Citrus Sinensis ID: 028419

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------21
MAQPVTTPCAHNFCKSCLEEAFSGKSFVRERSRGGRALRSQKTIMKCPSCTTDISDFLKDPQVNRELMEVIESLKQKTEEDDELAEESNDEGTDASEGISDLVPESSKSSGKHHEETIVTGCSHNPQVKCTPERASKRKKVDVEDSLGRNNDGEEATIAAEKPDDGLDVDSEANLKVGSKDTKAEEEMEEENDSPASPLLMPSDDQDSA
cccccccccccHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHccccHHHHHHHcccccccccccccccccccccccccccccHHHccccccccccccHHHHHHHHHHHHHHHHcccccHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccc
cccccccccccHHHHHHHHHHHcccHHHHHccccccEEEEcccccccccccccHHHHHHcccccHHHHHHHHHHHHHHHHcHHHHHHcccccccccccccccccccccccccccccEEEcccccccccccccccccccccccHHHHccccccccHccHHcccccccccccccccEEccccccccccccccccccccccccccccccccc
maqpvttpcahnfckSCLEEAFSGKSFVRersrggralrsqktimkcpscttdisdflkdpqvNRELMEVIESLKQKTEEDDELaeesndegtdasegisdlvpesskssgkhheetivtgcshnpqvkctperaskrkkvdvedslgrnndgeeatiaaekpddgldvdseanlkvgskdtkaeeemeeendspaspllmpsddqdsa
maqpvttpcahnfcKSCLEeafsgksfvrersrggralrsqktimkcpscttdisdflkdpqVNRELMEVIESLKQKTEEDDELaeesndegtdasegiSDLVPESSKSSGKHHEEtivtgcshnpqvkctperaskrkkvdvedslgrnndgeeatiaaekpddgldvdseanlkvgskdtkaeeemeeendspaspllmpsddqdsa
MAQPVTTPCAHNFCKSCLEEAFSGKSFVRERSRGGRALRSQKTIMKCPSCTTDISDFLKDPQVNRELMEVIESLKQKTEEDDELAEESNDEGTDASEGISDLVPesskssgkhheeTIVTGCSHNPQVKCTPERASKRKKVDVEDSLGRNNDGEEATIAAEKPDDGLDVDSEANLKVGSKDTKAeeemeeeNDSPASPLLMPSDDQDSA
********CAHNFCKSCLEEAFS********************IMKCPSCTTDISDFL*******************************************************************************************************************************************************
MAQPVTTPCAHNFCKSCLEEAFSGKSF***********RSQKTIMKCPSCTTDISDFLKDPQVNRELMEVI***************************ISDLVPESSKSSG**************************************************************************************************
********CAHNFCKSCLEEAFSGKSFVRERSRGGRALRSQKTIMKCPSCTTDISDFLKDPQVNRELMEVIESLKQ*********************GISDL**************TIVTGCSHNPQVKCTPERASKRKKVDVEDSLGRNNDGEEATIAAEKPDDGLDVDSEANLKV*******************SPLLMPSDDQDSA
**QPVTTPCAHNFCKSCLEEAFSGKSFVR*RSRGGRALRSQKTIMKCPSCTTDISDFLKDPQVNRELMEVIESLKQKTEED********************************************************************************************************************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAQPVTTPCAHNFCKSCLEEAFSGKSFVRERSRGGRALRSQKTIMKCPSCTTDISDFLKDPQVNRELMEVxxxxxxxxxxxxxxxxxxxxxGTDASEGISDLVPESSKSSGKHHEETIVTGCSHNPQVKCTPERASKRKKVDVEDSLGRNNDGEEATIAAEKPDDGLDVDSEANLKVGSKDTKAEEEMEEENDSPASPLLMPSDDQDSA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query209 2.2.26 [Sep-21-2011]
Q8VYZ0645 E3 ubiquitin-protein liga yes no 0.430 0.139 0.641 5e-29
Q9FKA7617 E3 ubiquitin-protein liga no no 0.306 0.103 0.634 1e-27
Q9FVS2660 E3 ubiquitin-protein liga no no 0.339 0.107 0.676 2e-25
Q9C8E1622 Putative E3 ubiquitin-pro no no 0.277 0.093 0.618 5e-25
Q680I0623 E3 ubiquitin-protein liga no no 0.277 0.093 0.618 5e-25
>sp|Q8VYZ0|ORTH2_ARATH E3 ubiquitin-protein ligase ORTHRUS 2 OS=Arabidopsis thaliana GN=ORTH2 PE=1 SV=1 Back     alignment and function desciption
 Score =  127 bits (319), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 72/92 (78%), Gaps = 2/92 (2%)

Query: 1   MAQPVTTPCAHNFCKSCLEEAFSGKSFVRERSRGGRALRSQKTIMKCPSCTTDISDFLKD 60
           +  PVTTPCAHNFCK+CLE  F+GK+ VRERS GGR LRS+K ++ CP C TDISDFL++
Sbjct: 525 LTLPVTTPCAHNFCKACLEAKFAGKTLVRERSTGGRTLRSRKNVLNCPCCPTDISDFLQN 584

Query: 61  PQVNRELMEVIESLKQKTEEDDELAEESNDEG 92
           PQVNRE+ EVIE LK + E+  EL +E  DEG
Sbjct: 585 PQVNREVAEVIEKLKTQEEDTAELEDE--DEG 614
E3 ubiquitin-protein ligase. Participates in CpG methylation-dependent transcriptional regulation and epigenetic transcriptional silencing. Mediates ubiquitination with the E2 ubiquitin-conjugating enzyme UBC11. Promotes methylation-mediated gene silencing leading, for example, to early flowering. Associates with methylated DNA, and can binds to CpG, CpNpG, and CpNpN DNA motifs, with a strong preference for methylated forms, and with highest affinity for CpG substrate. Probably acts at the DNA methylation?histone interface to maintain centromeric heterochromatin.
Arabidopsis thaliana (taxid: 3702)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -
>sp|Q9FKA7|ORTH1_ARATH E3 ubiquitin-protein ligase ORTHRUS 1 OS=Arabidopsis thaliana GN=ORTH1 PE=1 SV=1 Back     alignment and function description
>sp|Q9FVS2|ORTH3_ARATH E3 ubiquitin-protein ligase ORTHRUS 3 OS=Arabidopsis thaliana GN=ORTH3 PE=3 SV=2 Back     alignment and function description
>sp|Q9C8E1|ORTH4_ARATH Putative E3 ubiquitin-protein ligase ORTHRUS 4 OS=Arabidopsis thaliana GN=ORTH4 PE=3 SV=1 Back     alignment and function description
>sp|Q680I0|ORTH5_ARATH E3 ubiquitin-protein ligase ORTHRUS 5 OS=Arabidopsis thaliana GN=ORTH5 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query209
255577358 752 zinc finger protein, putative [Ricinus c 0.961 0.267 0.443 5e-35
313760924 713 VARIANT IN METHYLATION-like protein [Lir 0.444 0.130 0.702 6e-32
313760929 713 VARIANT IN METHYLATION-like protein [Lir 0.449 0.131 0.705 7e-32
224072467 673 predicted protein [Populus trichocarpa] 0.488 0.151 0.619 2e-30
297837707 649 hypothetical protein ARALYDRAFT_315436 [ 0.444 0.143 0.634 5e-30
225425270 815 PREDICTED: E3 ubiquitin-protein ligase O 0.449 0.115 0.666 2e-29
356553528 624 PREDICTED: E3 ubiquitin-protein ligase O 0.435 0.145 0.641 2e-29
296085530 803 unnamed protein product [Vitis vinifera] 0.449 0.117 0.666 3e-29
449515239 745 PREDICTED: LOW QUALITY PROTEIN: E3 ubiqu 0.416 0.116 0.678 3e-29
356499501 637 PREDICTED: E3 ubiquitin-protein ligase O 0.425 0.139 0.663 7e-29
>gi|255577358|ref|XP_002529559.1| zinc finger protein, putative [Ricinus communis] gi|223530971|gb|EEF32828.1| zinc finger protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  153 bits (386), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 103/232 (44%), Positives = 138/232 (59%), Gaps = 31/232 (13%)

Query: 1   MAQPVTTPCAHNFCKSCLEEAFSGKSFVRERSRGGRALRSQKTIMKCPSCTTDISDFLKD 60
           M QP+TTPCAHNFCKSCLE AF+GK+ +RERS+GGR LR+QK IM CP C TDISDFL+D
Sbjct: 525 MNQPITTPCAHNFCKSCLEGAFTGKTLMRERSKGGRTLRAQKNIMHCPRCPTDISDFLQD 584

Query: 61  PQVNRELMEVIESLKQKTEEDDELAEESNDEGTDASEGISDLVPESSKSSGKHHEETIVT 120
           P+VNRE+M VIESL+++TEE  +  ++S +E  D SE      P  +++     E+T   
Sbjct: 585 PKVNREVMAVIESLQRQTEETVDSVDDSGEEEADGSEE----NPCVTEAGEDDSEKTAAH 640

Query: 121 GCSHNPQVKCTPERASKRKKVDVEDSLGRNNDGEEATIAAEK------PDDGLDV----- 169
               NP  KC PE A ++KK + E S G+   G E +  A K       D GL+V     
Sbjct: 641 NGLENPS-KCEPEVAIEQKKEN-EISAGKTGCGNEHSEEASKLESEVAEDGGLNVQVPAA 698

Query: 170 ---------DSEANLK---VGSK--DTKAEEEMEEENDSPASPLLMPSDDQD 207
                    DS A  +   VG+K  + + +E   + N+SP+SPL + S D D
Sbjct: 699 RLSCKRKIPDSGAESREPTVGAKKRNRRGQEATADGNNSPSSPLNVRSSDDD 750

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|313760924|gb|ADR79438.1| VARIANT IN METHYLATION-like protein [Liriodendron tulipifera] Back     alignment and taxonomy information
>gi|313760929|gb|ADR79442.1| VARIANT IN METHYLATION-like protein [Liriodendron tulipifera] Back     alignment and taxonomy information
>gi|224072467|ref|XP_002303746.1| predicted protein [Populus trichocarpa] gi|222841178|gb|EEE78725.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297837707|ref|XP_002886735.1| hypothetical protein ARALYDRAFT_315436 [Arabidopsis lyrata subsp. lyrata] gi|297332576|gb|EFH62994.1| hypothetical protein ARALYDRAFT_315436 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|225425270|ref|XP_002267902.1| PREDICTED: E3 ubiquitin-protein ligase ORTHRUS 2-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|356553528|ref|XP_003545107.1| PREDICTED: E3 ubiquitin-protein ligase ORTHRUS 2-like [Glycine max] Back     alignment and taxonomy information
>gi|296085530|emb|CBI29262.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449515239|ref|XP_004164657.1| PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin-protein ligase ORTHRUS 2-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356499501|ref|XP_003518578.1| PREDICTED: E3 ubiquitin-protein ligase ORTHRUS 2-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query209
TAIR|locus:2009420645 VIM1 "AT1G57820" [Arabidopsis 0.416 0.134 0.662 9.5e-28
TAIR|locus:2013840623 VIM2 "VARIANT IN METHYLATION 2 0.459 0.154 0.59 3.8e-27
TAIR|locus:2009425660 VIM5 "VARIANT IN METHYLATION 5 0.464 0.146 0.581 4.5e-27
TAIR|locus:2164835617 VIM3 "VARIANT IN METHYLATION 3 0.473 0.160 0.56 7.9e-27
TAIR|locus:2013800622 VIM4 "VARIANT IN METHYLATION 4 0.459 0.154 0.585 1.7e-26
UNIPROTKB|C9IZE0114 TRIM59 "Tripartite motif-conta 0.330 0.605 0.325 0.00026
UNIPROTKB|C9J9F0111 TRIM59 "Tripartite motif-conta 0.330 0.621 0.325 0.00026
UNIPROTKB|J3KNZ3175 TRIM17 "E3 ubiquitin-protein l 0.373 0.445 0.295 0.00063
UNIPROTKB|E1B964638 LOC100849413 "Uncharacterized 0.081 0.026 0.764 0.00086
UNIPROTKB|I3LT33717 LONRF1 "Uncharacterized protei 0.081 0.023 0.764 0.0009
TAIR|locus:2009420 VIM1 "AT1G57820" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 318 (117.0 bits), Expect = 9.5e-28, P = 9.5e-28
 Identities = 59/89 (66%), Positives = 70/89 (78%)

Query:     4 PVTTPCAHNFCKSCLEEAFSGKSFVRERSRGGRALRSQKTIMKCPSCTTDISDFLKDPQV 63
             PVTTPCAHNFCK+CLE  F+GK+ VRERS GGR LRS+K ++ CP C TDISDFL++PQV
Sbjct:   528 PVTTPCAHNFCKACLEAKFAGKTLVRERSTGGRTLRSRKNVLNCPCCPTDISDFLQNPQV 587

Query:    64 NRELMEVIESLKQKTEEDDELAEESNDEG 92
             NRE+ EVIE LK  T+E+D    E  DEG
Sbjct:   588 NREVAEVIEKLK--TQEEDTAELEDEDEG 614
GO:0003677 "DNA binding" evidence=ISS
GO:0005634 "nucleus" evidence=ISM;IDA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=ISS
GO:0008270 "zinc ion binding" evidence=IEA
GO:0042393 "histone binding" evidence=IEA;IPI
GO:0008327 "methyl-CpG binding" evidence=IDA
GO:0010428 "methyl-CpNpG binding" evidence=IDA
GO:0010429 "methyl-CpNpN binding" evidence=IDA
GO:0003682 "chromatin binding" evidence=IDA
GO:0010369 "chromocenter" evidence=IDA
GO:0010385 "double-stranded methylated DNA binding" evidence=IDA
GO:0031508 "centromeric heterochromatin assembly" evidence=IMP
GO:0032776 "DNA methylation on cytosine" evidence=IMP
GO:0006325 "chromatin organization" evidence=IPI
GO:0051301 "cell division" evidence=IDA
GO:0004842 "ubiquitin-protein ligase activity" evidence=IDA
GO:0016567 "protein ubiquitination" evidence=IDA
GO:0010424 "DNA methylation on cytosine within a CG sequence" evidence=IMP
GO:0090309 "positive regulation of methylation-dependent chromatin silencing" evidence=IMP
GO:0000278 "mitotic cell cycle" evidence=RCA
GO:0000280 "nuclear division" evidence=RCA
GO:0000724 "double-strand break repair via homologous recombination" evidence=RCA
GO:0000911 "cytokinesis by cell plate formation" evidence=RCA
GO:0006260 "DNA replication" evidence=RCA
GO:0006261 "DNA-dependent DNA replication" evidence=RCA
GO:0006270 "DNA replication initiation" evidence=RCA
GO:0006275 "regulation of DNA replication" evidence=RCA
GO:0006306 "DNA methylation" evidence=RCA
GO:0006342 "chromatin silencing" evidence=RCA
GO:0007000 "nucleolus organization" evidence=RCA
GO:0008283 "cell proliferation" evidence=RCA
GO:0009555 "pollen development" evidence=RCA
GO:0016444 "somatic cell DNA recombination" evidence=RCA
GO:0016568 "chromatin modification" evidence=RCA
GO:0016572 "histone phosphorylation" evidence=RCA
GO:0031047 "gene silencing by RNA" evidence=RCA
GO:0051567 "histone H3-K9 methylation" evidence=RCA
GO:0051726 "regulation of cell cycle" evidence=RCA
TAIR|locus:2013840 VIM2 "VARIANT IN METHYLATION 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2009425 VIM5 "VARIANT IN METHYLATION 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2164835 VIM3 "VARIANT IN METHYLATION 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2013800 VIM4 "VARIANT IN METHYLATION 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|C9IZE0 TRIM59 "Tripartite motif-containing protein 59" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|C9J9F0 TRIM59 "Tripartite motif-containing protein 59" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|J3KNZ3 TRIM17 "E3 ubiquitin-protein ligase TRIM17" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E1B964 LOC100849413 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|I3LT33 LONRF1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
estExt_fgenesh4_pg.C_LG_III1345
hypothetical protein (674 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query209
cd0016245 cd00162, RING, RING-finger (Really Interesting New 0.003
>gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information 
 Score = 34.0 bits (78), Expect = 0.003
 Identities = 13/50 (26%), Positives = 17/50 (34%), Gaps = 18/50 (36%)

Query: 5  VTTPCAHNFCKSCLEEAFSGKSFVRERSRGGRALRSQKTIMKCPSCTTDI 54
          V  PC H FC+SC+++                          CP C T I
Sbjct: 14 VLLPCGHVFCRSCIDKWLKSGK------------------NTCPLCRTPI 45

Length = 45

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 209
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 98.96
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 98.87
smart0050463 Ubox Modified RING finger domain. Modified RING fi 98.83
KOG0287 442 consensus Postreplication repair protein RAD18 [Re 98.79
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 98.64
COG5432 391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 98.58
PLN03208193 E3 ubiquitin-protein ligase RMA2; Provisional 98.54
KOG2177 386 consensus Predicted E3 ubiquitin ligase [Posttrans 98.52
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 98.36
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 98.34
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 98.31
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 98.25
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 98.25
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 98.21
PF1463444 zf-RING_5: zinc-RING finger domain 98.12
KOG0823230 consensus Predicted E3 ubiquitin ligase [Posttrans 98.06
cd0016245 RING RING-finger (Really Interesting New Gene) dom 98.05
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 98.03
KOG4367 699 consensus Predicted Zn-finger protein [Function un 97.9
TIGR00570 309 cdk7 CDK-activating kinase assembly factor MAT1. A 97.84
KOG2164 513 consensus Predicted E3 ubiquitin ligase [Posttrans 97.68
KOG4159 398 consensus Predicted E3 ubiquitin ligase [Posttrans 97.66
KOG2660 331 consensus Locus-specific chromosome binding protei 97.57
KOG1813313 consensus Predicted E3 ubiquitin ligase [Posttrans 97.54
KOG0824 324 consensus Predicted E3 ubiquitin ligase [Posttrans 97.41
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 97.23
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 96.77
KOG0802543 consensus E3 ubiquitin ligase [Posttranslational m 96.66
KOG1002791 consensus Nucleotide excision repair protein RAD16 96.43
KOG4185296 consensus Predicted E3 ubiquitin ligase [Posttrans 96.41
KOG0311 381 consensus Predicted E3 ubiquitin ligase [Posttrans 96.4
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 96.37
COG5243491 HRD1 HRD ubiquitin ligase complex, ER membrane com 96.31
COG5222427 Uncharacterized conserved protein, contains RING Z 96.14
KOG1039344 consensus Predicted E3 ubiquitin ligase [Posttrans 95.35
KOG0297 391 consensus TNF receptor-associated factor [Signal t 95.29
KOG417262 consensus Predicted E3 ubiquitin ligase [Posttrans 94.83
KOG1785563 consensus Tyrosine kinase negative regulator CBL [ 94.44
KOG0825 1134 consensus PHD Zn-finger protein [General function 94.29
KOG1814445 consensus Predicted E3 ubiquitin ligase [Posttrans 94.24
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 94.13
KOG4739233 consensus Uncharacterized protein involved in syna 93.79
PF1444755 Prok-RING_4: Prokaryotic RING finger family 4 93.5
KOG2932 389 consensus E3 ubiquitin ligase involved in ubiquiti 93.01
KOG1001674 consensus Helicase-like transcription factor HLTF/ 92.41
KOG3800300 consensus Predicted E3 ubiquitin ligase containing 92.2
PF0385450 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc 90.96
KOG0804493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 90.16
KOG1734328 consensus Predicted RING-containing E3 ubiquitin l 89.86
PF1457048 zf-RING_4: RING/Ubox like zinc-binding domain; PDB 89.6
KOG0827 465 consensus Predicted E3 ubiquitin ligase [Posttrans 88.62
PF04641260 Rtf2: Rtf2 RING-finger 87.5
KOG149384 consensus Anaphase-promoting complex (APC), subuni 87.17
COG5236 493 Uncharacterized conserved protein, contains RING Z 86.44
COG519488 APC11 Component of SCF ubiquitin ligase and anapha 85.87
PHA03096284 p28-like protein; Provisional 85.0
KOG1645 463 consensus RING-finger-containing E3 ubiquitin liga 82.6
KOG3899381 consensus Uncharacterized conserved protein [Funct 80.86
PF05290140 Baculo_IE-1: Baculovirus immediate-early protein ( 80.53
KOG1941518 consensus Acetylcholine receptor-associated protei 80.05
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information 
Probab=98.96  E-value=3.3e-10  Score=74.73  Aligned_cols=35  Identities=43%  Similarity=1.088  Sum_probs=25.3

Q ss_pred             CCCCeEcCCCChhHHHHHHHHHhcCccchhcccCccccccCCCcccCCCC
Q 028419            1 MAQPVTTPCAHNFCKSCLEEAFSGKSFVRERSRGGRALRSQKTIMKCPSC   50 (209)
Q Consensus         1 f~dPV~LpCGH~FC~~CL~~~~~~~~~~~~r~~g~~~~r~~~~~~~CP~C   50 (209)
                      |.+||+|+|||+||..||.++|....               ...+.||.|
T Consensus         8 ~~~Pv~l~CGH~FC~~Cl~~~~~~~~---------------~~~~~CP~C   42 (42)
T PF15227_consen    8 FKDPVSLPCGHSFCRSCLERLWKEPS---------------GSGFSCPEC   42 (42)
T ss_dssp             -SSEEE-SSSSEEEHHHHHHHHCCSS---------------SST---SSS
T ss_pred             hCCccccCCcCHHHHHHHHHHHHccC---------------CcCCCCcCC
Confidence            68999999999999999999998654               112789988

>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>KOG4367 consensus Predicted Zn-finger protein [Function unknown] Back     alignment and domain information
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 Back     alignment and domain information
>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] Back     alignment and domain information
>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>KOG4185 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] Back     alignment and domain information
>KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4739 consensus Uncharacterized protein involved in synaptonemal complex formation [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF14447 Prok-RING_4: Prokaryotic RING finger family 4 Back     alignment and domain information
>KOG2932 consensus E3 ubiquitin ligase involved in ubiquitination of E-cadherin complex [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG3800 consensus Predicted E3 ubiquitin ligase containing RING finger, subunit of transcription/repair factor TFIIH and CDK-activating kinase assembly factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF03854 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B Back     alignment and domain information
>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>PHA03096 p28-like protein; Provisional Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3899 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0 Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query209
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 3e-09
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 8e-09
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 2e-08
1z6u_A150 NP95-like ring finger protein isoform B; structura 3e-08
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 1e-07
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 2e-07
2ecw_A85 Tripartite motif-containing protein 30; metal bind 5e-07
4epo_C149 E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 1e-06
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 1e-06
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 3e-06
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 5e-06
2ysl_A73 Tripartite motif-containing protein 31; ring-type 5e-06
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 5e-06
2ysj_A63 Tripartite motif-containing protein 31; ring-type 5e-06
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 6e-06
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 6e-06
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 8e-06
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 1e-04
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 1e-04
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 2e-04
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 2e-04
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 3e-04
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 5e-04
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 7e-04
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, chromosomal protein, DNA repair, metal-binding; 2.12A {Homo sapiens} Length = 115 Back     alignment and structure
 Score = 52.2 bits (125), Expect = 3e-09
 Identities = 22/99 (22%), Positives = 37/99 (37%), Gaps = 30/99 (30%)

Query: 1   MAQPVTTPCAHNFCKSCLEEAFSGKSFVRERSRGGRALRSQKTIMKCPSCTTDISDF--- 57
           + +PVT PC H  CK C +      S                    CP C   +S +   
Sbjct: 25  LVEPVTLPCNHTLCKPCFQSTVEKASL------------------CCPFCRRRVSSWTRY 66

Query: 58  --LKDPQVNRELMEVIESL-------KQKTEEDDELAEE 87
              ++  VN EL  +I+         +   +E +E+A++
Sbjct: 67  HTRRNSLVNVELWTIIQKHYPRECKLRASGQESEEVADD 105
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Length = 124 Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 112 Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Length = 150 Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Length = 99 Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Length = 85 Back     alignment and structure
>4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149 Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 58 Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 63 Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Length = 118 Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 56 Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Length = 108 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Length = 170 Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64 Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389 Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Length = 116 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query209
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 99.29
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 99.27
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 99.23
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 99.22
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 99.22
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 99.19
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 99.18
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 99.17
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.14
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 99.13
1z6u_A150 NP95-like ring finger protein isoform B; structura 99.13
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 99.1
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 99.08
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 99.03
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 99.02
2ecw_A85 Tripartite motif-containing protein 30; metal bind 99.02
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 99.01
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 99.01
2f42_A179 STIP1 homology and U-box containing protein 1; cha 98.98
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 98.95
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 98.95
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 98.93
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 98.85
2ysl_A73 Tripartite motif-containing protein 31; ring-type 98.85
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 98.84
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 98.83
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 98.81
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 98.8
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 98.78
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 98.75
2ysj_A63 Tripartite motif-containing protein 31; ring-type 98.74
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 98.72
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 98.66
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 98.63
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 98.63
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 98.61
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 98.58
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 98.56
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 98.53
2ect_A78 Ring finger protein 126; metal binding protein, st 98.52
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 98.51
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 98.49
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 98.48
2ecm_A55 Ring finger and CHY zinc finger domain- containing 98.46
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 98.4
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 98.38
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 98.37
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 98.37
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 98.35
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 98.35
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 98.33
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.33
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 98.3
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 98.23
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 98.11
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 98.1
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 98.1
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 98.09
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.06
2ea5_A68 Cell growth regulator with ring finger domain prot 97.95
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 97.92
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 97.87
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 97.83
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 97.49
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 97.21
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 97.09
2ko5_A99 Ring finger protein Z; lassa fever virus-Z, negati 93.07
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 92.46
3i2d_A371 E3 SUMO-protein ligase SIZ1; signal transduction, 92.38
3m62_A968 Ubiquitin conjugation factor E4; armadillo-like re 92.26
2jun_A101 Midline-1; B-BOX, TRIM, ring finger, alternative s 92.15
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 90.72
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
Probab=99.29  E-value=2.8e-12  Score=93.45  Aligned_cols=61  Identities=23%  Similarity=0.572  Sum_probs=50.5

Q ss_pred             CCCCeEcC-CCChhHHHHHHHHHhcCccchhcccCccccccCCCcccCCCCccccccCcCCCcccHHHHHHHHHHHhcCC
Q 028419            1 MAQPVTTP-CAHNFCKSCLEEAFSGKSFVRERSRGGRALRSQKTIMKCPSCTTDISDFLKDPQVNRELMEVIESLKQKTE   79 (209)
Q Consensus         1 f~dPV~Lp-CGH~FC~~CL~~~~~~~~~~~~r~~g~~~~r~~~~~~~CP~CR~~i~~~~~~~~~N~~L~~Lve~lk~~~~   79 (209)
                      |.+||+|+ |||+||..||..||....                 .+.||.||..+.. ...+.+|+.|..+++.++....
T Consensus        23 ~~~p~~~~~CgH~fC~~Ci~~~~~~~~-----------------~~~CP~Cr~~~~~-~~~~~~n~~l~~~i~~~~~~~~   84 (92)
T 3ztg_A           23 MTDAVVIPCCGNSYCDECIRTALLESD-----------------EHTCPTCHQNDVS-PDALIANKFLRQAVNNFKNETG   84 (92)
T ss_dssp             CSSCEECTTTCCEECHHHHHHHHHHCT-----------------TCCCTTTCCSSCC-TTSCEECHHHHHHHHHHHHHHT
T ss_pred             hcCceECCCCCCHHHHHHHHHHHHhcC-----------------CCcCcCCCCcCCC-ccccCcCHHHHHHHHHHHHHHh
Confidence            67899999 999999999999997432                 3589999998632 4578899999999999987543
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3i2d_A E3 SUMO-protein ligase SIZ1; signal transduction, replication, ring E3, PIAS, ubiquitin, UBC9, metal-binding, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3m62_A Ubiquitin conjugation factor E4; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} PDB: 3m63_A* 2qiz_A 2qj0_A Back     alignment and structure
>2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 209
d1jm7a_103 g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie 1e-06
d1chca_68 g.44.1.1 (A:) Immediate early protein, IEEHV {Equi 5e-04
d1fbva479 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta 0.002
d1rmda286 g.44.1.1 (A:1-86) V(D)J recombination activating p 0.004
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: brca1 RING domain
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 43.5 bits (102), Expect = 1e-06
 Identities = 22/91 (24%), Positives = 38/91 (41%), Gaps = 20/91 (21%)

Query: 1   MAQPVTTPCAHNFCKSCLEEAFSGKSFVRERSRGGRALRSQKTIMKCPSCTTDISDFLKD 60
           + +PV+T C H FCK C+                 + L  +K   +CP C  DI+   + 
Sbjct: 31  IKEPVSTKCDHIFCKFCML----------------KLLNQKKGPSQCPLCKNDIT--KRS 72

Query: 61  PQVNRELMEVIESLKQKTE--EDDELAEESN 89
            Q +    +++E L +     + D   E +N
Sbjct: 73  LQESTRFSQLVEELLKIICAFQLDTGLEYAN 103
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query209
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 99.28
d2c2la280 STIP1 homology and U box-containing protein 1, STU 99.27
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 99.23
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 99.05
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 99.02
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 98.96
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 98.8
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 98.67
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 98.66
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 98.48
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 98.47
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 98.44
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 98.35
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 98.21
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 98.18
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 97.46
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 97.17
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: brca1 RING domain
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.28  E-value=4.6e-13  Score=99.33  Aligned_cols=58  Identities=31%  Similarity=0.684  Sum_probs=46.1

Q ss_pred             CCCCeEcCCCChhHHHHHHHHHhcCccchhcccCccccccCCCcccCCCCccccccCcCCCcccHHHHHHHHHHHh
Q 028419            1 MAQPVTTPCAHNFCKSCLEEAFSGKSFVRERSRGGRALRSQKTIMKCPSCTTDISDFLKDPQVNRELMEVIESLKQ   76 (209)
Q Consensus         1 f~dPV~LpCGH~FC~~CL~~~~~~~~~~~~r~~g~~~~r~~~~~~~CP~CR~~i~~~~~~~~~N~~L~~Lve~lk~   76 (209)
                      |.+||+++|||+||..||..||....                ....||.||..+.  ...+..|..+.++++.+++
T Consensus        31 ~~~pv~~~CgH~fC~~Ci~~~~~~~~----------------~~~~CP~Cr~~~~--~~~l~~n~~l~~~ve~l~~   88 (103)
T d1jm7a_          31 IKEPVSTKCDHIFCKFCMLKLLNQKK----------------GPSQCPLCKNDIT--KRSLQESTRFSQLVEELLK   88 (103)
T ss_dssp             CSSCCBCTTSCCCCSHHHHHHHHSSS----------------SSCCCTTTSCCCC--TTTCBCCCSSSHHHHHHHH
T ss_pred             hCCeEEcCCCCchhhHHHHHHHHHCC----------------CCCcCcCCCCcCC--hhhCCcCHHHHHHHHHHHH
Confidence            67899999999999999999997543                3458999999887  4566777766777776644
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure