Citrus Sinensis ID: 028497

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------21
MESCWLFTTGRDLQRISGNITSKVGHLSMKEFAQKSHDQVITTIEDALTLVSNSVRKVILDAKVGPPSYEKGLAKDILSVIERTKCYNCLVWAKSDNLVRDIMRLSSNVTAGYIIMVDPSTGFRTNLLRIRKAGVVGVYHPLIDEKLVRTFHGRNKRVFAWTVDDEDSMRKMLHERVDAVVTSNPILFQRVMQDIRTQCLEEGFSLIR
cccEEEEEEcccccccccccccccccccHHHHcccccccccccHHHHHHHHHccccEEEEEEEccccccHHHHHHHHHHHHHHcccccEEEEEccHHHHHHHHHHccccEEEEEEcccccccHHHHHHHcccEEEEEcccccccHHHHHHHHHcccEEEEEEcccHHHHHHHHHccccEEEcccHHHHHHHHHHHHHHcccccccccc
cccEEEEEEHHHHHHHcccccccHcHccHHHHHHcccccccccHHHHHHHHcccccEEEEEEEcccccccccHHHHHHHHHHHcccccEEEEEccHHHHHHHHHHcccccEEEEEEEccccccccHHHHcccccEEEEEcccccHHHHHHHHHcccEEEEEEEccHHHHHHHHHccccEEEcccHHHHHHHHHHHHHHHHHccccccc
mescwlfttgrdlqrISGNITSKVGHLSMKEFAQKSHDQVITTIEDALTLVSNSVRKVILdakvgppsyekgLAKDILSVIERTKCYNCLVWAKSDNLVRDIMRLSsnvtagyiimvdpstgfrtNLLRIRKagvvgvyhplidekLVRTfhgrnkrvfawtvdDEDSMRKMLHERVDavvtsnpiLFQRVMQDIRTQCLEEGFSLIR
mescwlfttgrdlqrisGNITSKVGHLSMKEFAQKSHDQVITTIEDALTLVSNSVRKVILdakvgppsyekglAKDILSVIERTKCYNCLVWAKSDNLVRDIMRLSSNVTAGYIIMVDPSTGFRTNLLRIRKAgvvgvyhplideklvrtfhgrnkrvfawtvddedsmRKMLHERVDAVVTSNPILFQRVMQDIRTQCLEEGFSLIR
MESCWLFTTGRDLQRISGNITSKVGHLSMKEFAQKSHDQVITTIEDALTLVSNSVRKVILDAKVGPPSYEKGLAKDILSVIERTKCYNCLVWAKSDNLVRDIMRLSSNVTAGYIIMVDPSTGFRTNLLRIRKAGVVGVYHPLIDEKLVRTFHGRNKRVFAWTVDDEDSMRKMLHERVDAVVTSNPILFQRVMQDIRTQCLEEGFSLIR
***CWLFTTGRDLQRISGNITSKVGHLSMKEFAQKSHDQVITTIEDALTLVSNSVRKVILDAKVGPPSYEKGLAKDILSVIERTKCYNCLVWAKSDNLVRDIMRLSSNVTAGYIIMVDPSTGFRTNLLRIRKAGVVGVYHPLIDEKLVRTFHGRNKRVFAWTVDDEDSMRKMLHERVDAVVTSNPILFQRVMQDIRTQCLEEGF****
*ESCWLFTTGRDLQRISGNITSKVGHLSMKEFAQKSHDQVITTIEDALTLVSNSVRKVILDAKVGPPSYEKGLAKDILSVIERTKCYNCLVWAKSDNLVRDIMRLSSNVTAGYIIMVDPSTGFRTNLLRIRKAGVVGVYHPLIDEKLVRTFHGRNKRVFAWTVDDEDSMRKMLHERVDAVVTSNPILFQRVMQDIRT*CLE**FSLI*
MESCWLFTTGRDLQRISGNITSKVGHLSMKEFAQKSHDQVITTIEDALTLVSNSVRKVILDAKVGPPSYEKGLAKDILSVIERTKCYNCLVWAKSDNLVRDIMRLSSNVTAGYIIMVDPSTGFRTNLLRIRKAGVVGVYHPLIDEKLVRTFHGRNKRVFAWTVDDEDSMRKMLHERVDAVVTSNPILFQRVMQDIRTQCLEEGFSLIR
*ESCWLFTTGRDLQRISGNITSKVGHLSMKEFAQKSHDQVITTIEDALTLVSNSVRKVILDAKVGPPSYEKGLAKDILSVIERTKCYNCLVWAKSDNLVRDIMRLSSNVTAGYIIMVDPSTGFRTNLLRIRKAGVVGVYHPLIDEKLVRTFHGRNKRVFAWTVDDEDSMRKMLHERVDAVVTSNPILFQRVMQDIRTQCLEEGFSLIR
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MESCWLFTTGRDLQRISGNITSKVGHLSMKEFAQKSHDQVITTIEDALTLVSNSVRKVILDAKVGPPSYEKGLAKDILSVIERTKCYNCLVWAKSDNLVRDIMRLSSNVTAGYIIMVDPSTGFRTNLLRIRKAGVVGVYHPLIDEKLVRTFHGRNKRVFAWTVDDEDSMRKMLHERVDAVVTSNPILFQRVMQDIRTQCLEEGFSLIR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query208
255561472 334 glycerophosphoryl diester phosphodiester 0.951 0.592 0.724 2e-81
224124396 341 predicted protein [Populus trichocarpa] 0.951 0.580 0.714 3e-80
225459983 325 PREDICTED: uncharacterized protein LOC10 0.942 0.603 0.702 4e-79
147778759299 hypothetical protein VITISV_030223 [Viti 0.942 0.655 0.601 3e-73
356508146293 PREDICTED: uncharacterized protein LOC10 0.951 0.675 0.623 1e-72
363808152293 uncharacterized protein LOC100794323 [Gl 0.951 0.675 0.628 4e-72
17065162223 Unknown protein [Arabidopsis thaliana] g 0.966 0.901 0.619 6e-70
297841899 329 glycerophosphoryl diester phosphodiester 0.942 0.595 0.634 3e-68
42563134 328 glycerophosphodiester phosphodiesterase 0.942 0.597 0.614 7e-67
449447533 328 PREDICTED: uncharacterized protein LOC10 0.942 0.597 0.624 5e-65
>gi|255561472|ref|XP_002521746.1| glycerophosphoryl diester phosphodiesterase, putative [Ricinus communis] gi|223538959|gb|EEF40556.1| glycerophosphoryl diester phosphodiesterase, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  307 bits (786), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 150/207 (72%), Positives = 173/207 (83%), Gaps = 9/207 (4%)

Query: 11  RDLQRISGNITSKVGHLSMKEF---------AQKSHDQVITTIEDALTLVSNSVRKVILD 61
           RDLQ+ISG+ TSKVG+LSMKE          A++ HDQ I TIE+AL L+S SVR+VILD
Sbjct: 128 RDLQQISGHNTSKVGYLSMKEIKELYVPHQPAEEFHDQTIPTIEEALKLISTSVRQVILD 187

Query: 62  AKVGPPSYEKGLAKDILSVIERTKCYNCLVWAKSDNLVRDIMRLSSNVTAGYIIMVDPST 121
           AK GPPSYEKGLAKDILSV++R +C NCLVWAK DNLVRD+++ SSNVTAGYI+MVDP T
Sbjct: 188 AKAGPPSYEKGLAKDILSVVDRAQCRNCLVWAKGDNLVRDVIKQSSNVTAGYIVMVDPKT 247

Query: 122 GFRTNLLRIRKAGVVGVYHPLIDEKLVRTFHGRNKRVFAWTVDDEDSMRKMLHERVDAVV 181
           G R NLLR++ A VVG+YHPLIDEKLVR  HGRNK+V+AWTVDD DSMR+ML ERVDA+V
Sbjct: 248 GNRMNLLRMKGARVVGIYHPLIDEKLVRILHGRNKQVYAWTVDDVDSMRRMLIERVDAIV 307

Query: 182 TSNPILFQRVMQDIRTQCLEEGFSLIR 208
           TSNP L QR+MQDIRTQC EEGFSL R
Sbjct: 308 TSNPSLLQRLMQDIRTQCREEGFSLPR 334

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224124396|ref|XP_002319321.1| predicted protein [Populus trichocarpa] gi|222857697|gb|EEE95244.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225459983|ref|XP_002267634.1| PREDICTED: uncharacterized protein LOC100251767 [Vitis vinifera] gi|297734770|emb|CBI17004.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147778759|emb|CAN78218.1| hypothetical protein VITISV_030223 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356508146|ref|XP_003522821.1| PREDICTED: uncharacterized protein LOC100786146 [Glycine max] Back     alignment and taxonomy information
>gi|363808152|ref|NP_001242736.1| uncharacterized protein LOC100794323 [Glycine max] gi|255637187|gb|ACU18924.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|17065162|gb|AAL32735.1| Unknown protein [Arabidopsis thaliana] gi|20259926|gb|AAM13310.1| unknown protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297841899|ref|XP_002888831.1| glycerophosphoryl diester phosphodiesterase family protein [Arabidopsis lyrata subsp. lyrata] gi|297334672|gb|EFH65090.1| glycerophosphoryl diester phosphodiesterase family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|42563134|ref|NP_177290.3| glycerophosphodiester phosphodiesterase domain-containing protein [Arabidopsis thaliana] gi|332197070|gb|AEE35191.1| glycerophosphodiester phosphodiesterase domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|449447533|ref|XP_004141522.1| PREDICTED: uncharacterized protein LOC101219565 [Cucumis sativus] gi|449481461|ref|XP_004156190.1| PREDICTED: uncharacterized protein LOC101229805 [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query208
TAIR|locus:2032323328 GDPD4 "glycerophosphodiester p 0.942 0.597 0.614 1.8e-62
TIGR_CMR|BA_0591611 BA_0591 "glycerophosphoryl die 0.865 0.294 0.234 8.4e-07
TAIR|locus:2032323 GDPD4 "glycerophosphodiester phosphodiesterase 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 638 (229.6 bits), Expect = 1.8e-62, P = 1.8e-62
 Identities = 126/205 (61%), Positives = 158/205 (77%)

Query:    11 RDLQRISGNITSKVGHLSMKEFAQKSHDQV---------ITTIEDALTLVSNSVRKVILD 61
             RDLQRI+ N + +VG LSMK+  +    ++         I T+E+AL L+SNSVRKVILD
Sbjct:   122 RDLQRIARNSSVQVGDLSMKQIKELDVSEIVKGTLGSSRIPTLEEALALISNSVRKVILD 181

Query:    62 AKVGPPSYEKGLAKDILSVIERTKCYNCLVWAKSDNLVRDIMRLSSNVTAGYIIMVDPST 121
             AKVGPP YEKGLA+DILS+IER +C NC+VWAKSD L RDI+R + +   GYI+MVDP T
Sbjct:   182 AKVGPPMYEKGLAQDILSIIERAQCNNCIVWAKSDTLARDIIRRAPDTMVGYIVMVDPLT 241

Query:   122 GFRTNLLRIRKAGVVGVYHPLIDEKLVRTFHGRNKRVFAWTVDDEDSMRKMLHERVDAVV 181
             G R +LLR++ A VVGVYHPLIDE+LVR    RNK V+AWTVDD D M++MLH  VDAVV
Sbjct:   242 GARNSLLRMKGARVVGVYHPLIDEELVRVVRRRNKEVYAWTVDDADPMKRMLHLGVDAVV 301

Query:   182 TSNPILFQRVMQDIRTQCLEEGFSL 206
             TS+P +FQ +M+D+RT+CLEEGFS+
Sbjct:   302 TSDPSMFQGLMEDLRTECLEEGFSI 326
GO:0005886 "plasma membrane" evidence=ISM
GO:0006071 "glycerol metabolic process" evidence=IEA;ISS
GO:0006629 "lipid metabolic process" evidence=IEA
GO:0008081 "phosphoric diester hydrolase activity" evidence=IEA
GO:0008889 "glycerophosphodiester phosphodiesterase activity" evidence=IEA;ISS
TIGR_CMR|BA_0591 BA_0591 "glycerophosphoryl diester phosphodiesterase family protein" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query208
cd08556189 cd08556, GDPD, Glycerophosphodiester phosphodieste 5e-22
cd08579220 cd08579, GDPD_memb_like, Glycerophosphodiester pho 2e-12
cd08561249 cd08561, GDPD_cytoplasmic_ScUgpQ2_like, Glyceropho 2e-10
cd08567263 cd08567, GDPD_SpGDE_like, Glycerophosphodiester ph 7e-08
pfam03009238 pfam03009, GDPD, Glycerophosphoryl diester phospho 1e-07
cd08563230 cd08563, GDPD_TtGDE_like, Glycerophosphodiester ph 9e-07
pfam1365330 pfam13653, GDPD_2, Glycerophosphoryl diester phosp 1e-06
COG0584257 COG0584, UgpQ, Glycerophosphoryl diester phosphodi 1e-05
cd08582233 cd08582, GDPD_like_2, Glycerophosphodiester phosph 2e-05
cd08570234 cd08570, GDPD_YPL206cp_fungi, Glycerophosphodieste 4e-04
cd08568226 cd08568, GDPD_TmGDE_like, Glycerophosphodiester ph 0.001
>gnl|CDD|176499 cd08556, GDPD, Glycerophosphodiester phosphodiesterase domain as found in prokaryota and eukaryota, and similar proteins Back     alignment and domain information 
 Score = 88.1 bits (219), Expect = 5e-22
 Identities = 38/149 (25%), Positives = 66/149 (44%), Gaps = 6/149 (4%)

Query: 37  HDQVITTIEDALTLVSNSVRKVILDAKVGPPSYEKGLAKDILSVIERTKCYN-CLVWAKS 95
           HD  I T+E+ L LV   V  + ++ K   P+   GL   +  ++         +V +  
Sbjct: 46  HD--IPTLEEVLELVKGGV-GLNIELK--EPTRYPGLEAKVAELLREYGLEERVVVSSFD 100

Query: 96  DNLVRDIMRLSSNVTAGYIIMVDPSTGFRTNLLRIRKAGVVGVYHPLIDEKLVRTFHGRN 155
              +R +  L   V  G ++   P       L R   A  V  ++ L+  +LVR  H   
Sbjct: 101 HEALRALKELDPEVPTGLLVDKPPLDPLLAELARALGADAVNPHYKLLTPELVRAAHAAG 160

Query: 156 KRVFAWTVDDEDSMRKMLHERVDAVVTSN 184
            +V+ WTV+D +  R++L   VD ++T +
Sbjct: 161 LKVYVWTVNDPEDARRLLALGVDGIITDD 189

The typical glycerophosphodiester phosphodiesterase domain (GDPD) consists of a TIM barrel and a small insertion domain named the GDPD-insertion (GDPD-I) domain, which is specific for GDPD proteins. This family corresponds to both typical GDPD domain and GDPD-like domain which lacks the GDPD-I region. Members in this family mainly consist of a large family of prokaryotic and eukaryotic glycerophosphodiester phosphodiesterases (GP-GDEs, EC 3.1.4.46), and a number of uncharacterized homologs. Sphingomyelinases D (SMases D) (sphingomyelin phosphodiesterase D, EC 3.1.4.41) from spider venom, SMases D-like proteins, and phospholipase D (PLD) from several pathogenic bacteria are also included in this family. GDPD plays an essential role in glycerol metabolism and catalyzes the hydrolysis of glycerophosphodiesters to sn-glycerol-3-phosphate (G3P) and the corresponding alcohols are major sources of carbon and phosphate. Its catalytic mechanism is based on the metal ion-dependent acid-base reaction, which is similar to that of phosphoinositide-specific phospholipases C (PI-PLCs, EC 3.1.4.11). Both, GDPD related proteins and PI-PLCs, belong to the superfamily of PI-PLC-like phosphodiesterases. Length = 189
>gnl|CDD|176521 cd08579, GDPD_memb_like, Glycerophosphodiester phosphodiesterase domain of uncharacterized bacterial glycerophosphodiester phosphodiesterases Back     alignment and domain information
>gnl|CDD|176504 cd08561, GDPD_cytoplasmic_ScUgpQ2_like, Glycerophosphodiester phosphodiesterase domain of Streptomyces coelicolor cytoplasmic phosphodiesterases UgpQ2 and similar proteins Back     alignment and domain information
>gnl|CDD|176510 cd08567, GDPD_SpGDE_like, Glycerophosphodiester phosphodiesterase domain of putative Silicibacter pomeroyi glycerophosphodiester phosphodiesterase and similar proteins Back     alignment and domain information
>gnl|CDD|217317 pfam03009, GDPD, Glycerophosphoryl diester phosphodiesterase family Back     alignment and domain information
>gnl|CDD|176506 cd08563, GDPD_TtGDE_like, Glycerophosphodiester phosphodiesterase domain of Thermoanaerobacter tengcongensis and similar proteins Back     alignment and domain information
>gnl|CDD|205830 pfam13653, GDPD_2, Glycerophosphoryl diester phosphodiesterase family Back     alignment and domain information
>gnl|CDD|223657 COG0584, UgpQ, Glycerophosphoryl diester phosphodiesterase [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|176524 cd08582, GDPD_like_2, Glycerophosphodiester phosphodiesterase domain of uncharacterized bacterial glycerophosphodiester phosphodiesterases Back     alignment and domain information
>gnl|CDD|176512 cd08570, GDPD_YPL206cp_fungi, Glycerophosphodiester phosphodiesterase domain of Saccharomyces cerevisiae YPL206cp and similar proteins Back     alignment and domain information
>gnl|CDD|176511 cd08568, GDPD_TmGDE_like, Glycerophosphodiester phosphodiesterase domain of Thermotoga maritime and similar proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 208
cd08562229 GDPD_EcUgpQ_like Glycerophosphodiester phosphodies 100.0
PRK09454249 ugpQ cytoplasmic glycerophosphodiester phosphodies 100.0
cd08568226 GDPD_TmGDE_like Glycerophosphodiester phosphodiest 100.0
cd08565235 GDPD_pAtGDE_like Glycerophosphodiester phosphodies 100.0
cd08582233 GDPD_like_2 Glycerophosphodiester phosphodiesteras 100.0
cd08601256 GDPD_SaGlpQ_like Glycerophosphodiester phosphodies 100.0
cd08612300 GDPD_GDE4 Glycerophosphodiester phosphodiesterase 100.0
cd08581229 GDPD_like_1 Glycerophosphodiester phosphodiesteras 100.0
cd08579220 GDPD_memb_like Glycerophosphodiester phosphodieste 100.0
cd08563230 GDPD_TtGDE_like Glycerophosphodiester phosphodiest 100.0
cd08580263 GDPD_Rv2277c_like Glycerophosphodiester phosphodie 100.0
cd08609315 GDPD_GDE3 Glycerophosphodiester phosphodiesterase 100.0
cd08610316 GDPD_GDE6 Glycerophosphodiester phosphodiesterase 100.0
cd08574252 GDPD_GDE_2_3_6 Glycerophosphodiester phosphodieste 100.0
cd08573258 GDPD_GDE1 Glycerophosphodiester phosphodiesterase 100.0
cd08564265 GDPD_GsGDE_like Glycerophosphodiester phosphodiest 100.0
cd08559296 GDPD_periplasmic_GlpQ_like Periplasmic glycerophos 100.0
cd08567263 GDPD_SpGDE_like Glycerophosphodiester phosphodiest 100.0
cd08575264 GDPD_GDE4_like Glycerophosphodiester phosphodieste 100.0
cd08605282 GDPD_GDE5_like_1_plant Glycerophosphodiester phosp 100.0
cd08608351 GDPD_GDE2 Glycerophosphodiester phosphodiesterase 100.0
cd08570234 GDPD_YPL206cp_fungi Glycerophosphodiester phosphod 100.0
cd08585237 GDPD_like_3 Glycerophosphodiester phosphodiesteras 100.0
cd08561249 GDPD_cytoplasmic_ScUgpQ2_like Glycerophosphodieste 100.0
cd08606286 GDPD_YPL110cp_fungi Glycerophosphodiester phosphod 100.0
cd08583237 PI-PLCc_GDPD_SF_unchar1 Uncharacterized hypothetic 100.0
cd08604300 GDPD_SHV3_repeat_2 Glycerophosphodiester phosphodi 100.0
cd08566240 GDPD_AtGDE_like Glycerophosphodiester phosphodiest 100.0
cd08571302 GDPD_SHV3_plant Glycerophosphodiester phosphodiest 100.0
cd08600318 GDPD_EcGlpQ_like Glycerophosphodiester phosphodies 100.0
cd08572293 GDPD_GDE5_like Glycerophosphodiester phosphodieste 100.0
PRK11143355 glpQ glycerophosphodiester phosphodiesterase; Prov 100.0
cd08607290 GDPD_GDE5 Glycerophosphodiester phosphodiesterase 100.0
cd08602309 GDPD_ScGlpQ1_like Glycerophosphodiester phosphodie 99.98
cd08560356 GDPD_EcGlpQ_like_1 Glycerophosphodiester phosphodi 99.97
cd08613309 GDPD_GDE4_like_1 Glycerophosphodiester phosphodies 99.96
PF03009256 GDPD: Glycerophosphoryl diester phosphodiesterase 99.95
cd08556189 GDPD Glycerophosphodiester phosphodiesterase domai 99.95
COG0584257 UgpQ Glycerophosphoryl diester phosphodiesterase [ 99.94
cd08603299 GDPD_SHV3_repeat_1 Glycerophosphodiester phosphodi 99.93
cd08555179 PI-PLCc_GDPD_SF Catalytic domain of phosphoinositi 99.91
cd08578300 GDPD_NUC-2_fungi Putative glycerophosphodiester ph 99.8
cd08584192 PI-PLCc_GDPD_SF_unchar2 Uncharacterized hypothetic 99.6
cd08576265 GDPD_like_SMaseD_PLD Glycerophosphodiester phospho 99.18
cd08577228 PI-PLCc_GDPD_SF_unchar3 Uncharacterized hypothetic 99.15
PF1365330 GDPD_2: Glycerophosphoryl diester phosphodiesteras 99.07
KOG2258341 consensus Glycerophosphoryl diester phosphodiester 98.87
COG0134254 TrpC Indole-3-glycerol phosphate synthase [Amino a 96.52
TIGR01182204 eda Entner-Doudoroff aldolase. 2-deydro-3-deoxypho 96.21
PRK06552213 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 95.71
PRK05718212 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 95.64
cd04726202 KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxyl 95.54
COG2200256 Rtn c-di-GMP phosphodiesterase class I (EAL domain 95.14
PLN02460338 indole-3-glycerol-phosphate synthase 95.04
PF00218254 IGPS: Indole-3-glycerol phosphate synthase; InterP 94.98
PRK13957247 indole-3-glycerol-phosphate synthase; Provisional 94.92
cd00452190 KDPG_aldolase KDPG and KHG aldolase. This family b 94.87
PRK07114222 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 94.84
PF01081196 Aldolase: KDPG and KHG aldolase; InterPro: IPR0008 94.6
PRK06015201 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 94.57
PF03060 330 NMO: Nitronate monooxygenase; InterPro: IPR004136 94.37
TIGR03128206 RuMP_HxlA 3-hexulose-6-phosphate synthase. at the 94.29
PRK00278260 trpC indole-3-glycerol-phosphate synthase; Reviewe 94.25
PF10566 273 Glyco_hydro_97: Glycoside hydrolase 97 ; InterPro: 94.13
cd04743 320 NPD_PKS 2-Nitropropane dioxygenase (NPD)-like doma 93.58
PF04309175 G3P_antiterm: Glycerol-3-phosphate responsive anti 93.19
PF05913 357 DUF871: Bacterial protein of unknown function (DUF 93.09
PRK13802 695 bifunctional indole-3-glycerol phosphate synthase/ 93.06
PF04309175 G3P_antiterm: Glycerol-3-phosphate responsive anti 92.92
COG0800211 Eda 2-keto-3-deoxy-6-phosphogluconate aldolase [Ca 92.35
COG1954181 GlpP Glycerol-3-phosphate responsive antiterminato 91.89
PRK07455187 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 91.79
PRK11059640 regulatory protein CsrD; Provisional 91.29
COG0269217 SgbH 3-hexulose-6-phosphate synthase and related p 90.84
TIGR03151 307 enACPred_II putative enoyl-(acyl-carrier-protein) 90.69
PRK10060663 RNase II stability modulator; Provisional 90.64
COG3010229 NanE Putative N-acetylmannosamine-6-phosphate epim 90.05
cd02809299 alpha_hydroxyacid_oxid_FMN Family of homologous FM 89.83
cd00331217 IGPS Indole-3-glycerol phosphate synthase (IGPS); 89.45
TIGR01768223 GGGP-family geranylgeranylglyceryl phosphate synth 89.4
cd00381 325 IMPDH IMPDH: The catalytic domain of the inosine m 89.03
cd04729219 NanE N-acetylmannosamine-6-phosphate epimerase (Na 88.79
cd02812219 PcrB_like PcrB_like proteins. One member of this f 88.04
cd00956211 Transaldolase_FSA Transaldolase-like fructose-6-ph 87.81
PRK09722229 allulose-6-phosphate 3-epimerase; Provisional 87.25
COG3589 360 Uncharacterized conserved protein [Function unknow 86.62
PLN02591250 tryptophan synthase 86.6
PF00563236 EAL: EAL domain; InterPro: IPR001633 This domain i 86.59
PF04413186 Glycos_transf_N: 3-Deoxy-D-manno-octulosonic-acid 86.45
PRK12331 448 oxaloacetate decarboxylase; Provisional 85.87
cd04728248 ThiG Thiazole synthase (ThiG) is the tetrameric en 85.75
PRK09427 454 bifunctional indole-3-glycerol phosphate synthase/ 85.53
TIGR01769205 GGGP geranylgeranylglyceryl phosphate synthase. Th 85.48
TIGR01108 582 oadA oxaloacetate decarboxylase alpha subunit. Thi 85.39
PRK09140206 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; R 85.37
COG0826 347 Collagenase and related proteases [Posttranslation 84.91
PRK08883220 ribulose-phosphate 3-epimerase; Provisional 84.63
PRK13561651 putative diguanylate cyclase; Provisional 84.08
PRK01130221 N-acetylmannosamine-6-phosphate 2-epimerase; Provi 84.08
PRK00208250 thiG thiazole synthase; Reviewed 84.01
KOG4201289 consensus Anthranilate synthase component II [Amin 83.72
cd00405203 PRAI Phosphoribosylanthranilate isomerase (PRAI) c 83.09
PRK08745223 ribulose-phosphate 3-epimerase; Provisional 82.92
PRK08005210 epimerase; Validated 82.09
PRK11829660 biofilm formation regulator HmsP; Provisional 81.7
PRK097761092 putative diguanylate cyclase; Provisional 81.57
TIGR01302450 IMP_dehydrog inosine-5'-monophosphate dehydrogenas 81.5
TIGR01064 473 pyruv_kin pyruvate kinase. This enzyme is a homote 81.42
cd01948240 EAL EAL domain. This domain is found in diverse ba 81.19
cd08592229 PI-PLCc_gamma Catalytic domain of metazoan phospho 81.18
PRK08195 337 4-hyroxy-2-oxovalerate/4-hydroxy-2-oxopentanoic ac 81.17
PLN02334229 ribulose-phosphate 3-epimerase 80.9
PRK09283323 delta-aminolevulinic acid dehydratase; Validated 80.5
PTZ00170228 D-ribulose-5-phosphate 3-epimerase; Provisional 80.23
>cd08562 GDPD_EcUgpQ_like Glycerophosphodiester phosphodiesterase domain in Escherichia coli cytosolic glycerophosphodiester phosphodiesterase UgpQ and similar proteins Back     alignment and domain information 
Probab=100.00  E-value=1.1e-36  Score=241.03  Aligned_cols=180  Identities=21%  Similarity=0.238  Sum_probs=154.0

Q ss_pred             CceEEEEeCccchhhhCCCcccccccCHHHhhc---------ccCCCcCCCHHHHHHHHhcCCceEEEEeecCCCCCchh
Q 028497            2 ESCWLFTTGRDLQRISGNITSKVGHLSMKEFAQ---------KSHDQVITTIEDALTLVSNSVRKVILDAKVGPPSYEKG   72 (208)
Q Consensus         2 Dg~~Vv~HD~~l~r~tg~g~~~i~~~t~~eL~~---------~~~~~~iptL~evL~~~~~~~~~l~lEiK~~~~~~~~~   72 (208)
                      ||++||+||++++|+||. .+.|+++||+||++         .+.++++|||+|+|+++++.++.++||+|..... ...
T Consensus        39 Dg~lvv~HD~~l~r~t~~-~~~i~~lt~~el~~l~~~~~~~~~~~~~~iptl~evl~~~~~~~~~l~iEiK~~~~~-~~~  116 (229)
T cd08562          39 DGTLVLIHDDTLDRTTNG-SGAVTELTWAELAQLDAGSWFSPEFAGEPIPTLADVLELARELGLGLNLEIKPDPGD-EAL  116 (229)
T ss_pred             CCCEEEEcCCCCccccCC-CceeecCcHHHHhhcCCCcccCCCCCCCCCCCHHHHHHHHHhcCCEEEEEECCCCCc-cHH
Confidence            999999999999999965 69999999999964         2356899999999999987667899999986533 236


Q ss_pred             HHHHHHHHHHhcCC--cceEEEeeCHHHHHHHHhhccCCeEEEEEEecCCCchhhhHhhhhcCceEeecccccCHHHHHH
Q 028497           73 LAKDILSVIERTKC--YNCLVWAKSDNLVRDIMRLSSNVTAGYIIMVDPSTGFRTNLLRIRKAGVVGVYHPLIDEKLVRT  150 (208)
Q Consensus        73 ~~~~v~~~l~~~~~--~~~ii~Sf~~~~l~~l~~~~p~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~  150 (208)
                      +++.+.+++++++.  .+++++||+++.++.+++..|++++|++....+.  .+.++.+..++..+.+.+..+++++++.
T Consensus       117 ~~~~v~~~l~~~~~~~~~v~~~Sf~~~~l~~~~~~~p~~~~~~l~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~v~~  194 (229)
T cd08562         117 TARVVAAALRELWPHASKLLLSSFSLEALRAARRAAPELPLGLLFDTLPA--DWLELLAALGAVSIHLNYRGLTEEQVKA  194 (229)
T ss_pred             HHHHHHHHHHHhcCCcCCEEEECCCHHHHHHHHHhCCCCcEEEEecCCCc--CHHHHHHHcCCeEEecChhhCCHHHHHH
Confidence            77889999999986  3457799999999999999999999998754332  1234445577777888888899999999


Q ss_pred             HHhCCCeEEEeeCCCHHHHHHHHhCCCCEEEcCCh
Q 028497          151 FHGRNKRVFAWTVDDEDSMRKMLHERVDAVVTSNP  185 (208)
Q Consensus       151 ~~~~g~~v~~wtv~~~~~~~~~~~~gvd~i~TD~P  185 (208)
                      +|++|++|++||+|+++++++++++||||||||+|
T Consensus       195 ~~~~g~~v~~wTvn~~~~~~~~~~~gVdgiiTD~p  229 (229)
T cd08562         195 LKDAGYKLLVYTVNDPARAAELLEWGVDAIFTDRP  229 (229)
T ss_pred             HHHCCCEEEEEeCCCHHHHHHHHHCCCCEEEcCCC
Confidence            99999999999999999999999999999999998

This subfamily corresponds to the glycerophosphodiester phosphodiesterase domain (GDPD) present in Escherichia coli cytosolic glycerophosphodiester phosphodiesterase (GP-GDE, EC 3.1.4.46), UgpQ, and similar proteins. GP-GDE plays an essential role in the metabolic pathway of E. coli. It catalyzes the degradation of glycerophosphodiesters to produce sn-glycerol-3-phosphate (G3P) and the corresponding alcohols, which are major sources of carbon and phosphate. E. coli possesses two major G3P uptake systems: Glp and Ugp, which contain genes coding for two distinct GP-GDEs. UgpQ gene from the E. coli ugp operon codes for a cytosolic phosphodiesterase GlpQ, which is the prototype of this family. Various glycerophosphodiesters, such as glycerophosphocholine (GPC), glycerophosphoethanolanmine (GPE), glycerophosphoglycerol (GPG)
>PRK09454 ugpQ cytoplasmic glycerophosphodiester phosphodiesterase; Provisional Back     alignment and domain information
>cd08568 GDPD_TmGDE_like Glycerophosphodiester phosphodiesterase domain of Thermotoga maritime and similar proteins Back     alignment and domain information
>cd08565 GDPD_pAtGDE_like Glycerophosphodiester phosphodiesterase domain of putative Agrobacterium tumefaciens glycerophosphodiester phosphodiesterase and similar proteins Back     alignment and domain information
>cd08582 GDPD_like_2 Glycerophosphodiester phosphodiesterase domain of uncharacterized bacterial glycerophosphodiester phosphodiesterases Back     alignment and domain information
>cd08601 GDPD_SaGlpQ_like Glycerophosphodiester phosphodiesterase domain of Staphylococcus aureus and similar proteins Back     alignment and domain information
>cd08612 GDPD_GDE4 Glycerophosphodiester phosphodiesterase domain of mammalian glycerophosphodiester phosphodiesterase GDE4 and similar proteins Back     alignment and domain information
>cd08581 GDPD_like_1 Glycerophosphodiester phosphodiesterase domain of uncharacterized bacterial glycerophosphodiester phosphodiesterases Back     alignment and domain information
>cd08579 GDPD_memb_like Glycerophosphodiester phosphodiesterase domain of uncharacterized bacterial glycerophosphodiester phosphodiesterases Back     alignment and domain information
>cd08563 GDPD_TtGDE_like Glycerophosphodiester phosphodiesterase domain of Thermoanaerobacter tengcongensis and similar proteins Back     alignment and domain information
>cd08580 GDPD_Rv2277c_like Glycerophosphodiester phosphodiesterase domain of uncharacterized bacterial protein Rv2277c and similar proteins Back     alignment and domain information
>cd08609 GDPD_GDE3 Glycerophosphodiester phosphodiesterase domain of mammalian glycerophosphodiester phosphodiesterase GDE3 and similar proteins Back     alignment and domain information
>cd08610 GDPD_GDE6 Glycerophosphodiester phosphodiesterase domain of mammalian glycerophosphodiester phosphodiesterase GDE6 and similar proteins Back     alignment and domain information
>cd08574 GDPD_GDE_2_3_6 Glycerophosphodiester phosphodiesterase domain of mammalian glycerophosphodiester phosphodiesterase GDE2, GDE3, GDE6-like proteins Back     alignment and domain information
>cd08573 GDPD_GDE1 Glycerophosphodiester phosphodiesterase domain of mammalian glycerophosphodiester phosphodiesterase GDE1 and similar proteins Back     alignment and domain information
>cd08564 GDPD_GsGDE_like Glycerophosphodiester phosphodiesterase domain of putative Galdieria sulphuraria glycerophosphodiester phosphodiesterase and similar proteins Back     alignment and domain information
>cd08559 GDPD_periplasmic_GlpQ_like Periplasmic glycerophosphodiester phosphodiesterase domain (GlpQ) and similar proteins Back     alignment and domain information
>cd08567 GDPD_SpGDE_like Glycerophosphodiester phosphodiesterase domain of putative Silicibacter pomeroyi glycerophosphodiester phosphodiesterase and similar proteins Back     alignment and domain information
>cd08575 GDPD_GDE4_like Glycerophosphodiester phosphodiesterase domain of mammalian glycerophosphodiester phosphodiesterase GDE4-like proteins Back     alignment and domain information
>cd08605 GDPD_GDE5_like_1_plant Glycerophosphodiester phosphodiesterase domain of uncharacterized plant glycerophosphodiester phosphodiesterase-like proteins similar to mammalian GDE5 Back     alignment and domain information
>cd08608 GDPD_GDE2 Glycerophosphodiester phosphodiesterase domain of mammalian glycerophosphodiester phosphodiesterase GDE2 and similar proteins Back     alignment and domain information
>cd08570 GDPD_YPL206cp_fungi Glycerophosphodiester phosphodiesterase domain of Saccharomyces cerevisiae YPL206cp and similar proteins Back     alignment and domain information
>cd08585 GDPD_like_3 Glycerophosphodiester phosphodiesterase domain of uncharacterized bacterial glycerophosphodiester phosphodiesterases Back     alignment and domain information
>cd08561 GDPD_cytoplasmic_ScUgpQ2_like Glycerophosphodiester phosphodiesterase domain of Streptomyces coelicolor cytoplasmic phosphodiesterases UgpQ2 and similar proteins Back     alignment and domain information
>cd08606 GDPD_YPL110cp_fungi Glycerophosphodiester phosphodiesterase domain of Saccharomyces cerevisiae YPL110cp and similar proteins Back     alignment and domain information
>cd08583 PI-PLCc_GDPD_SF_unchar1 Uncharacterized hypothetical proteins similar to the catalytic domains of Phosphoinositide-specific phospholipaseand Glycerophosphodiester phosphodiesterases Back     alignment and domain information
>cd08604 GDPD_SHV3_repeat_2 Glycerophosphodiester phosphodiesterase domain repeat 2 of glycerophosphodiester phosphodiesterase-like protein SHV3 and SHV3-like proteins Back     alignment and domain information
>cd08566 GDPD_AtGDE_like Glycerophosphodiester phosphodiesterase domain of Agrobacterium tumefaciens and similar proteins Back     alignment and domain information
>cd08571 GDPD_SHV3_plant Glycerophosphodiester phosphodiesterase domain of glycerophosphodiester phosphodiesterase-like protein SHV3 and SHV3-like proteins Back     alignment and domain information
>cd08600 GDPD_EcGlpQ_like Glycerophosphodiester phosphodiesterase domain of Escherichia coli (GlpQ) and similar proteins Back     alignment and domain information
>cd08572 GDPD_GDE5_like Glycerophosphodiester phosphodiesterase domain of mammalian glycerophosphodiester phosphodiesterase GDE5-like proteins Back     alignment and domain information
>PRK11143 glpQ glycerophosphodiester phosphodiesterase; Provisional Back     alignment and domain information
>cd08607 GDPD_GDE5 Glycerophosphodiester phosphodiesterase domain of putative mammalian glycerophosphodiester phosphodiesterase GDE5 and similar proteins Back     alignment and domain information
>cd08602 GDPD_ScGlpQ1_like Glycerophosphodiester phosphodiesterase domain of Streptomycin coelicolor (GlpQ1) and similar proteins Back     alignment and domain information
>cd08560 GDPD_EcGlpQ_like_1 Glycerophosphodiester phosphodiesterase domain similar to Escherichia coli periplasmic phosphodiesterase (GlpQ) include uncharacterized proteins Back     alignment and domain information
>cd08613 GDPD_GDE4_like_1 Glycerophosphodiester phosphodiesterase domain of uncharacterized bacterial homologs of mammalian glycerophosphodiester phosphodiesterase GDE4 Back     alignment and domain information
>PF03009 GDPD: Glycerophosphoryl diester phosphodiesterase family; InterPro: IPR004129 Glycerophosphoryl diester phosphodiesterases display broad specificity for glycerophosphodiesters; glycerophosphocholine, glycerophosphoethanolamine, glycerophosphoglycerol, and bis(glycerophosphoglycerol) all of which are are hydrolysed by this enzyme Back     alignment and domain information
>cd08556 GDPD Glycerophosphodiester phosphodiesterase domain as found in prokaryota and eukaryota, and similar proteins Back     alignment and domain information
>COG0584 UgpQ Glycerophosphoryl diester phosphodiesterase [Energy production and conversion] Back     alignment and domain information
>cd08603 GDPD_SHV3_repeat_1 Glycerophosphodiester phosphodiesterase domain repeat 1 of glycerophosphodiester phosphodiesterase-like protein SHV3 and SHV3-like proteins Back     alignment and domain information
>cd08555 PI-PLCc_GDPD_SF Catalytic domain of phosphoinositide-specific phospholipase C-like phosphodiesterases superfamily Back     alignment and domain information
>cd08578 GDPD_NUC-2_fungi Putative glycerophosphodiester phosphodiesterase domain of ankyrin repeat protein NUC-2 and similar proteins Back     alignment and domain information
>cd08584 PI-PLCc_GDPD_SF_unchar2 Uncharacterized hypothetical proteins similar to the catalytic domains of Phosphoinositide-specific phospholipaseand Glycerophosphodiester phosphodiesterases Back     alignment and domain information
>cd08576 GDPD_like_SMaseD_PLD Glycerophosphodiester phosphodiesterase-like domain of spider venom sphingomyelinases D, bacterial phospholipase D, and similar proteins Back     alignment and domain information
>cd08577 PI-PLCc_GDPD_SF_unchar3 Uncharacterized hypothetical proteins similar to the catalytic domains of Phosphoinositide-specific phospholipaseand Glycerophosphodiester phosphodiesterases Back     alignment and domain information
>PF13653 GDPD_2: Glycerophosphoryl diester phosphodiesterase family; PDB: 3RLG_A 2F9R_B 1XX1_A 3RLH_A Back     alignment and domain information
>KOG2258 consensus Glycerophosphoryl diester phosphodiesterase [Energy production and conversion] Back     alignment and domain information
>COG0134 TrpC Indole-3-glycerol phosphate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01182 eda Entner-Doudoroff aldolase Back     alignment and domain information
>PRK06552 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>PRK05718 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>cd04726 KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxylase (KGPDC) and D-arabino-3-hexulose-6-phosphate synthase (HPS) Back     alignment and domain information
>COG2200 Rtn c-di-GMP phosphodiesterase class I (EAL domain) [Signal transduction mechanisms] Back     alignment and domain information
>PLN02460 indole-3-glycerol-phosphate synthase Back     alignment and domain information
>PF00218 IGPS: Indole-3-glycerol phosphate synthase; InterPro: IPR013798 Indole-3-glycerol phosphate synthase (4 Back     alignment and domain information
>PRK13957 indole-3-glycerol-phosphate synthase; Provisional Back     alignment and domain information
>cd00452 KDPG_aldolase KDPG and KHG aldolase Back     alignment and domain information
>PRK07114 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>PF01081 Aldolase: KDPG and KHG aldolase; InterPro: IPR000887 4-Hydroxy-2-oxoglutarate aldolase (4 Back     alignment and domain information
>PRK06015 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>PF03060 NMO: Nitronate monooxygenase; InterPro: IPR004136 2-Nitropropane dioxygenase (1 Back     alignment and domain information
>TIGR03128 RuMP_HxlA 3-hexulose-6-phosphate synthase Back     alignment and domain information
>PRK00278 trpC indole-3-glycerol-phosphate synthase; Reviewed Back     alignment and domain information
>PF10566 Glyco_hydro_97: Glycoside hydrolase 97 ; InterPro: IPR019563 O-Glycosyl hydrolases 3 Back     alignment and domain information
>cd04743 NPD_PKS 2-Nitropropane dioxygenase (NPD)-like domain, associated with polyketide synthases (PKS) Back     alignment and domain information
>PF04309 G3P_antiterm: Glycerol-3-phosphate responsive antiterminator; InterPro: IPR006699 Glycerol enters bacterial cells via facilitated diffusion, an energy-independent transport process catalysed by the glycerol transport facilitator GlpF, an integral membrane protein of the aquaporin family Back     alignment and domain information
>PF05913 DUF871: Bacterial protein of unknown function (DUF871); InterPro: IPR008589 This family consists of several conserved hypothetical proteins from bacteria and archaea Back     alignment and domain information
>PRK13802 bifunctional indole-3-glycerol phosphate synthase/tryptophan synthase subunit beta; Provisional Back     alignment and domain information
>PF04309 G3P_antiterm: Glycerol-3-phosphate responsive antiterminator; InterPro: IPR006699 Glycerol enters bacterial cells via facilitated diffusion, an energy-independent transport process catalysed by the glycerol transport facilitator GlpF, an integral membrane protein of the aquaporin family Back     alignment and domain information
>COG0800 Eda 2-keto-3-deoxy-6-phosphogluconate aldolase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG1954 GlpP Glycerol-3-phosphate responsive antiterminator (mRNA-binding) [Transcription] Back     alignment and domain information
>PRK07455 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>PRK11059 regulatory protein CsrD; Provisional Back     alignment and domain information
>COG0269 SgbH 3-hexulose-6-phosphate synthase and related proteins [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR03151 enACPred_II putative enoyl-(acyl-carrier-protein) reductase II Back     alignment and domain information
>PRK10060 RNase II stability modulator; Provisional Back     alignment and domain information
>COG3010 NanE Putative N-acetylmannosamine-6-phosphate epimerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd02809 alpha_hydroxyacid_oxid_FMN Family of homologous FMN-dependent alpha-hydroxyacid oxidizing enzymes Back     alignment and domain information
>cd00331 IGPS Indole-3-glycerol phosphate synthase (IGPS); an enzyme in the tryptophan biosynthetic pathway, catalyzing the ring closure reaction of 1-(o-carboxyphenylamino)-1-deoxyribulose-5-phosphate (CdRP) to indole-3-glycerol phosphate (IGP), accompanied by the release of carbon dioxide and water Back     alignment and domain information
>TIGR01768 GGGP-family geranylgeranylglyceryl phosphate synthase family protein Back     alignment and domain information
>cd00381 IMPDH IMPDH: The catalytic domain of the inosine monophosphate dehydrogenase Back     alignment and domain information
>cd04729 NanE N-acetylmannosamine-6-phosphate epimerase (NanE) converts N-acetylmannosamine-6-phosphate to N-acetylglucosamine-6-phosphate Back     alignment and domain information
>cd02812 PcrB_like PcrB_like proteins Back     alignment and domain information
>cd00956 Transaldolase_FSA Transaldolase-like fructose-6-phosphate aldolases (FSA) found in bacteria and archaea, which are member of the MipB/TalC subfamily of class I aldolases Back     alignment and domain information
>PRK09722 allulose-6-phosphate 3-epimerase; Provisional Back     alignment and domain information
>COG3589 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PLN02591 tryptophan synthase Back     alignment and domain information
>PF00563 EAL: EAL domain; InterPro: IPR001633 This domain is found in diverse bacterial signalling proteins Back     alignment and domain information
>PF04413 Glycos_transf_N: 3-Deoxy-D-manno-octulosonic-acid transferase (kdotransferase); InterPro: IPR007507 This is a domain found in proteins that transfer activated sugars to a variety of substrates, including glycogen, fructose-6-phosphate and lipopolysaccharides Back     alignment and domain information
>PRK12331 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>cd04728 ThiG Thiazole synthase (ThiG) is the tetrameric enzyme that is involved in the formation of the thiazole moiety of thiamin pyrophosphate, an essential ubiquitous cofactor that plays an important role in carbohydrate and amino acid metabolism Back     alignment and domain information
>PRK09427 bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase; Provisional Back     alignment and domain information
>TIGR01769 GGGP geranylgeranylglyceryl phosphate synthase Back     alignment and domain information
>TIGR01108 oadA oxaloacetate decarboxylase alpha subunit Back     alignment and domain information
>PRK09140 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; Reviewed Back     alignment and domain information
>COG0826 Collagenase and related proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK08883 ribulose-phosphate 3-epimerase; Provisional Back     alignment and domain information
>PRK13561 putative diguanylate cyclase; Provisional Back     alignment and domain information
>PRK01130 N-acetylmannosamine-6-phosphate 2-epimerase; Provisional Back     alignment and domain information
>PRK00208 thiG thiazole synthase; Reviewed Back     alignment and domain information
>KOG4201 consensus Anthranilate synthase component II [Amino acid transport and metabolism] Back     alignment and domain information
>cd00405 PRAI Phosphoribosylanthranilate isomerase (PRAI) catalyzes the fourth step of the tryptophan biosynthesis, the conversion of N-(5'- phosphoribosyl)-anthranilate (PRA) to 1-(o-carboxyphenylamino)- 1-deoxyribulose 5-phosphate (CdRP) Back     alignment and domain information
>PRK08745 ribulose-phosphate 3-epimerase; Provisional Back     alignment and domain information
>PRK08005 epimerase; Validated Back     alignment and domain information
>PRK11829 biofilm formation regulator HmsP; Provisional Back     alignment and domain information
>PRK09776 putative diguanylate cyclase; Provisional Back     alignment and domain information
>TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>TIGR01064 pyruv_kin pyruvate kinase Back     alignment and domain information
>cd01948 EAL EAL domain Back     alignment and domain information
>cd08592 PI-PLCc_gamma Catalytic domain of metazoan phosphoinositide-specific phospholipase C-gamma Back     alignment and domain information
>PRK08195 4-hyroxy-2-oxovalerate/4-hydroxy-2-oxopentanoic acid aldolase,; Validated Back     alignment and domain information
>PLN02334 ribulose-phosphate 3-epimerase Back     alignment and domain information
>PRK09283 delta-aminolevulinic acid dehydratase; Validated Back     alignment and domain information
>PTZ00170 D-ribulose-5-phosphate 3-epimerase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query208
2pz0_A252 Glycerophosphoryl diester phosphodiesterase; glyce 2e-19
3ks6_A250 Glycerophosphoryl diester phosphodiesterase; struc 9e-19
3qvq_A252 Phosphodiesterase OLEI02445; structural genomics, 3e-18
2otd_A247 Glycerophosphodiester phosphodiesterase; structura 4e-16
1vd6_A224 Glycerophosphoryl diester phosphodiesterase; glyce 7e-16
2oog_A287 Glycerophosphoryl diester phosphodiesterase; phosp 1e-15
3no3_A238 Glycerophosphodiester phosphodiesterase; structura 2e-15
2o55_A258 Putative glycerophosphodiester phosphodiesterase; 5e-15
1zcc_A248 Glycerophosphodiester phosphodiesterase; NYSGXRC, 1e-14
3mz2_A292 Glycerophosphoryl diester phosphodiesterase; struc 3e-13
3ch0_A272 Glycerophosphodiester phosphodiesterase; YP_677622 3e-13
1o1z_A234 GDPD, glycerophosphodiester phosphodiesterase; TM1 4e-13
3l12_A313 Putative glycerophosphoryl diester phosphodiester; 7e-13
3rlg_A302 Sphingomyelin phosphodiesterase D lisictox-alphai; 9e-09
1xx1_A285 Smase I, sphingomyelinase I; structure, quick cryo 6e-07
3i10_A278 Putative glycerophosphoryl diester phosphodiester; 1e-04
>2pz0_A Glycerophosphoryl diester phosphodiesterase; glycerophosphodiester phosphodiesterase, T. tengcongensis; 1.91A {Thermoanaerobacter tengcongensis} Length = 252 Back     alignment and structure
 Score = 82.3 bits (204), Expect = 2e-19
 Identities = 31/193 (16%), Positives = 80/193 (41%), Gaps = 14/193 (7%)

Query: 11  RDLQRISGNITSKVGHLSMKE---------FAQKSHDQVITTIEDALTLVSNSVRKVILD 61
             + R + N    V   +++E         F +K   + I T+ +   L+ +    V ++
Sbjct: 61  ETVDRTT-NGEGFVKDFTLEEIKKLDAGIKFGEKFAGERIPTLYEVFELIGDKDFLVNIE 119

Query: 62  AKVGPPSYEKGLAKDILSVIERTKCYN-CLVWAKSDNLVRDIMRLSSNVTAGYIIMVDPS 120
            K        G+ + ++  I+        ++ + +   +RD+ +++ ++  G +      
Sbjct: 120 IK-SGIVLYPGIEEKLIKAIKEYNFEERVIISSFNHYSLRDVKKMAPHLKIGLLYQCGLV 178

Query: 121 TGFRTNLLRIRKAGVVGVYHPLIDEKLVRTFHGRNKRVFAWTVDDEDSMRKMLHERVDAV 180
             +   +    +A  +  ++  I  +LV        ++F WTVD ++ M +M+   VD +
Sbjct: 179 EPWH--MALRMEAYSLHPFYFNIIPELVEGCKKNGVKLFPWTVDRKEDMERMIKAGVDGI 236

Query: 181 VTSNPILFQRVMQ 193
           +T +P     +++
Sbjct: 237 ITDDPETLINLVR 249
>3ks6_A Glycerophosphoryl diester phosphodiesterase; structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.80A {Agrobacterium tumefaciens str} PDB: 3ks5_A* Length = 250 Back     alignment and structure
>3qvq_A Phosphodiesterase OLEI02445; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta hydrolase, hydrolase; HET: MSE G3P; 1.60A {Oleispira antarctica} Length = 252 Back     alignment and structure
>2otd_A Glycerophosphodiester phosphodiesterase; structural genomics PSI-2, protein structure initiative, midwest center for STR genomics, hydrolase; 2.60A {Shigella flexneri} Length = 247 Back     alignment and structure
>1vd6_A Glycerophosphoryl diester phosphodiesterase; glycerophosphod phosphodiesterase, HB8; 1.30A {Thermus thermophilus} SCOP: c.1.18.3 PDB: 1v8e_A Length = 224 Back     alignment and structure
>2oog_A Glycerophosphoryl diester phosphodiesterase; phosphatase, ST genomics, protein structure initiative, PSI; 2.20A {Staphylococcus aureus subsp} PDB: 2p76_A Length = 287 Back     alignment and structure
>3no3_A Glycerophosphodiester phosphodiesterase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 1.89A {Parabacteroides distasonis} Length = 238 Back     alignment and structure
>2o55_A Putative glycerophosphodiester phosphodiesterase; beta barrel, structural genomics, protein structure initiati 2; 2.81A {Galdieria sulphuraria} Length = 258 Back     alignment and structure
>1zcc_A Glycerophosphodiester phosphodiesterase; NYSGXRC, agrobacterium tumefaciens STR. C58, structural genomics; 2.50A {Agrobacterium tumefaciens str} SCOP: c.1.18.3 Length = 248 Back     alignment and structure
>3mz2_A Glycerophosphoryl diester phosphodiesterase; structural genomics, joint center for structural genomics; HET: MSE PE4; 1.55A {Parabacteroides distasonis} Length = 292 Back     alignment and structure
>3ch0_A Glycerophosphodiester phosphodiesterase; YP_677622.1, glycerophosphoryl diester phosphodiesterase, ST genomics; HET: MSE CIT GOL; 1.50A {Cytophaga hutchinsonii atcc 33406} Length = 272 Back     alignment and structure
>1o1z_A GDPD, glycerophosphodiester phosphodiesterase; TM1621, glycerophosphodiester phosphodiesterase (GDPD), STRU genomics, JCSG, PSI; 1.60A {Thermotoga maritima} SCOP: c.1.18.3 Length = 234 Back     alignment and structure
>3l12_A Putative glycerophosphoryl diester phosphodiester; struct genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE; 1.60A {Silicibacter pomeroyi} Length = 313 Back     alignment and structure
>3rlg_A Sphingomyelin phosphodiesterase D lisictox-alphai; TIM beta/alpha-barrel, PLC-like phosphodiesterase, inactive H12A phospholipase D; HET: PGE; 1.60A {Loxosceles intermedia} PDB: 3rlh_A* Length = 302 Back     alignment and structure
>1xx1_A Smase I, sphingomyelinase I; structure, quick cryo-soaking, activity, smase D, hydrolase; HET: EPE; 1.75A {Loxosceles laeta} PDB: 2f9r_A* Length = 285 Back     alignment and structure
>3i10_A Putative glycerophosphoryl diester phosphodiester; NP_812074.1; HET: MSE; 1.35A {Bacteroides thetaiotaomicron vpi-5482} Length = 278 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query208
2pz0_A252 Glycerophosphoryl diester phosphodiesterase; glyce 100.0
3qvq_A252 Phosphodiesterase OLEI02445; structural genomics, 100.0
3ks6_A250 Glycerophosphoryl diester phosphodiesterase; struc 100.0
2otd_A247 Glycerophosphodiester phosphodiesterase; structura 100.0
2o55_A258 Putative glycerophosphodiester phosphodiesterase; 100.0
3l12_A313 Putative glycerophosphoryl diester phosphodiester; 100.0
2oog_A287 Glycerophosphoryl diester phosphodiesterase; phosp 100.0
1zcc_A248 Glycerophosphodiester phosphodiesterase; NYSGXRC, 100.0
3no3_A238 Glycerophosphodiester phosphodiesterase; structura 100.0
3ch0_A272 Glycerophosphodiester phosphodiesterase; YP_677622 100.0
1o1z_A234 GDPD, glycerophosphodiester phosphodiesterase; TM1 100.0
1vd6_A224 Glycerophosphoryl diester phosphodiesterase; glyce 100.0
3mz2_A292 Glycerophosphoryl diester phosphodiesterase; struc 100.0
1ydy_A356 Glycerophosphoryl diester phosphodiesterase; struc 100.0
3i10_A278 Putative glycerophosphoryl diester phosphodiester; 99.97
1xx1_A285 Smase I, sphingomyelinase I; structure, quick cryo 99.96
3rlg_A302 Sphingomyelin phosphodiesterase D lisictox-alphai; 99.54
4e38_A232 Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho 96.57
1wa3_A205 2-keto-3-deoxy-6-phosphogluconate aldolase; KDPG, 95.85
1vhc_A224 Putative KHG/KDPG aldolase; structural genomics, u 95.77
1i4n_A251 Indole-3-glycerol phosphate synthase; thermostable 95.72
3qja_A272 IGPS, indole-3-glycerol phosphate synthase; struct 95.07
1mxs_A225 KDPG aldolase; 2-keto-3-deoxy-6-phosphogluconate a 94.95
3f4w_A211 Putative hexulose 6 phosphate synthase; humps, mal 94.94
1vkf_A188 Glycerol uptake operon antiterminator-related Pro; 94.92
3lab_A217 Putative KDPG (2-keto-3-deoxy-6-phosphogluconate) 94.91
1pii_A 452 N-(5'phosphoribosyl)anthranilate isomerase; bifunc 94.75
1wbh_A214 KHG/KDPG aldolase; lyase; 1.55A {Escherichia coli} 94.58
2yw3_A207 4-hydroxy-2-oxoglutarate aldolase/2-deydro-3- deox 94.17
3q58_A229 N-acetylmannosamine-6-phosphate 2-epimerase; TIM b 94.12
3kts_A192 Glycerol uptake operon antiterminator regulatory; 93.4
3tsm_A272 IGPS, indole-3-glycerol phosphate synthase; struct 93.32
4a29_A258 Engineered retro-aldol enzyme RA95.0; de novo prot 93.26
3inp_A246 D-ribulose-phosphate 3-epimerase; IDP02542, isomer 92.98
3igs_A232 N-acetylmannosamine-6-phosphate 2-epimerase 2; ene 92.93
4f3h_A250 Fimxeal, putative uncharacterized protein; fimxeal 92.38
3jr2_A218 Hexulose-6-phosphate synthase SGBH; 3-keto-L-gulon 92.34
1tqj_A230 Ribulose-phosphate 3-epimerase; beta-alpha barrel 92.18
3pjx_A430 Cyclic dimeric GMP binding protein; ggdef-EAL tand 91.98
1x7f_A 385 Outer surface protein; structural genomics, unknow 91.87
2d73_A 738 Alpha-glucosidase SUSB; glycoside hydrolase family 91.37
2ekc_A 262 AQ_1548, tryptophan synthase alpha chain; structur 91.19
3bo9_A 326 Putative nitroalkan dioxygenase; TM0800, structura 90.55
2r6o_A294 Putative diguanylate cyclase/phosphodiesterase (G 90.41
3usb_A511 Inosine-5'-monophosphate dehydrogenase; structural 90.41
2gjl_A 328 Hypothetical protein PA1024; 2-nitropropane dioxyg 89.15
3bw2_A 369 2-nitropropane dioxygenase; TIM barrel, oxidoreduc 89.04
1y0e_A223 Putative N-acetylmannosamine-6-phosphate 2-epimer; 88.41
3hv8_A268 Protein FIMX; EAL phosphodiesterase, biofilm, C-DI 88.36
3f4w_A211 Putative hexulose 6 phosphate synthase; humps, mal 87.68
3ovp_A228 Ribulose-phosphate 3-epimerase; iron binding, isom 86.62
3zwt_A367 Dihydroorotate dehydrogenase (quinone), mitochond; 86.41
3ble_A 337 Citramalate synthase from leptospira interrogans; 86.41
1tqx_A227 D-ribulose-5-phosphate 3-epimerase, putative; stru 86.25
4fxs_A 496 Inosine-5'-monophosphate dehydrogenase; structural 85.99
2v82_A212 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; l 85.85
3khj_A 361 Inosine-5-monophosphate dehydrogenase; enzyme-inhi 85.67
3kts_A192 Glycerol uptake operon antiterminator regulatory; 85.25
2bas_A 431 YKUI protein; EAL domain, structural genom protein 84.83
3a24_A 641 Alpha-galactosidase; glycoside hydrolase family 97 84.68
2z6i_A 332 Trans-2-enoyl-ACP reductase II; fatty acid synthes 84.47
3o63_A243 Probable thiamine-phosphate pyrophosphorylase; thi 84.33
1vkf_A188 Glycerol uptake operon antiterminator-related Pro; 84.2
3vzx_A228 Heptaprenylglyceryl phosphate synthase; biosynthes 84.01
1yad_A221 Regulatory protein TENI; TIM barrel, transcription 83.96
3hvb_A437 Protein FIMX; EAL phosphodiesterase, biofilm, C-DI 83.43
1qop_A 268 Tryptophan synthase alpha chain; lyase, carbon-oxy 82.91
4adt_A 297 Pyridoxine biosynthetic enzyme PDX1 homologue, PU; 82.45
4hjf_A340 Ggdef family protein; structural genomics, PSI-bio 82.37
3s83_A259 Ggdef family protein; structural genomics, PSI-bio 82.33
3vk5_A286 MOEO5; TIM barrel, transferase; HET: FPQ; 1.39A {S 82.33
3ctl_A231 D-allulose-6-phosphate 3-epimerase; D-glucitol 6-p 82.14
4fo4_A 366 Inosine 5'-monophosphate dehydrogenase; structural 80.89
3igs_A232 N-acetylmannosamine-6-phosphate 2-epimerase 2; ene 80.48
>2pz0_A Glycerophosphoryl diester phosphodiesterase; glycerophosphodiester phosphodiesterase, T. tengcongensis; 1.91A {Thermoanaerobacter tengcongensis} Back     alignment and structure
Probab=100.00  E-value=2e-40  Score=264.83  Aligned_cols=188  Identities=16%  Similarity=0.293  Sum_probs=164.0

Q ss_pred             CceEEEEeCccchhhhCCCcccccccCHHHhhc---------ccCCCcCCCHHHHHHHHhcCCceEEEEeecCCCCCchh
Q 028497            2 ESCWLFTTGRDLQRISGNITSKVGHLSMKEFAQ---------KSHDQVITTIEDALTLVSNSVRKVILDAKVGPPSYEKG   72 (208)
Q Consensus         2 Dg~~Vv~HD~~l~r~tg~g~~~i~~~t~~eL~~---------~~~~~~iptL~evL~~~~~~~~~l~lEiK~~~~~~~~~   72 (208)
                      ||++||+||++++|+|| |.|.|.++||+||+.         .+.+++||||+|+|+++++..+.++||||.....+ ..
T Consensus        52 DG~lVv~HD~~l~Rtt~-~~g~v~~~t~~eL~~l~~~~~~~~~~~~~~iPtL~evL~~~~~~~~~l~iEiK~~~~~~-~~  129 (252)
T 2pz0_A           52 DGHLVVIHDETVDRTTN-GEGFVKDFTLEEIKKLDAGIKFGEKFAGERIPTLYEVFELIGDKDFLVNIEIKSGIVLY-PG  129 (252)
T ss_dssp             TCCEEECSSSBSTTTSS-CCSBGGGSCHHHHTTSCSSTTTCGGGTTCCCCBHHHHHHHHTTSCCEEEEEECCSSCCC-TT
T ss_pred             CCeEEEEcCCcccccCC-CCcchhhCcHHHHhhcCCCCCCCCCCCCCcCCCHHHHHHHhhhcCCeEEEEeCCCCccc-HH
Confidence            99999999999999995 579999999999964         23678999999999999875579999999875433 36


Q ss_pred             HHHHHHHHHHhcCCc-ceEEEeeCHHHHHHHHhhccCCeEEEEEEecCCCchhhhHhhhhcCceEeecccccCHHHHHHH
Q 028497           73 LAKDILSVIERTKCY-NCLVWAKSDNLVRDIMRLSSNVTAGYIIMVDPSTGFRTNLLRIRKAGVVGVYHPLIDEKLVRTF  151 (208)
Q Consensus        73 ~~~~v~~~l~~~~~~-~~ii~Sf~~~~l~~l~~~~p~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~  151 (208)
                      +++.++++++++++. +++++||++..+++++++.|++++|+++...+..  +..+.+..+++++++.+..+++++++.+
T Consensus       130 ~~~~v~~~l~~~~~~~~vii~SF~~~~l~~~~~~~p~~~~~~l~~~~~~~--~~~~~~~~~~~~i~~~~~~~~~~~v~~~  207 (252)
T 2pz0_A          130 IEEKLIKAIKEYNFEERVIISSFNHYSLRDVKKMAPHLKIGLLYQCGLVE--PWHMALRMEAYSLHPFYFNIIPELVEGC  207 (252)
T ss_dssp             HHHHHHHHHHHTTCTTTEEEEESBHHHHHHHHHHCTTSEEEEEECSBCSS--THHHHHHTTCSEEEEBGGGCCHHHHHHH
T ss_pred             HHHHHHHHHHhcCCCCCEEEEeCCHHHHHHHHHHCCCCCEEEEecCcccc--HHHHHHHcCCeEEecchhcCCHHHHHHH
Confidence            889999999999975 5567999999999999999999999998643322  2344566788889999999999999999


Q ss_pred             HhCCCeEEEeeCCCHHHHHHHHhCCCCEEEcCChHHHHHHHH
Q 028497          152 HGRNKRVFAWTVDDEDSMRKMLHERVDAVVTSNPILFQRVMQ  193 (208)
Q Consensus       152 ~~~g~~v~~wtv~~~~~~~~~~~~gvd~i~TD~P~~~~~~~~  193 (208)
                      |++|++|++||+|+++++++++++|||||+||+|..+.++++
T Consensus       208 ~~~G~~v~~wTvn~~~~~~~l~~~GvdgIiTD~P~~~~~~l~  249 (252)
T 2pz0_A          208 KKNGVKLFPWTVDRKEDMERMIKAGVDGIITDDPETLINLVR  249 (252)
T ss_dssp             HHTTCEECCBCCCSHHHHHHHHHHTCSEEEESCHHHHHHHHC
T ss_pred             HHCCCEEEEECCCCHHHHHHHHHcCCCEEEcCCHHHHHHHHh
Confidence            999999999999999999999999999999999999998875
>3qvq_A Phosphodiesterase OLEI02445; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta hydrolase, hydrolase; HET: MSE G3P; 1.60A {Oleispira antarctica} Back     alignment and structure
>3ks6_A Glycerophosphoryl diester phosphodiesterase; structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.80A {Agrobacterium tumefaciens str} PDB: 3ks5_A* Back     alignment and structure
>2otd_A Glycerophosphodiester phosphodiesterase; structural genomics PSI-2, protein structure initiative, midwest center for STR genomics, hydrolase; 2.60A {Shigella flexneri} Back     alignment and structure
>2o55_A Putative glycerophosphodiester phosphodiesterase; beta barrel, structural genomics, protein structure initiati 2; 2.81A {Galdieria sulphuraria} Back     alignment and structure
>3l12_A Putative glycerophosphoryl diester phosphodiester; struct genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE; 1.60A {Silicibacter pomeroyi} Back     alignment and structure
>2oog_A Glycerophosphoryl diester phosphodiesterase; phosphatase, ST genomics, protein structure initiative, PSI; 2.20A {Staphylococcus aureus subsp} PDB: 2p76_A Back     alignment and structure
>1zcc_A Glycerophosphodiester phosphodiesterase; NYSGXRC, agrobacterium tumefaciens STR. C58, structural genomics; 2.50A {Agrobacterium tumefaciens str} SCOP: c.1.18.3 Back     alignment and structure
>3no3_A Glycerophosphodiester phosphodiesterase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 1.89A {Parabacteroides distasonis} SCOP: c.1.18.0 Back     alignment and structure
>3ch0_A Glycerophosphodiester phosphodiesterase; YP_677622.1, glycerophosphoryl diester phosphodiesterase, ST genomics; HET: MSE CIT GOL; 1.50A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>1o1z_A GDPD, glycerophosphodiester phosphodiesterase; TM1621, glycerophosphodiester phosphodiesterase (GDPD), STRU genomics, JCSG, PSI; 1.60A {Thermotoga maritima} SCOP: c.1.18.3 Back     alignment and structure
>1vd6_A Glycerophosphoryl diester phosphodiesterase; glycerophosphod phosphodiesterase, HB8; 1.30A {Thermus thermophilus} SCOP: c.1.18.3 PDB: 1v8e_A Back     alignment and structure
>3mz2_A Glycerophosphoryl diester phosphodiesterase; structural genomics, joint center for structural genomics; HET: MSE PE4; 1.55A {Parabacteroides distasonis} Back     alignment and structure
>1ydy_A Glycerophosphoryl diester phosphodiesterase; structural genomics, PSI, protein structu initiative; 1.70A {Escherichia coli} SCOP: c.1.18.3 PDB: 1t8q_A Back     alignment and structure
>3i10_A Putative glycerophosphoryl diester phosphodiester; NP_812074.1; HET: MSE; 1.35A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>1xx1_A Smase I, sphingomyelinase I; structure, quick cryo-soaking, activity, smase D, hydrolase; HET: EPE; 1.75A {Loxosceles laeta} PDB: 2f9r_A* Back     alignment and structure
>3rlg_A Sphingomyelin phosphodiesterase D lisictox-alphai; TIM beta/alpha-barrel, PLC-like phosphodiesterase, inactive H12A phospholipase D; HET: PGE; 1.60A {Loxosceles intermedia} PDB: 3rlh_A* Back     alignment and structure
>4e38_A Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho aldolase; lyase; 1.64A {Vibrionales bacterium swat-3} Back     alignment and structure
>1wa3_A 2-keto-3-deoxy-6-phosphogluconate aldolase; KDPG, pyruvate, lyase; 1.9A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 1vlw_A Back     alignment and structure
>1vhc_A Putative KHG/KDPG aldolase; structural genomics, unknown function; HET: MSE; 1.89A {Haemophilus influenzae} SCOP: c.1.10.1 Back     alignment and structure
>1i4n_A Indole-3-glycerol phosphate synthase; thermostable TIM-barrel protein, salt bridges, electrostatic interactions, lyase; 2.50A {Thermotoga maritima} SCOP: c.1.2.4 PDB: 1j5t_A Back     alignment and structure
>3qja_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, T structural genomics consortium, TBSGC, lyase; 1.29A {Mycobacterium tuberculosis} PDB: 3t40_A* 3t44_A* 3t55_A* 3t78_A* 4fb7_A* Back     alignment and structure
>1mxs_A KDPG aldolase; 2-keto-3-deoxy-6-phosphogluconate aldolase, sulfate, beta-BA lyase; 2.20A {Pseudomonas putida} SCOP: c.1.10.1 Back     alignment and structure
>3f4w_A Putative hexulose 6 phosphate synthase; humps, malonate, lyase; 1.65A {Salmonella typhimurium} SCOP: c.1.2.0 Back     alignment and structure
>1vkf_A Glycerol uptake operon antiterminator-related Pro; struc genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: CIT; 1.65A {Thermotoga maritima} SCOP: c.1.29.1 Back     alignment and structure
>1pii_A N-(5'phosphoribosyl)anthranilate isomerase; bifunctional(isomerase and synthase); 2.00A {Escherichia coli} SCOP: c.1.2.4 c.1.2.4 PDB: 1jcm_P* 2kzh_A Back     alignment and structure
>1wbh_A KHG/KDPG aldolase; lyase; 1.55A {Escherichia coli} SCOP: c.1.10.1 PDB: 2c0a_A 1wau_A 1eua_A 1eun_A 1fq0_A* 1fwr_A* Back     alignment and structure
>2yw3_A 4-hydroxy-2-oxoglutarate aldolase/2-deydro-3- deoxyphosphogluconate aldolase; structural genomics, NPPSFA; 1.67A {Thermus thermophilus} PDB: 2yw4_A Back     alignment and structure
>3q58_A N-acetylmannosamine-6-phosphate 2-epimerase; TIM beta/alpha barrel, ribulose-phosphate binding barrel, carbohydrate metabolic process; HET: BTB; 1.80A {Salmonella enterica subsp} Back     alignment and structure
>3kts_A Glycerol uptake operon antiterminator regulatory; structural genomics, PSI-2, protein structur initiative; HET: UNL; 2.75A {Listeria monocytogenes str} Back     alignment and structure
>3tsm_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, ssgcid, seattle structural GE center for infectious disease, lyase; 2.15A {Brucella melitensis} SCOP: c.1.2.0 Back     alignment and structure
>4a29_A Engineered retro-aldol enzyme RA95.0; de novo protein, engineered enzyme, retro-aldolase, directed evolution; HET: 3NK MLT; 1.10A {Synthetic construct} PDB: 4a2s_A* 4a2r_A* 3tc7_A 3tc6_A 3nl8_A* 3nxf_A* 3o6y_X 3ud6_A* 1igs_A 1juk_A 1jul_A* 3hoj_A 1a53_A* 1lbf_A* 1lbl_A* 3nyz_A 3nz1_A* 3uy7_A 3uxd_A* 3uxa_A* ... Back     alignment and structure
>3inp_A D-ribulose-phosphate 3-epimerase; IDP02542, isomerase, struc genomics, center for structural genomics of infectious DISE csgid; 2.05A {Francisella tularensis subsp} Back     alignment and structure
>3igs_A N-acetylmannosamine-6-phosphate 2-epimerase 2; energy metabolism, sugars, csgid, carbohydrate metabolism, isomerase; HET: MSE 16G; 1.50A {Salmonella enterica subsp} SCOP: c.1.2.0 Back     alignment and structure
>4f3h_A Fimxeal, putative uncharacterized protein; fimxeal-C-DI-GMP, type IV pilus, signaling protein; HET: C2E; 2.50A {Xanthomonas campestris PV} PDB: 4f48_A* Back     alignment and structure
>3jr2_A Hexulose-6-phosphate synthase SGBH; 3-keto-L-gulonate-6-phosphate decarboxylase, ULAD, niaid,CSG bound, biosynthetic protein; HET: MSE; 1.80A {Vibrio cholerae} SCOP: c.1.2.0 PDB: 3ieb_A* Back     alignment and structure
>1tqj_A Ribulose-phosphate 3-epimerase; beta-alpha barrel epimerase, isomerase; 1.60A {Synechocystis SP} SCOP: c.1.2.2 Back     alignment and structure
>3pjx_A Cyclic dimeric GMP binding protein; ggdef-EAL tandem domain, C-DI-GMP receptor, lyase; 2.00A {Pseudomonas fluorescens} PDB: 3pjw_A 3pju_A* 3pjt_A* 3pfm_A Back     alignment and structure
>1x7f_A Outer surface protein; structural genomics, unknown function, MCSG, PSI, midwest center for struct genomics; 2.30A {Bacillus cereus atcc 14579} SCOP: b.62.1.2 c.1.8.12 Back     alignment and structure
>2d73_A Alpha-glucosidase SUSB; glycoside hydrolase family 97, TIM barrel; 1.60A {Bacteroides thetaiotaomicron vpi-5482} PDB: 2zq0_A* 2jke_A* 2jka_A* 2jkp_A* Back     alignment and structure
>2ekc_A AQ_1548, tryptophan synthase alpha chain; structural genomics, lyase, NPPSFA, national project on PROT structural and functional analyses; 2.00A {Aquifex aeolicus} Back     alignment and structure
>3bo9_A Putative nitroalkan dioxygenase; TM0800, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE 2PE; 2.71A {Thermotoga maritima MSB8} Back     alignment and structure
>2r6o_A Putative diguanylate cyclase/phosphodiesterase (G domains); ggdef and EAL domains, structural genomics, PSI-2; 1.80A {Thiobacillus denitrificans} PDB: 3ii8_A* 3n3t_A* Back     alignment and structure
>3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* Back     alignment and structure
>2gjl_A Hypothetical protein PA1024; 2-nitropropane dioxygenase, 2-nitropropane, FMN, oxidoreduct; HET: FMN; 2.00A {Pseudomonas aeruginosa PAO1} PDB: 2gjn_A* Back     alignment and structure
>3bw2_A 2-nitropropane dioxygenase; TIM barrel, oxidoreductase; HET: FMN; 2.10A {Streptomyces ansochromogenes} PDB: 3bw4_A* 3bw3_A* Back     alignment and structure
>1y0e_A Putative N-acetylmannosamine-6-phosphate 2-epimer; mannac-6-P epimerase, NANE, structural genomics, protein STR initiative, PSI; 1.95A {Staphylococcus aureus subsp} SCOP: c.1.2.5 Back     alignment and structure
>3hv8_A Protein FIMX; EAL phosphodiesterase, biofilm, C-DI-GMP, hydrolase; HET: C2E; 1.45A {Pseudomonas aeruginosa PAO1} PDB: 3hv9_A 4afy_A 4ag0_A Back     alignment and structure
>3f4w_A Putative hexulose 6 phosphate synthase; humps, malonate, lyase; 1.65A {Salmonella typhimurium} SCOP: c.1.2.0 Back     alignment and structure
>3ovp_A Ribulose-phosphate 3-epimerase; iron binding, isomerase; HET: XPE; 1.70A {Homo sapiens} SCOP: c.1.2.0 PDB: 3ovq_A* 3ovr_A* 3qc3_A Back     alignment and structure
>3zwt_A Dihydroorotate dehydrogenase (quinone), mitochond; oxidoreductase; HET: FMN ORO KFZ; 1.55A {Homo sapiens} PDB: 1d3h_A* 2bxv_A* 2prh_A* 2prl_A* 2prm_A* 3f1q_A* 3fj6_A* 3fjl_A* 3g0u_A* 3g0x_A* 3zws_A* 1d3g_A* 3u2o_A* 2fpv_A* 2fpt_A* 2fpy_A* 2fqi_A* 3kvl_A* 3kvk_A* 3kvj_A* ... Back     alignment and structure
>3ble_A Citramalate synthase from leptospira interrogans; TIM barrel, licmsn, substrate specificity, acyltransferase, amino-acid biosynthesis; 2.00A {Leptospira interrogans} PDB: 3blf_A 3bli_A* Back     alignment and structure
>1tqx_A D-ribulose-5-phosphate 3-epimerase, putative; structural genomics, protein structure initiative, PSI; 2.00A {Plasmodium falciparum} SCOP: c.1.2.2 Back     alignment and structure
>4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} Back     alignment and structure
>2v82_A 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; lyase, kdpgal; HET: KDP; 2.1A {Escherichia coli} PDB: 2v81_A* Back     alignment and structure
>3khj_A Inosine-5-monophosphate dehydrogenase; enzyme-inhibitor complex, oxidoreductase; HET: IMP C64; 2.80A {Cryptosporidium parvum} Back     alignment and structure
>3kts_A Glycerol uptake operon antiterminator regulatory; structural genomics, PSI-2, protein structur initiative; HET: UNL; 2.75A {Listeria monocytogenes str} Back     alignment and structure
>2bas_A YKUI protein; EAL domain, structural genom protein structure initiative, midwest center for structural genomics, MCSG, signaling protein; 2.61A {Bacillus subtilis} SCOP: c.1.33.1 d.110.6.2 PDB: 2w27_A* Back     alignment and structure
>3a24_A Alpha-galactosidase; glycoside hydrolase family 97, retaining glycosidase; HET: MES; 2.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z6i_A Trans-2-enoyl-ACP reductase II; fatty acid synthesis, antibiotics, oxidoreductase, flavoprotein; HET: FMN; 1.70A {Streptococcus pneumoniae} PDB: 2z6j_A* Back     alignment and structure
>3o63_A Probable thiamine-phosphate pyrophosphorylase; thiamin biosynthesis, TIM barrel, transferase; 2.35A {Mycobacterium tuberculosis} Back     alignment and structure
>1vkf_A Glycerol uptake operon antiterminator-related Pro; struc genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: CIT; 1.65A {Thermotoga maritima} SCOP: c.1.29.1 Back     alignment and structure
>3vzx_A Heptaprenylglyceryl phosphate synthase; biosynthesis, prenyltransferases, enzyme catalysis, transfer; 1.54A {Bacillus subtilis} PDB: 3vzy_A* 3vzz_A* 3w00_A* 1viz_A Back     alignment and structure
>1yad_A Regulatory protein TENI; TIM barrel, transcription; 2.10A {Bacillus subtilis} PDB: 3qh2_A* Back     alignment and structure
>1qop_A Tryptophan synthase alpha chain; lyase, carbon-oxygen lyase, tryptophan biosynthesis, pyridoxal phosphate; HET: IPL PLP; 1.4A {Salmonella typhimurium} SCOP: c.1.2.4 PDB: 1k8x_A* 1wbj_A* 2clk_A* 2j9z_A* 3cep_A* 1k8y_A* 1a5s_A* 1a50_A* 1c29_A* 1c8v_A* 1c9d_A* 1bks_A* 1cx9_A* 1fuy_A* 1cw2_A* 1k7e_A* 1k7f_A* 1k7x_A* 1k3u_A* 1k8z_A* ... Back     alignment and structure
>4adt_A Pyridoxine biosynthetic enzyme PDX1 homologue, PU; transferase, pyridoxal 5-phosphate biosynthesis; 2.42A {Plasmodium berghei} PDB: 4adu_A* 4ads_A Back     alignment and structure
>4hjf_A Ggdef family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, EAL domain, signaling protein; HET: MSE C2E; 1.75A {Caulobacter crescentus} Back     alignment and structure
>3s83_A Ggdef family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, signaling protein; HET: MSE; 1.34A {Caulobacter crescentus} PDB: 3u2e_A Back     alignment and structure
>3vk5_A MOEO5; TIM barrel, transferase; HET: FPQ; 1.39A {Streptomyces ghanaensis} PDB: 3vka_A* 3vkb_A* 3vkc_A* 3vkd_A* Back     alignment and structure
>3ctl_A D-allulose-6-phosphate 3-epimerase; D-glucitol 6-phosphate, (beta/alpha)8 barrel, carbohydrate metabolism, isomerase; HET: S6P; 2.20A {Escherichia coli} PDB: 3ct7_A* Back     alignment and structure
>4fo4_A Inosine 5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.03A {Vibrio cholerae o1 biovar el tor} PDB: 4ff0_A* 4hlv_A* 4fez_A Back     alignment and structure
>3igs_A N-acetylmannosamine-6-phosphate 2-epimerase 2; energy metabolism, sugars, csgid, carbohydrate metabolism, isomerase; HET: MSE 16G; 1.50A {Salmonella enterica subsp} SCOP: c.1.2.0 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 208
d1vd6a1217 c.1.18.3 (A:8-224) Putative glycerophosphodiester 3e-10
d1o1za_226 c.1.18.3 (A:) Hypothetical protein TM1621 {Thermot 4e-09
d1zcca1240 c.1.18.3 (A:1-240) Glycerophosphodiester phosphodi 6e-08
d1ydya1328 c.1.18.3 (A:29-356) Glycerophosphodiester phosphod 1e-04
>d1vd6a1 c.1.18.3 (A:8-224) Putative glycerophosphodiester phosphodiesterase TTHB141 {Thermus thermophilus [TaxId: 274]} Length = 217 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: PLC-like phosphodiesterases
family: Glycerophosphoryl diester phosphodiesterase
domain: Putative glycerophosphodiester phosphodiesterase TTHB141
species: Thermus thermophilus [TaxId: 274]

 Score = 55.4 bits (132), Expect = 3e-10
 Identities = 26/155 (16%), Positives = 59/155 (38%), Gaps = 7/155 (4%)

Query: 37  HDQVITTIEDALTLVSNSVRKVILDAKVGPPSYEKGLAKDILSVIERTKCYNCLVWAKSD 96
            +  +  +E+ L L     + V        P   +  A+ + ++          V +   
Sbjct: 68  QEPDLPRLEEVLALKEAFPQAVFNVELKSFPGLGEEAARRLAAL--LRGREGVWVSSFDP 125

Query: 97  NLVRDIMRLSSNVTAGYIIMVDPSTGFRTNLLRIRKAGVVGVYHPLIDEKLVRTFHGRNK 156
             +  + + +  +  G+++  D S       +       V  +H L+ E+ V  +  R  
Sbjct: 126 LALLALRKAAPGLPLGFLMAEDHSALLPCLGVEA-----VHPHHALVTEEAVAGWRKRGL 180

Query: 157 RVFAWTVDDEDSMRKMLHERVDAVVTSNPILFQRV 191
            V AWTV++E   R++L   +D ++   P +   +
Sbjct: 181 FVVAWTVNEEGEARRLLALGLDGLIGDRPEVLLPL 215
>d1o1za_ c.1.18.3 (A:) Hypothetical protein TM1621 {Thermotoga maritima [TaxId: 2336]} Length = 226 Back     information, alignment and structure
>d1zcca1 c.1.18.3 (A:1-240) Glycerophosphodiester phosphodiesterase UgpQ {Agrobacterium tumefaciens [TaxId: 358]} Length = 240 Back     information, alignment and structure
>d1ydya1 c.1.18.3 (A:29-356) Glycerophosphodiester phosphodiesterase GlpQ {Escherichia coli [TaxId: 562]} Length = 328 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query208
d1zcca1240 Glycerophosphodiester phosphodiesterase UgpQ {Agro 100.0
d1o1za_226 Hypothetical protein TM1621 {Thermotoga maritima [ 100.0
d1vd6a1217 Putative glycerophosphodiester phosphodiesterase T 100.0
d1ydya1328 Glycerophosphodiester phosphodiesterase GlpQ {Esch 99.94
d1vhca_212 Hypothetical protein HI0047 {Haemophilus influenza 96.4
d1wbha1213 KDPG aldolase {Escherichia coli [TaxId: 562]} 95.17
d1mxsa_216 KDPG aldolase {Pseudomonas putida [TaxId: 303]} 94.7
d1vkfa_172 Glycerol uptake operon antiterminator-related prot 91.75
d1wa3a1202 KDPG aldolase {Thermotoga maritima [TaxId: 2336]} 91.42
d1vc4a_254 Indole-3-glycerophosphate synthase, IPGS {Thermus 91.26
d1x7fa2244 Outer surface protein, N-terminal domain {Bacillus 90.97
d1vkfa_172 Glycerol uptake operon antiterminator-related prot 90.72
d1piia2254 Indole-3-glycerophosphate synthase, IPGS {Escheric 90.42
d1a3xa2265 Pyruvate kinase, N-terminal domain {Baker's yeast 90.31
d1dxea_ 253 2-dehydro-3-deoxy-galactarate aldolase {Escherichi 89.39
d1a53a_247 Indole-3-glycerophosphate synthase, IPGS {Archaeon 88.14
d2b8ea1135 Cation-transporting ATPase {Archaeon Archaeoglobus 86.54
d1e0ta2246 Pyruvate kinase, N-terminal domain {Escherichia co 83.2
d7reqa2168 Methylmalonyl-CoA mutase alpha subunit, C-terminal 82.85
d2basa1261 Hypothetical protein YkuI, N-terminal domain {Baci 82.43
d1geqa_248 Trp synthase alpha-subunit {Archaeon Pyrococcus fu 80.93
>d1zcca1 c.1.18.3 (A:1-240) Glycerophosphodiester phosphodiesterase UgpQ {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: PLC-like phosphodiesterases
family: Glycerophosphoryl diester phosphodiesterase
domain: Glycerophosphodiester phosphodiesterase UgpQ
species: Agrobacterium tumefaciens [TaxId: 358]

Probab=100.00  E-value=8.9e-36  Score=234.29  Aligned_cols=183  Identities=11%  Similarity=0.195  Sum_probs=148.0

Q ss_pred             CceEEEEeCccchhhhCCCcccccccCHHHhhc---------ccCCCcCCCHHHHHHHHhcCCceEEEEeecCCCCCchh
Q 028497            2 ESCWLFTTGRDLQRISGNITSKVGHLSMKEFAQ---------KSHDQVITTIEDALTLVSNSVRKVILDAKVGPPSYEKG   72 (208)
Q Consensus         2 Dg~~Vv~HD~~l~r~tg~g~~~i~~~t~~eL~~---------~~~~~~iptL~evL~~~~~~~~~l~lEiK~~~~~~~~~   72 (208)
                      ||++||+||++++|+|| +.|+|+++||+||+.         .+.+++||||+|+|+.++++ ..++||+|...      
T Consensus        42 Dg~~Vv~HD~~l~r~t~-~~~~v~~~t~~el~~l~~~~~~~~~~~~~~IptL~evl~~~~~~-~~l~iEiK~~~------  113 (240)
T d1zcca1          42 DGVLYVIHDETLDRTTN-GTGPVGHMLSSEIDTLDAGGWFDDRFKGAIVPRLDAYLEHLRGR-AGVYIELKYCD------  113 (240)
T ss_dssp             TCCEEECSSSBTTTTSS-CCSBSTTSCHHHHTTSCSSTTTCGGGTTCCCCBHHHHHHHHTTT-CEEEEEEEESC------
T ss_pred             CCCEEEecccccccccc-ccccHHHhhHHHHHHhhccCcCccccCCCcCChHHHhhhccccc-ceeEEEEccCc------
Confidence            99999999999999995 579999999999963         35678999999999999876 58999999863      


Q ss_pred             HHHHHHHHHHhcCCc-ceEEEeeCHHHHHHHHhhccCCeEEEEEEecCCCchhhhHhhhhcCceEe-ecccccCHHHHHH
Q 028497           73 LAKDILSVIERTKCY-NCLVWAKSDNLVRDIMRLSSNVTAGYIIMVDPSTGFRTNLLRIRKAGVVG-VYHPLIDEKLVRT  150 (208)
Q Consensus        73 ~~~~v~~~l~~~~~~-~~ii~Sf~~~~l~~l~~~~p~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~v~~  150 (208)
                       .+.+.++++++++. +++++||+++.++++++..|++++|++....... .  .......+..+. .++...+++++++
T Consensus       114 -~~~v~~l~~~~~~~~~v~~~Sf~~~~l~~~~~~~P~~~~~~~~~~~~~~-~--~~~~~~~~~~~~~~~~~~~~~~~v~~  189 (240)
T d1zcca1         114 -PAKVAALVRHLGMVRDTFYFSFSEEMRQGLQSIAPEFRRMMTLDIAKSP-S--LVGAVHHASIIEITPAQMRRPGIIEA  189 (240)
T ss_dssp             -HHHHHHHHHHHTCSTTEEEECSCHHHHHHHHHHCTTSEEEEEHHHHSST-H--HHHHTTCCSEEEECHHHHHSHHHHHH
T ss_pred             -chhhhHHHHHHHhhcccccccccHHHHHHHHHhhhccceEEeecccccc-h--hHHHHhcccccccchhhhCCHHHHHH
Confidence             35688899999874 5678999999999999999999999887532211 1  111112233333 3455678999999


Q ss_pred             HHhCCCeEEEeeCCC-HHHHHHHHhCCCCEEEcCChHHHHHHHHHHH
Q 028497          151 FHGRNKRVFAWTVDD-EDSMRKMLHERVDAVVTSNPILFQRVMQDIR  196 (208)
Q Consensus       151 ~~~~g~~v~~wtv~~-~~~~~~~~~~gvd~i~TD~P~~~~~~~~~~~  196 (208)
                      +|++|++|++||+|+ .+.++.+.++|||||+||+|+.+.++.+..+
T Consensus       190 ~~~~Gl~v~~wTvnd~~~~~~~l~~~gVdgI~TD~P~l~~~vr~~~~  236 (240)
T d1zcca1         190 SRKAGLEIMVYYGGDDMAVHREIATSDVDYINLDRPDLFAAVRSGMA  236 (240)
T ss_dssp             HHHHTCEEEEECCCCCHHHHHHHHHSSCSEEEESCHHHHHHHHHHHH
T ss_pred             HHHCCCEEEEEccCCHHHHHHHHHHcCCCEEEeCcHHHHHHHHHHHH
Confidence            999999999999986 5566888999999999999999998776543
>d1o1za_ c.1.18.3 (A:) Hypothetical protein TM1621 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vd6a1 c.1.18.3 (A:8-224) Putative glycerophosphodiester phosphodiesterase TTHB141 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ydya1 c.1.18.3 (A:29-356) Glycerophosphodiester phosphodiesterase GlpQ {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vhca_ c.1.10.1 (A:) Hypothetical protein HI0047 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1wbha1 c.1.10.1 (A:1-213) KDPG aldolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mxsa_ c.1.10.1 (A:) KDPG aldolase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1vkfa_ c.1.29.1 (A:) Glycerol uptake operon antiterminator-related protein TM1436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wa3a1 c.1.10.1 (A:2-203) KDPG aldolase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vc4a_ c.1.2.4 (A:) Indole-3-glycerophosphate synthase, IPGS {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1x7fa2 c.1.8.12 (A:1-244) Outer surface protein, N-terminal domain {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1vkfa_ c.1.29.1 (A:) Glycerol uptake operon antiterminator-related protein TM1436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1piia2 c.1.2.4 (A:1-254) Indole-3-glycerophosphate synthase, IPGS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a3xa2 c.1.12.1 (A:1-87,A:189-366) Pyruvate kinase, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1dxea_ c.1.12.5 (A:) 2-dehydro-3-deoxy-galactarate aldolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a53a_ c.1.2.4 (A:) Indole-3-glycerophosphate synthase, IPGS {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2b8ea1 c.108.1.7 (A:416-434,A:548-663) Cation-transporting ATPase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1e0ta2 c.1.12.1 (A:1-69,A:168-344) Pyruvate kinase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d7reqa2 c.23.6.1 (A:561-728) Methylmalonyl-CoA mutase alpha subunit, C-terminal domain {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} Back     information, alignment and structure
>d2basa1 c.1.33.1 (A:2-262) Hypothetical protein YkuI, N-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1geqa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure