF05175 MTS: Methyltransferase small domain; InterPro: IPR007848 This domain is found in ribosomal RNA small subunit methyltransferase C and in other methyltransferases Back     alignment and domain information
>TIGR00536 hemK_fam HemK family putative methylases Back     alignment and domain information
>TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific Back     alignment and domain information
>PRK14966 unknown domain/N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase fusion protein; Provisional Back     alignment and domain information
>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional Back     alignment and domain information
>PRK14968 putative methyltransferase; Provisional Back     alignment and domain information
>PRK09489 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provisional Back     alignment and domain information
>KOG2671 consensus Putative RNA methylase [Replication, recombination and repair] Back     alignment and domain information
>PHA03412 putative methyltransferase; Provisional Back     alignment and domain information
>PRK11524 putative methyltransferase; Provisional Back     alignment and domain information
>cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) Back     alignment and domain information
>PRK14902 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK14903 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>TIGR00563 rsmB ribosomal RNA small subunit methyltransferase RsmB Back     alignment and domain information
>PRK14901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>PF03602 Cons_hypoth95: Conserved hypothetical protein 95; InterPro: IPR004398 This entry contains Ribosomal RNA small subunit methyltransferase D as well as the putative rRNA methyltransferase YlbH Back     alignment and domain information
>PF01170 UPF0020: Putative RNA methylase family UPF0020; InterPro: IPR000241 This domain is probably a methylase Back     alignment and domain information
>COG0742 N6-adenine-specific methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed Back     alignment and domain information
>TIGR00446 nop2p NOL1/NOP2/sun family putative RNA methylase Back     alignment and domain information
>COG2263 Predicted RNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF13659 Methyltransf_26: Methyltransferase domain; PDB: 3GJY_A 3LPM_B 2NP6_D 1AQI_B 2ADM_B 2IH2_A 2JG3_A 2IBS_D 2NP7_A 2IBT_A Back     alignment and domain information
>COG1041 Predicted DNA modification methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14904 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PF10672 Methyltrans_SAM: S-adenosylmethionine-dependent methyltransferase; InterPro: IPR019614 Members of this entry are S-adenosylmethionine-dependent methyltransferases from gamma-proteobacterial species Back     alignment and domain information
>COG2890 HemK Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK10909 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional Back     alignment and domain information
>PRK00811 spermidine synthase; Provisional Back     alignment and domain information
>PRK15001 SAM-dependent 23S ribosomal RNA mG1835 methyltransferase; Provisional Back     alignment and domain information
>PHA03411 putative methyltransferase; Provisional Back     alignment and domain information
>TIGR00417 speE spermidine synthase Back     alignment and domain information
>PRK13168 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewed Back     alignment and domain information
>TIGR00438 rrmJ cell division protein FtsJ Back     alignment and domain information
>TIGR02085 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransferase RumB Back     alignment and domain information
>TIGR00095 RNA methyltransferase, RsmD family Back     alignment and domain information
>PRK03612 spermidine synthase; Provisional Back     alignment and domain information
>KOG3420 consensus Predicted RNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00477 tehB tellurite resistance protein TehB Back     alignment and domain information
>TIGR00080 pimt protein-L-isoaspartate(D-aspartate) O-methyltransferase Back     alignment and domain information
>PRK05134 bifunctional 3-demethylubiquinone-9 3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol methylase; Provisional Back     alignment and domain information
>COG1092 Predicted SAM-dependent methyltransferases [General function prediction only] Back     alignment and domain information
>PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed Back     alignment and domain information
>PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A Back     alignment and domain information
>PRK01581 speE spermidine synthase; Validated Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query209
2b3t_A276 Protein methyltransferase HEMK; translation termin 97.1
2qm3_A373 Predicted methyltransferase; putative methyltransf 97.04
4dzr_A215 Protein-(glutamine-N5) methyltransferase, release 96.73
3p9n_A189 Possible methyltransferase (methylase); RV2966C, a 96.71
1dus_A194 MJ0882; hypothetical protein, methanococcus jannas 96.3
1ej0_A180 FTSJ; methyltransferase, adoMet, adenosyl methioni 96.18
3evz_A230 Methyltransferase; NYSGXRC, NEW YORK SGX research 96.05
3q87_B170 N6 adenine specific DNA methylase; SAM-methyltrans 95.87
3tma_A354 Methyltransferase; thump domain; 2.05A {Thermus th 95.19
1ws6_A171 Methyltransferase; structural genomics, riken stru 95.18
1sqg_A429 SUN protein, FMU protein; rossmann-fold, mixed bet 95.07
3lpm_A259 Putative methyltransferase; structural genomics, p 94.96
1wy7_A207 Hypothetical protein PH1948; seven-stranded beta s 94.91
3m6w_A 464 RRNA methylase; rRNA methyltransferase, 5-methylcy 94.47
3dmg_A381 Probable ribosomal RNA small subunit methyltransf; 94.45
3ajd_A274 Putative methyltransferase MJ0026; tRNA, M5C, ross 94.28
2esr_A177 Methyltransferase; structural genomics, hypothetic 94.21
3mti_A185 RRNA methylase; SAM-dependent, PSI, MCSG, structur 94.07
3ofk_A216 Nodulation protein S; NODS, N-methyltransferase, S 94.05
2yxl_A450 PH0851 protein, 450AA long hypothetical FMU protei 94.05
4dmg_A393 Putative uncharacterized protein TTHA1493; rRNA, m 93.97
2kw5_A202 SLR1183 protein; structural genomics, northeast st 93.96
1boo_A 323 Protein (N-4 cytosine-specific methyltransferase P 93.91
2ih2_A 421 Modification methylase TAQI; DNA, DNA methyltransf 93.85
1g60_A 260 Adenine-specific methyltransferase MBOIIA; structu 93.82
2gpy_A233 O-methyltransferase; structural genomics, PSI, pro 93.65
2frx_A 479 Hypothetical protein YEBU; rossmann-type S-adenosy 93.53
1ve3_A227 Hypothetical protein PH0226; dimer, riken structur 93.47
2zig_A 297 TTHA0409, putative modification methylase; methylt 93.46
2yx1_A336 Hypothetical protein MJ0883; methyl transferase, t 93.45
2ift_A201 Putative methylase HI0767; NESG, Y767_haein, struc 93.44
3eey_A197 Putative rRNA methylase; rRNA methylation, S-adeno 93.4
4df3_A233 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 93.29
2igt_A332 SAM dependent methyltransferase; alpha-beta sandwi 93.23
1nv8_A284 HEMK protein; class I adoMet-dependent methyltrans 93.02
4dcm_A375 Ribosomal RNA large subunit methyltransferase G; 2 92.94
3ntv_A232 MW1564 protein; rossmann fold, putative methyltran 92.92
2pxx_A215 Uncharacterized protein MGC2408; structural genomi 92.6
3hm2_A178 Precorrin-6Y C5,15-methyltransferase; alpha-beta-s 92.58
3cgg_A195 SAM-dependent methyltransferase; NP_600671.1, meth 92.45
1o9g_A250 RRNA methyltransferase; antibiotic resistance, Se- 92.28
2frn_A278 Hypothetical protein PH0793; structural genomics, 92.22
3tr6_A225 O-methyltransferase; cellular processes; HET: SAH; 92.18
3duw_A223 OMT, O-methyltransferase, putative; alternating of 92.07
2ozv_A260 Hypothetical protein ATU0636; structural genomics, 92.05
3gu3_A 284 Methyltransferase; alpha-beta protein, structural 91.95
2pjd_A343 Ribosomal RNA small subunit methyltransferase C; g 91.91
1ixk_A315 Methyltransferase; open beta sheet; 1.90A {Pyrococ 91.89
2avd_A229 Catechol-O-methyltransferase; structural genomics, 91.88
3v97_A703 Ribosomal RNA large subunit methyltransferase L; Y 91.85
1ne2_A200 Hypothetical protein TA1320; structural genomics, 91.81
3m4x_A 456 NOL1/NOP2/SUN family protein; mtase domain, PUA do 91.76
1eg2_A 319 Modification methylase RSRI; rossmann fold, exocyc 91.68
2ipx_A233 RRNA 2'-O-methyltransferase fibrillarin; FBL, stru 91.53
3bzb_A281 Uncharacterized protein; RED ALGA, protein structu 91.45
3e05_A204 Precorrin-6Y C5,15-methyltransferase (decarboxyla; 90.66
3grz_A205 L11 mtase, ribosomal protein L11 methyltransferase 90.62
1wxx_A382 TT1595, hypothetical protein TTHA1280; thermus the 90.44
2yxe_A215 Protein-L-isoaspartate O-methyltransferase; rossma 90.07
3adn_A294 Spermidine synthase; aminopropyltransferase, polya 90.06
2as0_A396 Hypothetical protein PH1915; RNA methyltransferase 90.04
3c0k_A396 UPF0064 protein YCCW; PUA domain, adoMet dependent 90.03
2fhp_A187 Methylase, putative; alpha-beta-alpha sandwich, st 89.66
2oo3_A283 Protein involved in catabolism of external DNA; st 89.44
1vbf_A231 231AA long hypothetical protein-L-isoaspartate O- 89.33
1mjf_A281 Spermidine synthase; spermidine synthetase, struct 89.23
2b78_A385 Hypothetical protein SMU.776; structure genomics, 89.05
3tfw_A248 Putative O-methyltransferase; PSI-biology, nysgrc, 88.95
3bwc_A304 Spermidine synthase; SAM, SGPP, structura genomics 88.78
3dou_A191 Ribosomal RNA large subunit methyltransferase J; c 88.54
2b2c_A314 Spermidine synthase; beta-alpha, transferase; 2.50 88.51
3gdh_A241 Trimethylguanosine synthase homolog; M7G, CAP, dim 88.29
3u81_A221 Catechol O-methyltransferase; neurotransmitter deg 88.29
1yf3_A259 DNA adenine methylase; T4DAM, methyltransferase, t 87.99
3mb5_A255 SAM-dependent methyltransferase; RNA methyltransfe 87.98
3bt7_A369 TRNA (uracil-5-)-methyltransferase; methyluridine, 87.97
2fpo_A202 Methylase YHHF; structural genomics, putative meth 87.96
1sui_A247 Caffeoyl-COA O-methyltransferase; rossmann fold, p 87.68
3pfg_A 263 N-methyltransferase; N,N-dimethyltransferase, SAM 87.3
2yxd_A183 Probable cobalt-precorrin-6Y C(15)-methyltransfer 87.12
1fbn_A230 MJ fibrillarin homologue; MJ proteins, ribosomal R 86.98
2jjq_A425 Uncharacterized RNA methyltransferase pyrab10780; 86.96
3a27_A272 TYW2, uncharacterized protein MJ1557; wybutosine m 86.61
3r3h_A242 O-methyltransferase, SAM-dependent; structural gen 86.54
3ldg_A384 Putative uncharacterized protein SMU.472; YPSC, me 86.38
3lbf_A210 Protein-L-isoaspartate O-methyltransferase; modifi 86.33
2hnk_A239 SAM-dependent O-methyltransferase; modified rossma 86.16
2p35_A 259 Trans-aconitate 2-methyltransferase; SAM dependent 86.04
1iy9_A275 Spermidine synthase; rossmann fold, structural gen 86.04
2pt6_A321 Spermidine synthase; transferase, structural genom 85.94
3k0b_A393 Predicted N6-adenine-specific DNA methylase; methy 85.45
3dr5_A221 Putative O-methyltransferase; Q8NRD3, CGL1119, PF0 85.44
1inl_A296 Spermidine synthase; beta-barrel, rossman fold, st 85.33
2i7c_A283 Spermidine synthase; transferase, structural genom 85.24
2nxc_A254 L11 mtase, ribosomal protein L11 methyltransferase 85.21
2plw_A201 Ribosomal RNA methyltransferase, putative; malaria 85.19
2h00_A254 Methyltransferase 10 domain containing protein; st 85.17
1g8a_A227 Fibrillarin-like PRE-rRNA processing protein; rRNA 85.02
2b9e_A309 NOL1/NOP2/SUN domain family, member 5 isoform 2; m 84.82
3cbg_A232 O-methyltransferase; cyanobacterium; HET: SAH FER 84.78
1uwv_A433 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA m 84.54
3dtn_A234 Putative methyltransferase MM_2633; structural gen 84.32
3e8s_A227 Putative SAM dependent methyltransferase; NP_74470 84.25
3id6_C232 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 83.99
1i1n_A226 Protein-L-isoaspartate O-methyltransferase; S-aden 83.9
3ldu_A385 Putative methylase; structural genomics, PSI-2, pr 83.82
2qfm_A364 Spermine synthase; spermidine aminopropyltransfera 83.69
1o54_A277 SAM-dependent O-methyltransferase; TM0748, structu 83.34
1l3i_A192 Precorrin-6Y methyltransferase/putative decarboxyl 82.46
2dpm_A284 M.dpnii 1, protein (adenine-specific methyltransfe 82.44
1jg1_A235 PIMT;, protein-L-isoaspartate O-methyltransferase; 82.19
2nyu_A196 Putative ribosomal RNA methyltransferase 2; SAM, s 82.11
1uir_A 314 Polyamine aminopropyltransferase; spermidien synth 81.93
2g1p_A278 DNA adenine methylase; DAM methylation, GATC recog 81.78
3gru_A 295 Dimethyladenosine transferase; rossman fold, ribos 81.57
3c3y_A237 Pfomt, O-methyltransferase; plant secondary metabo 81.39
3d2l_A 243 SAM-dependent methyltransferase; ZP_00538691.1, st 81.19
3dp7_A363 SAM-dependent methyltransferase; structural genomi 81.12
1yzh_A214 TRNA (guanine-N(7)-)-methyltransferase; alpha-beta 80.83
2pwy_A258 TRNA (adenine-N(1)-)-methyltransferase; mtase, ado 80.64
1jsx_A207 Glucose-inhibited division protein B; methyltransf 80.58
2pbf_A227 Protein-L-isoaspartate O-methyltransferase beta-A 80.53
1r18_A227 Protein-L-isoaspartate(D-aspartate)-O-methyltrans; 80.51
3m70_A286 Tellurite resistance protein TEHB homolog; structu 80.39
2p8j_A209 S-adenosylmethionine-dependent methyltransferase; 80.38
2o07_A304 Spermidine synthase; structural genomics, structur 80.34
3g2m_A 299 PCZA361.24; SAM-dependent methyltransferase, glyco 80.02
>2b3t_A Protein methyltransferase HEMK; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: c.66.1.30 PDB: 1t43_A* Back     alignment and structure
Probab=97.10  E-value=0.0034  Score=52.50  Aligned_cols=150  Identities=17%  Similarity=0.222  Sum_probs=87.7

Q ss_pred             CCCHHHHHHHHHHHHHHHhhh-HhhhcccCCCCcccccCccccccc-----ccccChHHHHHHHHHHHhhcCCCCCeEEE
Q 028404           44 MLSSQALAALQEFLSEQNQTS-ETAQNKTESDSDEVALVSEDWRLS-----QFWYDAVTAETVAQEAVSLCSDSDSRVAC  117 (209)
Q Consensus        44 ~LSa~tLaAL~eF~~E~~~~~-~~f~~~~~~~~~~~~~~~EDwqlS-----QFWYSd~Ta~~La~~l~~~a~~~~~rIac  117 (209)
                      .|+.+..+.|+++..++..+. -++-          ....+-|.+.     ..+......+.|++.+++....++.+|+=
T Consensus        46 ~~~~~~~~~~~~~~~~~~~~~p~~~i----------~g~~~f~~~~~~~~~~~~ipr~~te~l~~~~l~~~~~~~~~vLD  115 (276)
T 2b3t_A           46 QLTDEQCQQLDALLTRRRDGEPIAHL----------TGVREFWSLPLFVSPATLIPRPDTECLVEQALARLPEQPCRILD  115 (276)
T ss_dssp             BCCHHHHHHHHHHHHHHHTTCCHHHH----------SCEEEETTEEEECCTTSCCCCTTHHHHHHHHHHHSCSSCCEEEE
T ss_pred             CCCHHHHHHHHHHHHHHHcCCChhHe----------eeeeEECCceEEeCCCCcccCchHHHHHHHHHHhcccCCCEEEE
Confidence            588889999999887765442 1111          1111223221     11122234566677776654225679999


Q ss_pred             EeCchHH--HHHHhhCCCCCceEEeeccccc--------ccC-C--cceeecCCCCCCchHhhcccccEEEECCCCCCH-
Q 028404          118 IACPTLY--AYLKKIRPEVSPKILEYDMRFE--------QYG-S--DFAFYDYNQPQDLPLELKHAFSVVVVDPPYLSK-  183 (209)
Q Consensus       118 lstPSly--~~Lk~~~~~~~~~LLE~D~RF~--------~~g-~--~FvfYDyn~P~~lp~~lk~~fD~Vv~DPPFlse-  183 (209)
                      |||=|=.  ..+.+..|..+++.+|++..--        .+| +  +|+.-|...+  ++   .++||+||++|||... 
T Consensus       116 lG~GsG~~~~~la~~~~~~~v~~vD~s~~~l~~a~~n~~~~~~~~v~~~~~d~~~~--~~---~~~fD~Iv~npPy~~~~  190 (276)
T 2b3t_A          116 LGTGTGAIALALASERPDCEIIAVDRMPDAVSLAQRNAQHLAIKNIHILQSDWFSA--LA---GQQFAMIVSNPPYIDEQ  190 (276)
T ss_dssp             ETCTTSHHHHHHHHHCTTSEEEEECSSHHHHHHHHHHHHHHTCCSEEEECCSTTGG--GT---TCCEEEEEECCCCBCTT
T ss_pred             ecCCccHHHHHHHHhCCCCEEEEEECCHHHHHHHHHHHHHcCCCceEEEEcchhhh--cc---cCCccEEEECCCCCCcc
Confidence            9887533  3444445777899999986432        222 1  3555555443  22   4689999999999764 


Q ss_pred             ------------------------HHHHHHHHHHHHhcCCCCCcEEEecC
Q 028404          184 ------------------------ECLEKVSETVSFLARPGDSKLLLLTG  209 (209)
Q Consensus       184 ------------------------ec~~K~A~Tik~L~k~~~~kiilcTG  209 (209)
                                              +.+.++...+..++++ ++.+++.+|
T Consensus       191 ~~~l~~~v~~~~p~~al~~~~~g~~~~~~~l~~~~~~Lkp-gG~l~~~~~  239 (276)
T 2b3t_A          191 DPHLQQGDVRFEPLTALVAADSGMADIVHIIEQSRNALVS-GGFLLLEHG  239 (276)
T ss_dssp             CHHHHSSGGGSSCSTTTBCHHHHTHHHHHHHHHHGGGEEE-EEEEEEECC
T ss_pred             ccccChhhhhcCcHHHHcCCCcHHHHHHHHHHHHHHhcCC-CCEEEEEEC
Confidence                                    2345555556666666 556776543
>2qm3_A Predicted methyltransferase; putative methyltransferase, structural genomics, pyrococcus PSI-2, protein structure initiative; HET: MSE; 2.05A {Pyrococcus furiosus dsm 3638} Back     alignment and structure
>4dzr_A Protein-(glutamine-N5) methyltransferase, release specific; structural genomics, PSI-biology; 2.55A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>3p9n_A Possible methyltransferase (methylase); RV2966C, adoMet binding, RNA methylase, RSMD, SAM-fold, RNA methyltransferase; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 Back     alignment and structure
>1ej0_A FTSJ; methyltransferase, adoMet, adenosyl methionine, heat shock proteins, 23S ribosomal RNA; HET: SAM; 1.50A {Escherichia coli} SCOP: c.66.1.2 PDB: 1eiz_A* Back     alignment and structure
>3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research CE structural genomics, protein structure initiative, pyrococc furiosus, PSI-2; 2.20A {Pyrococcus furiosus} Back     alignment and structure
>3q87_B N6 adenine specific DNA methylase; SAM-methyltransferase, methyltransferase, methylation, trans activator-transferase complex; HET: SAM; 2.00A {Encephalitozoon cuniculi} Back     alignment and structure
>3tma_A Methyltransferase; thump domain; 2.05A {Thermus thermophilus} Back     alignment and structure
>1ws6_A Methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Thermus thermophilus} SCOP: c.66.1.46 Back     alignment and structure
>1sqg_A SUN protein, FMU protein; rossmann-fold, mixed beta sheet, methyltransferase-fold, RNA-binding domain; 1.65A {Escherichia coli} SCOP: a.79.1.3 c.66.1.38 PDB: 1sqf_A Back     alignment and structure
>3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes} Back     alignment and structure
>1wy7_A Hypothetical protein PH1948; seven-stranded beta sheet, methyltransferase fold, structura genomics, transferase; HET: SAH; 2.20A {Pyrococcus horikoshii} SCOP: c.66.1.32 Back     alignment and structure
>3m6w_A RRNA methylase; rRNA methyltransferase, 5-methylcytidine, RSMF, adoMet, MULT specific, methyltransferase, transferase; HET: CXM SAM; 1.30A {Thermus thermophilus} PDB: 3m6v_A* 3m6u_A* 3m6x_A* Back     alignment and structure
>3dmg_A Probable ribosomal RNA small subunit methyltransf; monomethyltranserase, 16S rRNA methyltransferase, N2 G1207 methyltransferase; HET: SAH; 1.55A {Thermus thermophilus} PDB: 3dmf_A* 3dmh_A* 2zul_A* 2zwv_A* Back     alignment and structure
>3ajd_A Putative methyltransferase MJ0026; tRNA, M5C, rossmann fold, structural genomics, riken structu genomics/proteomics initiative; 1.27A {Methanocaldococcus jannaschii} PDB: 3a4t_A Back     alignment and structure
>2esr_A Methyltransferase; structural genomics, hypothetical protein, streptococcus PYO PSI, protein structure initiative; HET: GLC; 1.80A {Streptococcus pyogenes} SCOP: c.66.1.46 Back     alignment and structure
>3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A* Back     alignment and structure
>3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A* Back     alignment and structure
>2yxl_A PH0851 protein, 450AA long hypothetical FMU protein; FMU-homolog, methyltransferase, structural genomics, NPPSFA; HET: SFG; 2.55A {Pyrococcus horikoshii} Back     alignment and structure
>4dmg_A Putative uncharacterized protein TTHA1493; rRNA, methyltransferase, S-adenosyl-methionine, 23S ribosoma transferase; HET: SAM; 1.70A {Thermus thermophilus} Back     alignment and structure
>2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A Back     alignment and structure
>1boo_A Protein (N-4 cytosine-specific methyltransferase PVU II); type II DNA-(cytosine N4) methyltransferase, amino methylation, selenomethionine; HET: SAH; 2.80A {Proteus vulgaris} SCOP: c.66.1.11 Back     alignment and structure
>2ih2_A Modification methylase TAQI; DNA, DNA methyltransferase, target base partner, 5-methylpyr 2(1H)-ONE, base flipping; HET: 5PY 6MA NEA; 1.61A {Thermus aquaticus} SCOP: c.66.1.27 d.287.1.1 PDB: 2ibs_A* 2ibt_A* 2ih4_A* 2ih5_A* 2jg3_A* 2np6_A* 2np7_A* 1aqj_A* 1aqi_A* 2adm_A* 1g38_A* Back     alignment and structure
>1g60_A Adenine-specific methyltransferase MBOIIA; structural genomics, DNA methylation, S- adenosylmethionine, PSI, protein structure initiative; HET: SAM; 1.74A {Moraxella bovis} SCOP: c.66.1.11 Back     alignment and structure
>2gpy_A O-methyltransferase; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: MSE; 1.90A {Bacillus halodurans} Back     alignment and structure
>2frx_A Hypothetical protein YEBU; rossmann-type S-adenosylmethionine-dependent methyltransfera domain; 2.90A {Escherichia coli} Back     alignment and structure
>1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>2zig_A TTHA0409, putative modification methylase; methyltransferase, S- adenosylmethionine, structural genomics, NPPSFA; 2.10A {Thermus thermophilus} PDB: 2zie_A* 2zif_A Back     alignment and structure
>2yx1_A Hypothetical protein MJ0883; methyl transferase, tRNA modification enzyme, transferase; HET: SFG; 2.20A {Methanocaldococcus jannaschii} PDB: 2zzn_A* 3ay0_A* 2zzm_A* Back     alignment and structure
>2ift_A Putative methylase HI0767; NESG, Y767_haein, structural genomics, PSI-2, protein structure initiative; 2.30A {Haemophilus influenzae} SCOP: c.66.1.46 Back     alignment and structure
>3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} Back     alignment and structure
>4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix} Back     alignment and structure
>2igt_A SAM dependent methyltransferase; alpha-beta sandwich, beta-barrel, structural genomics, PSI-2 structure initiative; HET: MSE SAM GOL; 1.89A {Agrobacterium tumefaciens str} SCOP: c.66.1.51 Back     alignment and structure
>1nv8_A HEMK protein; class I adoMet-dependent methyltransferase; HET: SAM MEQ; 2.20A {Thermotoga maritima} SCOP: c.66.1.30 PDB: 1nv9_A* 1vq1_A* 1sg9_A* Back     alignment and structure
>4dcm_A Ribosomal RNA large subunit methyltransferase G; 23S rRNA (guanine1835-N2)-methyltransferase; HET: SAM; 2.30A {Escherichia coli} Back     alignment and structure
>3ntv_A MW1564 protein; rossmann fold, putative methyltransferase, transferase; HET: MSE; 1.55A {Staphylococcus aureus} Back     alignment and structure
>2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens} Back     alignment and structure
>3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} Back     alignment and structure
>3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1o9g_A RRNA methyltransferase; antibiotic resistance, Se-MAD; 1.5A {Streptomyces viridochromogenes} SCOP: c.66.1.29 PDB: 1o9h_A Back     alignment and structure
>2frn_A Hypothetical protein PH0793; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pyrococcus horikoshii OT3} PDB: 3k6r_A 3a25_A* 3a26_A* Back     alignment and structure
>3tr6_A O-methyltransferase; cellular processes; HET: SAH; 2.70A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>3duw_A OMT, O-methyltransferase, putative; alternating of alpha and beta with complex SAH; HET: SAH; 1.20A {Bacillus cereus} PDB: 3dul_A* Back     alignment and structure
>2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175; HET: MSE; 1.70A {Agrobacterium tumefaciens str} Back     alignment and structure
>3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} SCOP: c.66.1.49 PDB: 2gh1_A Back     alignment and structure
>2pjd_A Ribosomal RNA small subunit methyltransferase C; gene duplication, RNA modification, SAM binding; 2.10A {Escherichia coli} Back     alignment and structure
>1ixk_A Methyltransferase; open beta sheet; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.38 Back     alignment and structure
>2avd_A Catechol-O-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Homo sapiens} SCOP: c.66.1.1 Back     alignment and structure
>3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* Back     alignment and structure
>1ne2_A Hypothetical protein TA1320; structural genomics, conserved hypothetical protein, PSI, protein structure initiative; 1.75A {Thermoplasma acidophilum} SCOP: c.66.1.32 Back     alignment and structure
>3m4x_A NOL1/NOP2/SUN family protein; mtase domain, PUA domain, RRM motif, transferase; 2.28A {Enterococcus faecium} Back     alignment and structure
>1eg2_A Modification methylase RSRI; rossmann fold, exocyclic amino DNA methyltransferase RSRI, D binding, DNA modification, DNA methylation; HET: MTA; 1.75A {Rhodobacter sphaeroides} SCOP: c.66.1.11 PDB: 1nw5_A* 1nw6_A* 1nw7_A* 1nw8_A Back     alignment and structure
>2ipx_A RRNA 2'-O-methyltransferase fibrillarin; FBL, structural genomics, structural genomics consortium, SGC; HET: MTA; 1.82A {Homo sapiens} Back     alignment and structure
>3bzb_A Uncharacterized protein; RED ALGA, protein structure initiat center for eukaryotic structural genomics, CESG, structural genomics; 2.79A {Cyanidioschyzon merolae} Back     alignment and structure
>3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0 Back     alignment and structure
>3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp} Back     alignment and structure
>1wxx_A TT1595, hypothetical protein TTHA1280; thermus thermophillus, methyltransferase, adoMet, structural genomics; 1.80A {Thermus thermophilus} SCOP: b.122.1.9 c.66.1.51 PDB: 1wxw_A 2cww_A* Back     alignment and structure
>2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>2as0_A Hypothetical protein PH1915; RNA methyltransferase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus horikoshii} SCOP: b.122.1.9 c.66.1.51 Back     alignment and structure
>3c0k_A UPF0064 protein YCCW; PUA domain, adoMet dependent methyltransferase fold; 2.00A {Escherichia coli K12} Back     alignment and structure
>2fhp_A Methylase, putative; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Enterococcus faecalis} SCOP: c.66.1.46 Back     alignment and structure
>2oo3_A Protein involved in catabolism of external DNA; structural genomics, unknown function, PSI-2, protein structure initiative; 2.00A {Legionella pneumophila subsp} SCOP: c.66.1.59 Back     alignment and structure
>1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7 Back     alignment and structure
>1mjf_A Spermidine synthase; spermidine synthetase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus furiosus} SCOP: c.66.1.17 PDB: 2e5w_A* 2zsu_A* Back     alignment and structure
>2b78_A Hypothetical protein SMU.776; structure genomics, methyltransferase, caries, structural genomics, unknown function; 2.00A {Streptococcus mutans} SCOP: b.122.1.9 c.66.1.51 PDB: 3ldf_A* Back     alignment and structure
>3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3bwc_A Spermidine synthase; SAM, SGPP, structura genomics, PSI, protein structure initiative, structural GEN pathogenic protozoa consortium; HET: MSE SAM; 2.30A {Trypanosoma cruzi} PDB: 3bwb_A* Back     alignment and structure
>3dou_A Ribosomal RNA large subunit methyltransferase J; cell division, structural genomics, protein structure initiative, PSI; HET: SAM; 1.45A {Thermoplasma volcanium} SCOP: c.66.1.0 Back     alignment and structure
>2b2c_A Spermidine synthase; beta-alpha, transferase; 2.50A {Caenorhabditis elegans} SCOP: c.66.1.17 Back     alignment and structure
>3gdh_A Trimethylguanosine synthase homolog; M7G, CAP, dimethyltransferase, usnRNA, snoRNA, telomerase, cytoplasm, methyltransferase, nucleus; HET: MGP SAH; 2.00A {Homo sapiens} PDB: 3egi_A* Back     alignment and structure
>3u81_A Catechol O-methyltransferase; neurotransmitter degradation, transferase transferase inhibitor complex; HET: SAH; 1.13A {Rattus norvegicus} SCOP: c.66.1.1 PDB: 3nwe_A* 3oe5_A* 3ozr_A* 3oe4_A* 3ozt_A* 3ozs_A* 3r6t_A* 3hvi_A* 1jr4_A* 1vid_A* 1h1d_A* 2cl5_A* 3hvh_A* 3hvj_A* 3hvk_A* 3nw9_A* 3nwb_A* 3s68_A* 2zlb_A 2zth_A* ... Back     alignment and structure
>1yf3_A DNA adenine methylase; T4DAM, methyltransferase, transferase-DNA complex; HET: DNA SAH; 2.29A {Enterobacteria phage T4} SCOP: c.66.1.28 PDB: 1yfj_A* 1yfl_A* 1q0s_A* 1q0t_A* Back     alignment and structure
>3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C* Back     alignment and structure
>3bt7_A TRNA (uracil-5-)-methyltransferase; methyluridine, methyltransferase, TRMA, RUMT; HET: 5MU; 2.43A {Escherichia coli} Back     alignment and structure
>2fpo_A Methylase YHHF; structural genomics, putative methyltransferase, PSI, protei structure initiative; HET: MSE; 2.05A {Escherichia coli} SCOP: c.66.1.46 Back     alignment and structure
>1sui_A Caffeoyl-COA O-methyltransferase; rossmann fold, protein-cofactor-substrate complex; HET: SAH FRE; 2.70A {Medicago sativa} SCOP: c.66.1.1 PDB: 1sus_A* Back     alignment and structure
>3pfg_A N-methyltransferase; N,N-dimethyltransferase, SAM binding, DTDP-linked sugar BIND transferase; HET: SAM TLO; 1.35A {Streptomyces fradiae} PDB: 3pfh_A* 3px3_A* 3px2_A* Back     alignment and structure
>2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii} Back     alignment and structure
>1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A Back     alignment and structure
>2jjq_A Uncharacterized RNA methyltransferase pyrab10780; metal-binding, tRNA methyltransferase, S-adenosyl-L-methionine, iron, 4Fe-4S, iron-sulfur; HET: SAH; 1.8A {Pyrococcus abyssi} PDB: 2vs1_A* Back     alignment and structure
>3a27_A TYW2, uncharacterized protein MJ1557; wybutosine modification, transferase; HET: SAM; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>3r3h_A O-methyltransferase, SAM-dependent; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.65A {Legionella pneumophila subsp} Back     alignment and structure
>3ldg_A Putative uncharacterized protein SMU.472; YPSC, methyltransferase, transferase; HET: SAH; 1.96A {Streptococcus mutans} Back     alignment and structure
>3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli} Back     alignment and structure
>2hnk_A SAM-dependent O-methyltransferase; modified rossman fold; HET: SAH; 2.30A {Leptospira interrogans} Back     alignment and structure
>2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str} Back     alignment and structure
>1iy9_A Spermidine synthase; rossmann fold, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacillus subtilis} SCOP: c.66.1.17 Back     alignment and structure
>2pt6_A Spermidine synthase; transferase, structural genomics consor SGC,dcadoMet complex; HET: S4M 1PG; 2.00A {Plasmodium falciparum} PDB: 2pss_A* 2pt9_A* Back     alignment and structure
>3k0b_A Predicted N6-adenine-specific DNA methylase; methylase,PF01170, putative RNA methylase, PSI,MCSG, structu genomics; 1.50A {Listeria monocytogenes str} Back     alignment and structure
>3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum} Back     alignment and structure
>1inl_A Spermidine synthase; beta-barrel, rossman fold, structural genomics, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: c.66.1.17 PDB: 1jq3_A* Back     alignment and structure
>2i7c_A Spermidine synthase; transferase, structural genomics consor; HET: AAT 1PG; 1.71A {Plasmodium falciparum} PDB: 2hte_A* 3b7p_A* 3rie_A* 2pwp_A* Back     alignment and structure
>2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A* Back     alignment and structure
>2plw_A Ribosomal RNA methyltransferase, putative; malaria, SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Plasmodium falciparum} Back     alignment and structure
>2h00_A Methyltransferase 10 domain containing protein; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.54 Back     alignment and structure
>1g8a_A Fibrillarin-like PRE-rRNA processing protein; rRNA binding, RNA binding, structural genomics, BSGC structure funded by NIH; 1.40A {Pyrococcus horikoshii} SCOP: c.66.1.3 PDB: 2nnw_B 3nmu_F* 3nvk_I* 3nvm_B 1pry_A Back     alignment and structure
>2b9e_A NOL1/NOP2/SUN domain family, member 5 isoform 2; methytransferase, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.65A {Homo sapiens} SCOP: c.66.1.38 Back     alignment and structure
>3cbg_A O-methyltransferase; cyanobacterium; HET: SAH FER 4FE; 2.00A {Synechocystis SP} Back     alignment and structure
>1uwv_A 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA modification, iron-sulfur cluster, RNA processing; 1.95A {Escherichia coli} SCOP: b.40.4.12 c.66.1.40 PDB: 2bh2_A* Back     alignment and structure
>3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} Back     alignment and structure
>3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} Back     alignment and structure
>3id6_C Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; C/D guide RNA, 2'-O-methylation, coiled-coil, methyltransfer binding, rRNA processing; HET: SAM; 2.60A {Sulfolobus solfataricus} SCOP: c.66.1.0 PDB: 3id5_B* 3pla_E* Back     alignment and structure
>1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl homocysteine, protein repair; HET: SAH; 1.50A {Homo sapiens} SCOP: c.66.1.7 PDB: 1kr5_A* Back     alignment and structure
>3ldu_A Putative methylase; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE GTP; 1.70A {Clostridium difficile} Back     alignment and structure
>1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 Back     alignment and structure
>1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* Back     alignment and structure
>2dpm_A M.dpnii 1, protein (adenine-specific methyltransferase dpnii 1); DNA adenine methyltransferase, methylase; HET: SAM; 1.80A {Streptococcus pneumoniae} SCOP: c.66.1.28 Back     alignment and structure
>1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A* Back     alignment and structure
>2nyu_A Putative ribosomal RNA methyltransferase 2; SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.76A {Homo sapiens} Back     alignment and structure
>1uir_A Polyamine aminopropyltransferase; spermidien synthase, spermine synthase, riken STR genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} SCOP: c.66.1.17 PDB: 3anx_A* Back     alignment and structure
>2g1p_A DNA adenine methylase; DAM methylation, GATC recognition, base flipping, bacterial factor, transferase-DNA complex; HET: DNA SAH; 1.89A {Escherichia coli} PDB: 2ore_D* Back     alignment and structure
>3gru_A Dimethyladenosine transferase; rossman fold, ribosomal assem adenosyl-L-methionine, rRNA, methyltransferase, RNA-binding processing; HET: AMP; 1.60A {Methanocaldococcus jannaschii} PDB: 3grr_A* 3grv_A* 3gry_A* 3fyd_A 3fyc_A* Back     alignment and structure
>3c3y_A Pfomt, O-methyltransferase; plant secondary metabolism; HET: SAH; 1.37A {Mesembryanthemum crystallinum} Back     alignment and structure
>3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15} Back     alignment and structure
>3dp7_A SAM-dependent methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research; 2.33A {Bacteroides vulgatus} Back     alignment and structure
>1yzh_A TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alpha sandwich, S-adenosylmeth dependent, structural genomics, PSI; 2.02A {Streptococcus pneumoniae} SCOP: c.66.1.53 Back     alignment and structure
>2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus} Back     alignment and structure
>1jsx_A Glucose-inhibited division protein B; methyltransferase fold, structural genomics, PSI, protein structure initiative; 2.40A {Escherichia coli} SCOP: c.66.1.20 Back     alignment and structure
>2pbf_A Protein-L-isoaspartate O-methyltransferase beta-A methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum} Back     alignment and structure
>1r18_A Protein-L-isoaspartate(D-aspartate)-O-methyltrans; methyltransferase, isomerization, protein repair, S-adenosyl homocysteine; HET: SAH; 2.20A {Drosophila melanogaster} SCOP: c.66.1.7 Back     alignment and structure
>3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae} Back     alignment and structure
>2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} Back     alignment and structure
>2o07_A Spermidine synthase; structural genomics, structural genomics consortium, SGC, transferase; HET: SPD MTA; 1.89A {Homo sapiens} SCOP: c.66.1.17 PDB: 2o06_A* 2o05_A* 2o0l_A* 3rw9_A* Back     alignment and structure
>3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query209
d1wy7a1201 Hypothetical protein PH1948 {Archaeon Pyrococcus h 97.28
d1dusa_194 Hypothetical protein MJ0882 {Archaeon Methanococcu 96.42
d1ne2a_197 Hypothetical protein Ta1320 {Archaeon Thermoplasma 96.31
d2b3ta1274 N5-glutamine methyltransferase, HemK {Escherichia 94.5
d1wxxa2318 Hypothetical protein TTHA1280, middle and C-termin 94.02
d2igta1309 Putative methyltransferase Atu0340 {Agrobacterium 93.91
d1ws6a1171 Methyltransferase TTHA0928 {Thermus thermophilus [ 93.79
d2esra1152 Putative methyltransferase SPy1538 {Streptococcus 93.5
d2fhpa1182 Putative methylase EF2452 {Enterococcus faecalis [ 93.34
d2b78a2317 Hypothetical protein SMu776, middle and C-terminal 92.8
d2ifta1183 Putative methylase HI0767 {Haemophilus influenzae 92.54
d2as0a2324 Hypothetical protein PH1915, middle and C-terminal 92.31
d1eg2a_ 279 m.RsrI N6 adenosine-specific DNA methyltransferase 92.06
d1nv8a_271 N5-glutamine methyltransferase, HemK {Thermotoga m 91.17
d1g8aa_227 Fibrillarin homologue {Archaeon Pyrococcus horikos 91.06
d2fpoa1183 Methylase YhhF {Escherichia coli [TaxId: 562]} 91.01
d2dpma_275 DNA methylase DpnM {Streptococcus pneumoniae [TaxI 88.57
d1booa_ 320 m.PvuII N4 cytosine-specific DNA methyltransferase 88.14
d2f8la1 328 Hypothetical protein Lmo1582 {Listeria monocytogen 87.36
d2nxca1254 PrmA-like protein TTHA0656 (TT0836) {Thermus therm 86.92
d2h00a1250 Methyltransferase 10 domain containing protein MET 86.77
d1g60a_ 256 Methyltransferase mboII {Moraxella bovis [TaxId: 4 86.5
d2ih2a1 223 DNA methylase TaqI, N-terminal domain {Thermus aqu 83.65
d1yf3a1259 DNA methylase T4DAM {Bacteriophage T4 [TaxId: 1066 80.38
>d1wy7a1 c.66.1.32 (A:4-204) Hypothetical protein PH1948 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: Ta1320-like
domain: Hypothetical protein PH1948
species: Archaeon Pyrococcus horikoshii [TaxId: 53953]

Probab=97.28  E-value=0.00079  Score=53.54  Aligned_cols=93  Identities=18%  Similarity=0.138  Sum_probs=62.1

Q ss_pred             ccccccccccChHHHHHHHHHHHhhcCCCCCeEEEEeCchHHHHHHhh-CCCCCceEEeeccccc--------ccCC--c
Q 028404           83 EDWRLSQFWYDAVTAETVAQEAVSLCSDSDSRVACIACPTLYAYLKKI-RPEVSPKILEYDMRFE--------QYGS--D  151 (209)
Q Consensus        83 EDwqlSQFWYSd~Ta~~La~~l~~~a~~~~~rIaclstPSly~~Lk~~-~~~~~~~LLE~D~RF~--------~~g~--~  151 (209)
                      -.|.|.||-=+.+.+..++..+....+-.+.+|+=+||=|=-..+.-. .+..+++.+|+|.+-.        .++.  +
T Consensus        18 ~~~~l~qy~Tp~~~a~~~~~~~~~~~dl~g~~vLDlg~GtG~l~i~a~~~g~~~v~~vdi~~~~~~~a~~N~~~~~~~~~   97 (201)
T d1wy7a1          18 PKVWLEQYRTPGNAASELLWLAYSLGDIEGKVVADLGAGTGVLSYGALLLGAKEVICVEVDKEAVDVLIENLGEFKGKFK   97 (201)
T ss_dssp             CCGGGTCCCCCHHHHHHHHHHHHHTTSSTTCEEEEETCTTCHHHHHHHHTTCSEEEEEESCHHHHHHHHHHTGGGTTSEE
T ss_pred             CCcccccCCCCHHHHHHHHHHHHhcCCCCCCEEEECcCcchHHHHHHHHcCCCEEEEEcCcHHHHHHHHHHHHHcCCCce
Confidence            478899998887777777765554433357899999998654443221 2335899999998532        2332  4


Q ss_pred             ceeecCCCCCCchHhhcccccEEEECCCCCC
Q 028404          152 FAFYDYNQPQDLPLELKHAFSVVVVDPPYLS  182 (209)
Q Consensus       152 FvfYDyn~P~~lp~~lk~~fD~Vv~DPPFls  182 (209)
                      |+..|..       .+.++||+||+||||+.
T Consensus        98 ~~~~d~~-------~~~~~fD~Vi~nPP~~~  121 (201)
T d1wy7a1          98 VFIGDVS-------EFNSRVDIVIMNPPFGS  121 (201)
T ss_dssp             EEESCGG-------GCCCCCSEEEECCCCSS
T ss_pred             EEECchh-------hhCCcCcEEEEcCcccc
Confidence            4444432       23568999999999975
>d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1ne2a_ c.66.1.32 (A:) Hypothetical protein Ta1320 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2b3ta1 c.66.1.30 (A:2-275) N5-glutamine methyltransferase, HemK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wxxa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2igta1 c.66.1.51 (A:1-309) Putative methyltransferase Atu0340 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1ws6a1 c.66.1.46 (A:15-185) Methyltransferase TTHA0928 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2esra1 c.66.1.46 (A:28-179) Putative methyltransferase SPy1538 {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2fhpa1 c.66.1.46 (A:1-182) Putative methylase EF2452 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2b78a2 c.66.1.51 (A:69-385) Hypothetical protein SMu776, middle and C-terminal domains {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d2ifta1 c.66.1.46 (A:11-193) Putative methylase HI0767 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2as0a2 c.66.1.51 (A:73-396) Hypothetical protein PH1915, middle and C-terminal domains {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1eg2a_ c.66.1.11 (A:) m.RsrI N6 adenosine-specific DNA methyltransferase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1nv8a_ c.66.1.30 (A:) N5-glutamine methyltransferase, HemK {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2fpoa1 c.66.1.46 (A:10-192) Methylase YhhF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2dpma_ c.66.1.28 (A:) DNA methylase DpnM {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1booa_ c.66.1.11 (A:) m.PvuII N4 cytosine-specific DNA methyltransferase {Proteus vulgaris [TaxId: 585]} Back     information, alignment and structure
>d2f8la1 c.66.1.45 (A:2-329) Hypothetical protein Lmo1582 {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2h00a1 c.66.1.54 (A:5-254) Methyltransferase 10 domain containing protein METT10D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g60a_ c.66.1.11 (A:) Methyltransferase mboII {Moraxella bovis [TaxId: 476]} Back     information, alignment and structure
>d2ih2a1 c.66.1.27 (A:21-243) DNA methylase TaqI, N-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1yf3a1 c.66.1.28 (A:1-259) DNA methylase T4DAM {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure