Citrus Sinensis ID: 028608
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 206 | ||||||
| 255587476 | 222 | conserved hypothetical protein [Ricinus | 0.941 | 0.873 | 0.65 | 2e-67 | |
| 363807536 | 227 | uncharacterized protein LOC100814016 [Gl | 0.888 | 0.806 | 0.675 | 2e-65 | |
| 225457126 | 215 | PREDICTED: uncharacterized protein At5g5 | 0.883 | 0.846 | 0.675 | 2e-65 | |
| 224135751 | 167 | predicted protein [Populus trichocarpa] | 0.684 | 0.844 | 0.804 | 7e-64 | |
| 297792301 | 213 | hypothetical protein ARALYDRAFT_495066 [ | 0.898 | 0.868 | 0.628 | 3e-63 | |
| 363807530 | 208 | uncharacterized protein LOC100785087 [Gl | 0.873 | 0.865 | 0.649 | 8e-63 | |
| 18423105 | 214 | putative thiol-disulfide oxidoreductase | 0.898 | 0.864 | 0.615 | 1e-62 | |
| 18146782 | 221 | PBng143 [Vigna radiata] | 0.927 | 0.864 | 0.636 | 1e-62 | |
| 388518351 | 216 | unknown [Lotus japonicus] | 0.781 | 0.745 | 0.680 | 4e-59 | |
| 449440704 | 223 | PREDICTED: uncharacterized protein At5g5 | 0.951 | 0.878 | 0.580 | 4e-59 |
| >gi|255587476|ref|XP_002534285.1| conserved hypothetical protein [Ricinus communis] gi|223525573|gb|EEF28096.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 260 bits (665), Expect = 2e-67, Method: Compositional matrix adjust.
Identities = 130/200 (65%), Positives = 152/200 (76%), Gaps = 6/200 (3%)
Query: 1 MAVRGAAAIACTTRGRNPFVSSAN--HYFFMRFHHSPSRSFQRFTSHPNHRSG-YRNQIR 57
MA++G AC R + SS + Y RFHHS S +RFT +P ++G + +R
Sbjct: 1 MAIKGVVT-ACNVARRGSYQSSLSVPRYLTFRFHHSSSYPPKRFTFYPTSQTGKFMYSVR 59
Query: 58 AIQGATADPLTSKKEYDKDPSPENWKIKMLYDGDCPLCMREVNMLKERNKQYGTIKFVDI 117
AI A DP+T+KK+ ++ +P WKIKMLYDGDCPLCMREVNML+ERNK Y TIKFVDI
Sbjct: 60 AIHKAIVDPVTTKKKNEEKSTP--WKIKMLYDGDCPLCMREVNMLRERNKSYDTIKFVDI 117
Query: 118 SSDEYSIEENQGLDYKTVMGSIHAIVSDGTVVTDVEAFRRLYEEVGLGWVYAITKYEPIA 177
SS +YS EENQGLDY TVMG IHAI+SDGT+VTDVEAFRRLYE+VGLGWVYAITKYEPI
Sbjct: 118 SSKDYSPEENQGLDYTTVMGRIHAILSDGTIVTDVEAFRRLYEQVGLGWVYAITKYEPIG 177
Query: 178 KIADFVYSVWAKYRLQITGK 197
IAD VYS WAKYRLQITG+
Sbjct: 178 SIADVVYSFWAKYRLQITGR 197
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|363807536|ref|NP_001242657.1| uncharacterized protein LOC100814016 [Glycine max] gi|255647257|gb|ACU24096.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|225457126|ref|XP_002283569.1| PREDICTED: uncharacterized protein At5g50100, mitochondrial [Vitis vinifera] gi|297733833|emb|CBI15080.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224135751|ref|XP_002322151.1| predicted protein [Populus trichocarpa] gi|222869147|gb|EEF06278.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|297792301|ref|XP_002864035.1| hypothetical protein ARALYDRAFT_495066 [Arabidopsis lyrata subsp. lyrata] gi|297309870|gb|EFH40294.1| hypothetical protein ARALYDRAFT_495066 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|363807530|ref|NP_001242656.1| uncharacterized protein LOC100785087 [Glycine max] gi|255639025|gb|ACU19813.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|18423105|ref|NP_568719.1| putative thiol-disulfide oxidoreductase DCC [Arabidopsis thaliana] gi|75162429|sp|Q8W485.1|Y5010_ARATH RecName: Full=Uncharacterized protein At5g50100, mitochondrial; Flags: Precursor gi|17065380|gb|AAL32844.1| Unknown protein [Arabidopsis thaliana] gi|20148617|gb|AAM10199.1| unknown protein [Arabidopsis thaliana] gi|21593055|gb|AAM65004.1| unknown [Arabidopsis thaliana] gi|332008513|gb|AED95896.1| putative thiol-disulfide oxidoreductase DCC [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|18146782|dbj|BAB82450.1| PBng143 [Vigna radiata] | Back alignment and taxonomy information |
|---|
| >gi|388518351|gb|AFK47237.1| unknown [Lotus japonicus] | Back alignment and taxonomy information |
|---|
| >gi|449440704|ref|XP_004138124.1| PREDICTED: uncharacterized protein At5g50100, mitochondrial-like [Cucumis sativus] gi|449477382|ref|XP_004155007.1| PREDICTED: uncharacterized protein At5g50100, mitochondrial-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 206 | ||||||
| TAIR|locus:2170041 | 214 | AT5G50100 "AT5G50100" [Arabido | 0.898 | 0.864 | 0.62 | 1.2e-60 | |
| UNIPROTKB|Q885H3 | 163 | PSPTO_1860 "Uncharacterized pr | 0.514 | 0.650 | 0.330 | 7.4e-11 | |
| UNIPROTKB|Q8EIR5 | 129 | SO_0771 "Thiol-disulphide oxid | 0.524 | 0.837 | 0.258 | 4.2e-07 | |
| TIGR_CMR|SO_0771 | 129 | SO_0771 "conserved hypothetica | 0.524 | 0.837 | 0.258 | 4.2e-07 | |
| UNIPROTKB|Q74GL0 | 138 | GSU0236 "Uncharacterized prote | 0.446 | 0.666 | 0.276 | 7.2e-07 | |
| TIGR_CMR|GSU_0236 | 138 | GSU_0236 "conserved hypothetic | 0.446 | 0.666 | 0.276 | 7.2e-07 | |
| UNIPROTKB|Q9KR35 | 139 | VC_1812 "Putative uncharacteri | 0.529 | 0.784 | 0.278 | 2.1e-06 | |
| TIGR_CMR|VC_1812 | 139 | VC_1812 "conserved hypothetica | 0.529 | 0.784 | 0.278 | 2.1e-06 |
| TAIR|locus:2170041 AT5G50100 "AT5G50100" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 621 (223.7 bits), Expect = 1.2e-60, P = 1.2e-60
Identities = 124/200 (62%), Positives = 150/200 (75%)
Query: 1 MAVRGAAAIACTT---RGRNPFVSSANHYFFMRFHHSPSRSFQRFTSHPNHRSGYRNQIR 57
MA RGA A A +T RNP + S + +F F+H R P +G++ Q+R
Sbjct: 1 MATRGAVAAAASTIWKHRRNPSLRSLSRHFNPNFNH-------RII--P---TGFKYQVR 48
Query: 58 AIQGATADPLTSKKEYDKDPSPENWKIKMLYDGDCPLCMREVNMLKERNKQYGTIKFVDI 117
AIQG + DP+ + + ++P P+NWKIKMLYDGDCPLCMREVNML ERN+++GTIKFVDI
Sbjct: 49 AIQGTSTDPVITPLKNREEPKPQNWKIKMLYDGDCPLCMREVNMLMERNEKHGTIKFVDI 108
Query: 118 SSDEYSIEENQGLDYKTVMGSIHAIVSDGTVVTDVEAFRRLYEEVGLGWVYAITKYEPIA 177
SS++YS E+NQGLDYKTVMG IHAI SDG VV VEAFRRLYEEVGLGWVY ITK+EPI
Sbjct: 109 SSNDYSPEDNQGLDYKTVMGQIHAIQSDGNVVKGVEAFRRLYEEVGLGWVYTITKFEPIG 168
Query: 178 KIADFVYSVWAKYRLQITGK 197
K+AD VY VWAKYRLQ+TG+
Sbjct: 169 KLADVVYDVWAKYRLQVTGR 188
|
|
| UNIPROTKB|Q885H3 PSPTO_1860 "Uncharacterized protein" [Pseudomonas syringae pv. tomato str. DC3000 (taxid:223283)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8EIR5 SO_0771 "Thiol-disulphide oxidoreductase DCC family" [Shewanella oneidensis MR-1 (taxid:211586)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|SO_0771 SO_0771 "conserved hypothetical protein" [Shewanella oneidensis MR-1 (taxid:211586)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q74GL0 GSU0236 "Uncharacterized protein" [Geobacter sulfurreducens PCA (taxid:243231)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|GSU_0236 GSU_0236 "conserved hypothetical protein" [Geobacter sulfurreducens PCA (taxid:243231)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9KR35 VC_1812 "Putative uncharacterized protein" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|VC_1812 VC_1812 "conserved hypothetical protein" [Vibrio cholerae O1 biovar El Tor (taxid:686)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| gw1.XV.1392.1 | hypothetical protein (167 aa) | ||||||||||
(Populus trichocarpa) | |||||||||||
| gw1.XI.1083.1 | • | 0.477 | |||||||||
| gw1.II.4176.1 | • | 0.404 | |||||||||
| estExt_Genewise1_v1.C_LG_XII1182 | • | 0.403 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 206 | |||
| pfam04134 | 113 | pfam04134, DUF393, Protein of unknown function, DU | 7e-28 | |
| COG3011 | 137 | COG3011, COG3011, Predicted thiol-disulfide oxidor | 6e-14 |
| >gnl|CDD|217918 pfam04134, DUF393, Protein of unknown function, DUF393 | Back alignment and domain information |
|---|
Score = 101 bits (253), Expect = 7e-28
Identities = 35/114 (30%), Positives = 62/114 (54%), Gaps = 5/114 (4%)
Query: 87 LYDGDCPLCMREVNMLKERNKQYGTIKFVDISSDE-YSIEENQGLDYKTVMGSIHAIVSD 145
LYDG+CPLC REV L+ R++ G ++FVDI S E ++ E G+D + + +H +
Sbjct: 2 LYDGECPLCNREVRFLERRDRG-GRLRFVDIQSAEGQALLEAFGIDPEDLDSRLH-VEDG 59
Query: 146 GTVVTDVEAFRRLYEEVG--LGWVYAITKYEPIAKIADFVYSVWAKYRLQITGK 197
G V T +AF ++ + + A+ + + + D +Y A+ R ++ G+
Sbjct: 60 GDVYTGSDAFLEIWRLLPGPWRLLAALLRLPRLRPLRDALYRFIARNRYRLFGR 113
|
Members of this family have two highly conserved cysteine residues near their N-terminus. The function of these proteins is unknown. Length = 113 |
| >gnl|CDD|225556 COG3011, COG3011, Predicted thiol-disulfide oxidoreductase [General function prediction only] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 206 | |||
| PF04134 | 114 | DUF393: Protein of unknown function, DUF393; Inter | 99.96 | |
| COG3011 | 137 | Predicted thiol-disulfide oxidoreductase [General | 99.96 | |
| TIGR02180 | 84 | GRX_euk Glutaredoxin. This model represents eukary | 96.42 | |
| cd03027 | 73 | GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Eg | 96.08 | |
| cd02066 | 72 | GRX_family Glutaredoxin (GRX) family; composed of | 95.99 | |
| cd03419 | 82 | GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX h | 95.74 | |
| TIGR02190 | 79 | GlrX-dom Glutaredoxin-family domain. This C-termin | 95.39 | |
| PHA03050 | 108 | glutaredoxin; Provisional | 95.04 | |
| PRK10638 | 83 | glutaredoxin 3; Provisional | 94.82 | |
| cd03040 | 77 | GST_N_mPGES2 GST_N family; microsomal Prostaglandi | 94.69 | |
| cd03418 | 75 | GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX b | 94.65 | |
| PRK11200 | 85 | grxA glutaredoxin 1; Provisional | 94.25 | |
| TIGR02200 | 77 | GlrX_actino Glutaredoxin-like protein. This family | 94.04 | |
| cd03041 | 77 | GST_N_2GST_N GST_N family, 2 repeats of the N-term | 93.8 | |
| cd02966 | 116 | TlpA_like_family TlpA-like family; composed of Tlp | 93.75 | |
| TIGR02183 | 86 | GRXA Glutaredoxin, GrxA family. This model include | 93.05 | |
| COG3019 | 149 | Predicted metal-binding protein [General function | 92.76 | |
| TIGR02181 | 79 | GRX_bact Glutaredoxin, GrxC family. This family of | 92.69 | |
| cd03029 | 72 | GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hyb | 92.68 | |
| cd03028 | 90 | GRX_PICOT_like Glutaredoxin (GRX) family, PKC-inte | 92.66 | |
| TIGR02189 | 99 | GlrX-like_plant Glutaredoxin-like family. This fam | 92.5 | |
| PF13728 | 215 | TraF: F plasmid transfer operon protein | 92.11 | |
| cd03055 | 89 | GST_N_Omega GST_N family, Class Omega subfamily; G | 92.02 | |
| cd02973 | 67 | TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)- | 91.5 | |
| PRK13703 | 248 | conjugal pilus assembly protein TraF; Provisional | 91.41 | |
| TIGR02738 | 153 | TrbB type-F conjugative transfer system pilin asse | 90.93 | |
| TIGR00365 | 97 | monothiol glutaredoxin, Grx4 family. The gene for | 90.58 | |
| TIGR02739 | 256 | TraF type-F conjugative transfer system pilin asse | 90.46 | |
| PRK10824 | 115 | glutaredoxin-4; Provisional | 90.36 | |
| PRK10329 | 81 | glutaredoxin-like protein; Provisional | 90.34 | |
| cd00570 | 71 | GST_N_family Glutathione S-transferase (GST) famil | 90.23 | |
| PRK10877 | 232 | protein disulfide isomerase II DsbC; Provisional | 90.17 | |
| PF00578 | 124 | AhpC-TSA: AhpC/TSA family; InterPro: IPR000866 Per | 90.01 | |
| KOG1422 | 221 | consensus Intracellular Cl- channel CLIC, contains | 89.46 | |
| PTZ00051 | 98 | thioredoxin; Provisional | 89.06 | |
| PRK11657 | 251 | dsbG disulfide isomerase/thiol-disulfide oxidase; | 89.01 | |
| TIGR02196 | 74 | GlrX_YruB Glutaredoxin-like protein, YruB-family. | 88.85 | |
| cd02982 | 103 | PDI_b'_family Protein Disulfide Isomerase (PDIb') | 88.8 | |
| cd03060 | 71 | GST_N_Omega_like GST_N family, Omega-like subfamil | 88.65 | |
| cd03056 | 73 | GST_N_4 GST_N family, unknown subfamily 4; compose | 88.61 | |
| cd02967 | 114 | mauD Methylamine utilization (mau) D family; mauD | 88.58 | |
| cd03045 | 74 | GST_N_Delta_Epsilon GST_N family, Class Delta and | 88.45 | |
| cd03037 | 71 | GST_N_GRX2 GST_N family, Glutaredoxin 2 (GRX2) sub | 87.97 | |
| PRK13728 | 181 | conjugal transfer protein TrbB; Provisional | 87.8 | |
| cd03023 | 154 | DsbA_Com1_like DsbA family, Com1-like subfamily; c | 87.69 | |
| cd03020 | 197 | DsbA_DsbC_DsbG DsbA family, DsbC and DsbG subfamil | 87.18 | |
| cd03059 | 73 | GST_N_SspA GST_N family, Stringent starvation prot | 86.69 | |
| cd01659 | 69 | TRX_superfamily Thioredoxin (TRX) superfamily; a l | 86.63 | |
| TIGR00411 | 82 | redox_disulf_1 small redox-active disulfide protei | 86.62 | |
| PRK03147 | 173 | thiol-disulfide oxidoreductase; Provisional | 86.02 | |
| PF00085 | 103 | Thioredoxin: Thioredoxin; InterPro: IPR013766 Thio | 85.98 | |
| PRK15412 | 185 | thiol:disulfide interchange protein DsbE; Provisio | 85.89 | |
| PF13098 | 112 | Thioredoxin_2: Thioredoxin-like domain; PDB: 1T3B_ | 85.87 | |
| cd02961 | 101 | PDI_a_family Protein Disulfide Isomerase (PDIa) fa | 85.82 | |
| cd03051 | 74 | GST_N_GTT2_like GST_N family, Saccharomyces cerevi | 85.47 | |
| TIGR02194 | 72 | GlrX_NrdH Glutaredoxin-like protein NrdH. NrdH-red | 85.3 | |
| cd02949 | 97 | TRX_NTR TRX domain, novel NADPH thioredoxin reduct | 85.0 | |
| TIGR02740 | 271 | TraF-like TraF-like protein. This protein is relat | 84.84 | |
| cd02968 | 142 | SCO SCO (an acronym for Synthesis of Cytochrome c | 84.41 | |
| cd02976 | 73 | NrdH NrdH-redoxin (NrdH) family; NrdH is a small m | 84.31 | |
| TIGR01126 | 102 | pdi_dom protein disulfide-isomerase domain. This m | 84.14 | |
| PTZ00062 | 204 | glutaredoxin; Provisional | 84.04 | |
| cd03061 | 91 | GST_N_CLIC GST_N family, Chloride Intracellular Ch | 83.45 | |
| cd03026 | 89 | AhpF_NTD_C TRX-GRX-like family, Alkyl hydroperoxid | 82.82 | |
| cd03052 | 73 | GST_N_GDAP1 GST_N family, Ganglioside-induced diff | 81.98 | |
| PRK12759 | 410 | bifunctional gluaredoxin/ribonucleoside-diphosphat | 81.98 | |
| cd02972 | 98 | DsbA_family DsbA family; consists of DsbA and DsbA | 81.73 | |
| cd02984 | 97 | TRX_PICOT TRX domain, PICOT (for PKC-interacting c | 81.44 | |
| cd02995 | 104 | PDI_a_PDI_a'_C PDIa family, C-terminal TRX domain | 81.1 | |
| cd03036 | 111 | ArsC_like Arsenate Reductase (ArsC) family, unknow | 81.02 | |
| PF13417 | 75 | GST_N_3: Glutathione S-transferase, N-terminal dom | 80.76 | |
| cd03053 | 76 | GST_N_Phi GST_N family, Class Phi subfamily; compo | 80.74 | |
| TIGR02187 | 215 | GlrX_arch Glutaredoxin-like domain protein. This f | 80.67 |
| >PF04134 DUF393: Protein of unknown function, DUF393; InterPro: IPR007263 The DCC family, named after the conserved N-terminal DxxCxxC motif, encompasses COG3011 from COG | Back alignment and domain information |
|---|
Probab=99.96 E-value=4.5e-29 Score=190.74 Aligned_cols=110 Identities=32% Similarity=0.587 Sum_probs=100.8
Q ss_pred EEEcCCChhhHHHHHHHHhhcccCCCEEEEeCCChhhhH-HHhCCCChhcccceEEEEEeCCe-EEehHHHHHHHHHHcC
Q 028608 86 MLYDGDCPLCMREVNMLKERNKQYGTIKFVDISSDEYSI-EENQGLDYKTVMGSIHAIVSDGT-VVTDVEAFRRLYEEVG 163 (206)
Q Consensus 86 VlYDG~CplC~~~v~~L~r~d~~~~~I~fvdi~s~~~~~-l~~~gld~e~~~~~lhvv~~dG~-v~~G~dA~~~il~~lp 163 (206)
|||||+||||++++++++++|. .+.|+|+|+|++.... ++..|++.|++++.+|+ +++|+ ++.|++|++++++.++
T Consensus 1 v~YDg~C~lC~~~~~~l~~~d~-~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~-~~~g~~~~~G~~A~~~l~~~~~ 78 (114)
T PF04134_consen 1 VFYDGDCPLCRREVRFLRRRDR-GGRLRFVDIQSEPDQALLASYGISPEDADSRLHL-IDDGERVYRGSDAVLRLLRRLP 78 (114)
T ss_pred CEECCCCHhHHHHHHHHHhcCC-CCCEEEEECCChhhhhHHHhcCcCHHHHcCeeEE-ecCCCEEEEcHHHHHHHHHHcC
Confidence 7999999999999999999986 7999999998887765 56899999999999999 77886 9999999999999998
Q ss_pred c--hhhhhhhcccchhhHHHHHHHHHHhhcccccCC
Q 028608 164 L--GWVYAITKYEPIAKIADFVYSVWAKYRLQITGK 197 (206)
Q Consensus 164 ~--~w~~~ll~l~pv~~l~d~~Yr~VArnR~ri~Gr 197 (206)
. +|+..++.+|++++++|++|++||+||++|+||
T Consensus 79 ~~~~~l~~l~~lp~~~~l~~~~Y~~iA~~R~~~~gr 114 (114)
T PF04134_consen 79 GPWRWLAWLLRLPGIRPLADRLYRWIARNRYRWFGR 114 (114)
T ss_pred cchHHHHHHHHcccHHHHHHHHHHHHHhhHhhhhCc
Confidence 6 555678899999999999999999999999997
|
Proteins in this family are predicted to have a thioredoxin-like fold which, together with the presence of an invariant catalytic cysteine residue, suggests that they are a novel group of thiol-disulphide oxidoreductases []. As some of the bacterial proteins are encoded near penicillin-binding proteins, it has been suggested that these may be involved in redox regulation of cell wall biosynthesis []. |
| >COG3011 Predicted thiol-disulfide oxidoreductase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02180 GRX_euk Glutaredoxin | Back alignment and domain information |
|---|
| >cd03027 GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Egl-10, and Pleckstrin (DEP) subfamily; composed of uncharacterized proteins containing a GRX domain and additional domains DEP and DUF547, both of which have unknown functions | Back alignment and domain information |
|---|
| >cd02066 GRX_family Glutaredoxin (GRX) family; composed of GRX, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain | Back alignment and domain information |
|---|
| >cd03419 GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX human class 1 and 2 (h_1_2)-like subfamily; composed of proteins similar to human GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain | Back alignment and domain information |
|---|
| >TIGR02190 GlrX-dom Glutaredoxin-family domain | Back alignment and domain information |
|---|
| >PHA03050 glutaredoxin; Provisional | Back alignment and domain information |
|---|
| >PRK10638 glutaredoxin 3; Provisional | Back alignment and domain information |
|---|
| >cd03040 GST_N_mPGES2 GST_N family; microsomal Prostaglandin E synthase Type 2 (mPGES2) subfamily; mPGES2 is a membrane-anchored dimeric protein containing a CXXC motif which catalyzes the isomerization of PGH2 to PGE2 | Back alignment and domain information |
|---|
| >cd03418 GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX bacterial class 1 and 3 (b_1_3)-like subfamily; composed of bacterial GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain | Back alignment and domain information |
|---|
| >PRK11200 grxA glutaredoxin 1; Provisional | Back alignment and domain information |
|---|
| >TIGR02200 GlrX_actino Glutaredoxin-like protein | Back alignment and domain information |
|---|
| >cd03041 GST_N_2GST_N GST_N family, 2 repeats of the N-terminal domain of soluble GSTs (2 GST_N) subfamily; composed of uncharacterized proteins | Back alignment and domain information |
|---|
| >cd02966 TlpA_like_family TlpA-like family; composed of TlpA, ResA, DsbE and similar proteins | Back alignment and domain information |
|---|
| >TIGR02183 GRXA Glutaredoxin, GrxA family | Back alignment and domain information |
|---|
| >COG3019 Predicted metal-binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02181 GRX_bact Glutaredoxin, GrxC family | Back alignment and domain information |
|---|
| >cd03029 GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hybrid subfamily; composed of hybrid proteins containing peroxiredoxin (PRX) and GRX domains, which is found in some pathogenic bacteria and cyanobacteria | Back alignment and domain information |
|---|
| >cd03028 GRX_PICOT_like Glutaredoxin (GRX) family, PKC-interacting cousin of TRX (PICOT)-like subfamily; composed of PICOT and GRX-PICOT-like proteins | Back alignment and domain information |
|---|
| >TIGR02189 GlrX-like_plant Glutaredoxin-like family | Back alignment and domain information |
|---|
| >PF13728 TraF: F plasmid transfer operon protein | Back alignment and domain information |
|---|
| >cd03055 GST_N_Omega GST_N family, Class Omega subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd02973 TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)-like family; composed of archaeal and bacterial proteins that show similarity to both TRX and GRX, including the C-terminal TRX-fold subdomain of Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO) | Back alignment and domain information |
|---|
| >PRK13703 conjugal pilus assembly protein TraF; Provisional | Back alignment and domain information |
|---|
| >TIGR02738 TrbB type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB | Back alignment and domain information |
|---|
| >TIGR00365 monothiol glutaredoxin, Grx4 family | Back alignment and domain information |
|---|
| >TIGR02739 TraF type-F conjugative transfer system pilin assembly protein TraF | Back alignment and domain information |
|---|
| >PRK10824 glutaredoxin-4; Provisional | Back alignment and domain information |
|---|
| >PRK10329 glutaredoxin-like protein; Provisional | Back alignment and domain information |
|---|
| >cd00570 GST_N_family Glutathione S-transferase (GST) family, N-terminal domain; a large, diverse group of cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >PRK10877 protein disulfide isomerase II DsbC; Provisional | Back alignment and domain information |
|---|
| >PF00578 AhpC-TSA: AhpC/TSA family; InterPro: IPR000866 Peroxiredoxins (Prxs) are a ubiquitous family of antioxidant enzymes that also control cytokine-induced peroxide levels which mediate signal transduction in mammalian cells | Back alignment and domain information |
|---|
| >KOG1422 consensus Intracellular Cl- channel CLIC, contains GST domain [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PTZ00051 thioredoxin; Provisional | Back alignment and domain information |
|---|
| >PRK11657 dsbG disulfide isomerase/thiol-disulfide oxidase; Provisional | Back alignment and domain information |
|---|
| >TIGR02196 GlrX_YruB Glutaredoxin-like protein, YruB-family | Back alignment and domain information |
|---|
| >cd02982 PDI_b'_family Protein Disulfide Isomerase (PDIb') family, redox inactive TRX-like domain b'; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants | Back alignment and domain information |
|---|
| >cd03060 GST_N_Omega_like GST_N family, Omega-like subfamily; composed of uncharacterized proteins with similarity to class Omega GSTs | Back alignment and domain information |
|---|
| >cd03056 GST_N_4 GST_N family, unknown subfamily 4; composed of uncharacterized bacterial proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >cd02967 mauD Methylamine utilization (mau) D family; mauD protein is the translation product of the mauD gene found in methylotrophic bacteria, which are able to use methylamine as a sole carbon source and a nitrogen source | Back alignment and domain information |
|---|
| >cd03045 GST_N_Delta_Epsilon GST_N family, Class Delta and Epsilon subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03037 GST_N_GRX2 GST_N family, Glutaredoxin 2 (GRX2) subfamily; composed of bacterial proteins similar to E | Back alignment and domain information |
|---|
| >PRK13728 conjugal transfer protein TrbB; Provisional | Back alignment and domain information |
|---|
| >cd03023 DsbA_Com1_like DsbA family, Com1-like subfamily; composed of proteins similar to Com1, a 27-kDa outer membrane-associated immunoreactive protein originally found in both acute and chronic disease strains of the pathogenic bacteria Coxiella burnetti | Back alignment and domain information |
|---|
| >cd03020 DsbA_DsbC_DsbG DsbA family, DsbC and DsbG subfamily; V-shaped homodimeric proteins containing a redox active CXXC motif imbedded in a TRX fold | Back alignment and domain information |
|---|
| >cd03059 GST_N_SspA GST_N family, Stringent starvation protein A (SspA) subfamily; SspA is a RNA polymerase (RNAP)-associated protein required for the lytic development of phage P1 and for stationary phase-induced acid tolerance of E | Back alignment and domain information |
|---|
| >cd01659 TRX_superfamily Thioredoxin (TRX) superfamily; a large, diverse group of proteins containing a TRX-fold | Back alignment and domain information |
|---|
| >TIGR00411 redox_disulf_1 small redox-active disulfide protein 1 | Back alignment and domain information |
|---|
| >PRK03147 thiol-disulfide oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PF00085 Thioredoxin: Thioredoxin; InterPro: IPR013766 Thioredoxins [, , , ] are small disulphide-containing redox proteins that have been found in all the kingdoms of living organisms | Back alignment and domain information |
|---|
| >PRK15412 thiol:disulfide interchange protein DsbE; Provisional | Back alignment and domain information |
|---|
| >PF13098 Thioredoxin_2: Thioredoxin-like domain; PDB: 1T3B_A 2L57_A 1EEJ_B 1TJD_A 1JZD_B 1JZO_A 1G0T_B 3GV1_A 1V58_A 2H0H_A | Back alignment and domain information |
|---|
| >cd02961 PDI_a_family Protein Disulfide Isomerase (PDIa) family, redox active TRX domains; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants | Back alignment and domain information |
|---|
| >cd03051 GST_N_GTT2_like GST_N family, Saccharomyces cerevisiae GTT2-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S | Back alignment and domain information |
|---|
| >TIGR02194 GlrX_NrdH Glutaredoxin-like protein NrdH | Back alignment and domain information |
|---|
| >cd02949 TRX_NTR TRX domain, novel NADPH thioredoxin reductase (NTR) family; composed of fusion proteins found only in oxygenic photosynthetic organisms containing both TRX and NTR domains | Back alignment and domain information |
|---|
| >TIGR02740 TraF-like TraF-like protein | Back alignment and domain information |
|---|
| >cd02968 SCO SCO (an acronym for Synthesis of Cytochrome c Oxidase) family; composed of proteins similar to Sco1, a membrane-anchored protein possessing a soluble domain with a TRX fold | Back alignment and domain information |
|---|
| >cd02976 NrdH NrdH-redoxin (NrdH) family; NrdH is a small monomeric protein with a conserved redox active CXXC motif within a TRX fold, characterized by a glutaredoxin (GRX)-like sequence and TRX-like activity profile | Back alignment and domain information |
|---|
| >TIGR01126 pdi_dom protein disulfide-isomerase domain | Back alignment and domain information |
|---|
| >PTZ00062 glutaredoxin; Provisional | Back alignment and domain information |
|---|
| >cd03061 GST_N_CLIC GST_N family, Chloride Intracellular Channel (CLIC) subfamily; composed of CLIC1-5, p64, parchorin and similar proteins | Back alignment and domain information |
|---|
| >cd03026 AhpF_NTD_C TRX-GRX-like family, Alkyl hydroperoxide reductase F subunit (AhpF) N-terminal domain (NTD) subfamily, C-terminal TRX-fold subdomain; AhpF is a homodimeric flavoenzyme which catalyzes the NADH-dependent reduction of the peroxiredoxin AhpC, which then reduces hydrogen peroxide and organic hydroperoxides | Back alignment and domain information |
|---|
| >cd03052 GST_N_GDAP1 GST_N family, Ganglioside-induced differentiation-associated protein 1 (GDAP1) subfamily; GDAP1 was originally identified as a highly expressed gene at the differentiated stage of GD3 synthase-transfected cells | Back alignment and domain information |
|---|
| >PRK12759 bifunctional gluaredoxin/ribonucleoside-diphosphate reductase subunit beta; Provisional | Back alignment and domain information |
|---|
| >cd02972 DsbA_family DsbA family; consists of DsbA and DsbA-like proteins, including DsbC, DsbG, glutathione (GSH) S-transferase kappa (GSTK), 2-hydroxychromene-2-carboxylate (HCCA) isomerase, an oxidoreductase (FrnE) presumed to be involved in frenolicin biosynthesis, a 27-kDa outer membrane protein, and similar proteins | Back alignment and domain information |
|---|
| >cd02984 TRX_PICOT TRX domain, PICOT (for PKC-interacting cousin of TRX) subfamily; PICOT is a protein that interacts with protein kinase C (PKC) theta, a calcium independent PKC isoform selectively expressed in skeletal muscle and T lymphocytes | Back alignment and domain information |
|---|
| >cd02995 PDI_a_PDI_a'_C PDIa family, C-terminal TRX domain (a') subfamily; composed of the C-terminal redox active a' domains of PDI, ERp72, ERp57 (or ERp60) and EFP1 | Back alignment and domain information |
|---|
| >cd03036 ArsC_like Arsenate Reductase (ArsC) family, unknown subfamily; uncharacterized proteins containing a CXXC motif with similarity to thioredoxin (TRX)-fold arsenic reductases, ArsC | Back alignment and domain information |
|---|
| >PF13417 GST_N_3: Glutathione S-transferase, N-terminal domain; PDB: 3ERG_B 3IBH_A 3ERF_A 3UBL_A 3UBK_A 3IR4_A 3M8N_B 2R4V_A 2PER_A 2R5G_A | Back alignment and domain information |
|---|
| >cd03053 GST_N_Phi GST_N family, Class Phi subfamily; composed of plant-specific class Phi GSTs and related fungal and bacterial proteins | Back alignment and domain information |
|---|
| >TIGR02187 GlrX_arch Glutaredoxin-like domain protein | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
No hit with e-value below 0.005
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 206 | |||
| 3msz_A | 89 | Glutaredoxin 1; alpha-beta sandwich, center for st | 96.36 | |
| 1fov_A | 82 | Glutaredoxin 3, GRX3; active site disulfide, CIS P | 96.26 | |
| 1kte_A | 105 | Thioltransferase; redox-active center, electron tr | 95.79 | |
| 2khp_A | 92 | Glutaredoxin; thioredoxin type domain, ssgcid, ele | 95.69 | |
| 2klx_A | 89 | Glutaredoxin; thioredoxin type domain, ssgcid, ele | 95.59 | |
| 3qmx_A | 99 | Glutaredoxin A, glutaredoxin 3; electron transport | 95.55 | |
| 1aba_A | 87 | Glutaredoxin; electron transport; HET: MES; 1.45A | 95.37 | |
| 2l57_A | 126 | Uncharacterized protein; structural genomics, unkn | 95.35 | |
| 2cq9_A | 130 | GLRX2 protein, glutaredoxin 2; glutathione-S-trans | 95.12 | |
| 2hze_A | 114 | Glutaredoxin-1; thioredoxin fold, arsenic, dimethy | 95.12 | |
| 1zzo_A | 136 | RV1677; thioredoxin fold, structural genomics, PSI | 94.96 | |
| 1lu4_A | 136 | Soluble secreted antigen MPT53; thioredoxin-like f | 94.89 | |
| 3ipz_A | 109 | Monothiol glutaredoxin-S14, chloroplastic; electro | 94.86 | |
| 3c1r_A | 118 | Glutaredoxin-1; oxidized form, oxidoreductase, cyt | 94.73 | |
| 1wik_A | 109 | Thioredoxin-like protein 2; picot homology 2 domai | 94.69 | |
| 2yan_A | 105 | Glutaredoxin-3; oxidoreductase; HET: GSH; 1.90A {H | 94.67 | |
| 3ha9_A | 165 | Uncharacterized thioredoxin-like protein; PSI, MCS | 94.49 | |
| 1r7h_A | 75 | NRDH-redoxin; thioredoxin, glutaredoxin, redox pro | 94.49 | |
| 3gx8_A | 121 | Monothiol glutaredoxin-5, mitochondrial; TRX fold, | 94.27 | |
| 3ctg_A | 129 | Glutaredoxin-2; reduced form, electron transport, | 94.26 | |
| 2lqo_A | 92 | Putative glutaredoxin RV3198.1/MT3292; TRX fold, o | 94.22 | |
| 2b5x_A | 148 | YKUV protein, TRXY; thioredoxin-like, oxidoreducta | 94.17 | |
| 3h8q_A | 114 | Thioredoxin reductase 3; oxidoreductase, structura | 94.13 | |
| 2lrn_A | 152 | Thiol:disulfide interchange protein; structural ge | 94.09 | |
| 3rhb_A | 113 | ATGRXC5, glutaredoxin-C5, chloroplastic; thioredox | 93.91 | |
| 1h75_A | 81 | Glutaredoxin-like protein NRDH; electron transport | 93.83 | |
| 1ego_A | 85 | Glutaredoxin; electron transport; NMR {Escherichia | 93.73 | |
| 2ht9_A | 146 | Glutaredoxin-2; thioredoxin fold, iron-sulfur clus | 93.73 | |
| 4evm_A | 138 | Thioredoxin family protein; structural genomics, n | 93.69 | |
| 3erw_A | 145 | Sporulation thiol-disulfide oxidoreductase A; thio | 93.67 | |
| 3ia1_A | 154 | THIO-disulfide isomerase/thioredoxin; oxidoreducta | 93.4 | |
| 2vlu_A | 122 | Thioredoxin, thioredoxin H isoform 2.; oxidoreduct | 93.35 | |
| 2e7p_A | 116 | Glutaredoxin; thioredoxin fold, poplar, electron t | 93.23 | |
| 1t1v_A | 93 | SH3BGRL3, SH3 domain-binding glutamic acid-rich pr | 93.14 | |
| 3zyw_A | 111 | Glutaredoxin-3; metal binding protein; 1.84A {Homo | 93.06 | |
| 1xfl_A | 124 | Thioredoxin H1; AT3G51030, structural genomics, pr | 93.01 | |
| 2oe3_A | 114 | Thioredoxin-3; electron transport, alpha/beta sand | 93.01 | |
| 3fk8_A | 133 | Disulphide isomerase; APC61824.1, xylella fastidio | 92.96 | |
| 1nm3_A | 241 | Protein HI0572; hybrid, peroxiredoxin, glutaredoxi | 92.92 | |
| 2f9s_A | 151 | Thiol-disulfide oxidoreductase RESA; thioredoxin-l | 92.9 | |
| 2e0q_A | 104 | Thioredoxin; electron transport; 1.49A {Sulfolobus | 92.87 | |
| 3hdc_A | 158 | Thioredoxin family protein; ATCC53774, DSM 7210, , | 92.8 | |
| 1t00_A | 112 | Thioredoxin, TRX; redox regulation, multifunction | 92.69 | |
| 1kng_A | 156 | Thiol:disulfide interchange protein CYCY; thioredo | 92.69 | |
| 3hxs_A | 141 | Thioredoxin, TRXP; electron transport; 2.00A {Bact | 92.58 | |
| 3ic4_A | 92 | Glutaredoxin (GRX-1); structural genomics, PSI, MC | 92.58 | |
| 3fkf_A | 148 | Thiol-disulfide oxidoreductase; structural genomic | 92.57 | |
| 1w4v_A | 119 | Thioredoxin, mitochondrial; antioxidant enzyme, mi | 92.54 | |
| 2ct6_A | 111 | SH3 domain-binding glutamic acid-rich-like protein | 92.43 | |
| 1r26_A | 125 | Thioredoxin; redox-active disulfide, electron tran | 92.43 | |
| 1dby_A | 107 | Chloroplast thioredoxin M CH2; thioredoxin CH2, ch | 92.42 | |
| 2vm1_A | 118 | Thioredoxin, thioredoxin H isoform 1.; oxidoreduct | 92.35 | |
| 2trx_A | 108 | Thioredoxin; electron transport; 1.68A {Escherichi | 92.28 | |
| 1syr_A | 112 | Thioredoxin; SGPP, structural genomics, PSI, prote | 92.14 | |
| 2pu9_C | 111 | TRX-F, thioredoxin F-type, chloroplast; protein-pr | 92.11 | |
| 2l5l_A | 136 | Thioredoxin; structural genomics, electron transpo | 92.1 | |
| 3l4n_A | 127 | Monothiol glutaredoxin-6; C-terminal domain of GRX | 92.05 | |
| 2i4a_A | 107 | Thioredoxin; acidophIle, disulfide exchange, oxido | 92.04 | |
| 1xwb_A | 106 | Thioredoxin; dimerization, redox regulation, THI X | 91.92 | |
| 3kcm_A | 154 | Thioredoxin family protein; SGX, thioredoxin prote | 91.89 | |
| 1ep7_A | 112 | Thioredoxin CH1, H-type; electron transport; 2.10A | 91.88 | |
| 2l5o_A | 153 | Putative thioredoxin; structural genomics, unknown | 91.76 | |
| 1ti3_A | 113 | Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Popul | 91.75 | |
| 2vim_A | 104 | Thioredoxin, TRX; thioredoxin fold, oxidoreductase | 91.74 | |
| 1thx_A | 115 | Thioredoxin, thioredoxin 2; oxido-reductase, elect | 91.62 | |
| 3die_A | 106 | Thioredoxin, TRX; electron transport, SWAP domain, | 91.38 | |
| 2wz9_A | 153 | Glutaredoxin-3; protein binding; 1.55A {Homo sapie | 91.36 | |
| 1nsw_A | 105 | Thioredoxin, TRX; thermostability, electron transp | 91.32 | |
| 2wci_A | 135 | Glutaredoxin-4; redox-active center, iron-sulfur c | 91.3 | |
| 2lrt_A | 152 | Uncharacterized protein; structural genomics, thio | 91.28 | |
| 2lja_A | 152 | Putative thiol-disulfide oxidoreductase; structura | 91.25 | |
| 3or5_A | 165 | Thiol:disulfide interchange protein, thioredoxin p | 91.24 | |
| 2wem_A | 118 | Glutaredoxin-related protein 5; chromosome 14 open | 91.21 | |
| 2fwh_A | 134 | Thiol:disulfide interchange protein DSBD; thioredo | 91.11 | |
| 3tco_A | 109 | Thioredoxin (TRXA-1); disulfide oxidoreductase, ox | 91.07 | |
| 1fb6_A | 105 | Thioredoxin M; electron transport; 2.10A {Spinacia | 91.03 | |
| 2yzu_A | 109 | Thioredoxin; redox protein, electron transport, st | 90.93 | |
| 3drn_A | 161 | Peroxiredoxin, bacterioferritin comigratory prote | 90.93 | |
| 2i1u_A | 121 | Thioredoxin, TRX, MPT46; redox protein, electron t | 90.92 | |
| 1xvw_A | 160 | Hypothetical protein RV2238C/MT2298; thioredoxin f | 90.8 | |
| 2cvb_A | 188 | Probable thiol-disulfide isomerase/thioredoxin; re | 90.79 | |
| 1fo5_A | 85 | Thioredoxin; disulfide oxidoreductase, structural | 90.7 | |
| 3raz_A | 151 | Thioredoxin-related protein; structural genomics, | 90.55 | |
| 3gyk_A | 175 | 27KDA outer membrane protein; APC61738.2, siliciba | 90.5 | |
| 2xc2_A | 117 | Thioredoxinn; oxidoreductase, protein disulfide re | 90.46 | |
| 3d22_A | 139 | TRXH4, thioredoxin H-type; electron transport, cyt | 90.44 | |
| 1nho_A | 85 | Probable thioredoxin; beta sheet, alpha helix, oxi | 90.42 | |
| 3gl3_A | 152 | Putative thiol:disulfide interchange protein DSBE; | 90.39 | |
| 3nzn_A | 103 | Glutaredoxin; structural genomics, PSI2, MCSG, pro | 90.25 | |
| 2k8s_A | 80 | Thioredoxin; dimer, structural genomics, PSI-2, pr | 90.19 | |
| 3q18_A | 239 | GSTO-2, glutathione S-transferase omega-2; glutath | 90.18 | |
| 1faa_A | 124 | Thioredoxin F; electron transport; 1.85A {Spinacia | 89.94 | |
| 3qfa_C | 116 | Thioredoxin; protein-protein complex, rossmann fol | 89.83 | |
| 2l6c_A | 110 | Thioredoxin; oxidoreductase; NMR {Desulfovibrio vu | 89.82 | |
| 2k6v_A | 172 | Putative cytochrome C oxidase assembly protein; th | 89.74 | |
| 3f3q_A | 109 | Thioredoxin-1; His TAG, electron transport, cytopl | 89.38 | |
| 1jfu_A | 186 | Thiol:disulfide interchange protein TLPA; thioredo | 89.35 | |
| 2wul_A | 118 | Glutaredoxin related protein 5; chromosome 14 open | 89.32 | |
| 3kh7_A | 176 | Thiol:disulfide interchange protein DSBE; TRX-like | 89.29 | |
| 1i5g_A | 144 | Tryparedoxin II; electron transport; HET: TS5; 1.4 | 89.28 | |
| 2j23_A | 121 | Thioredoxin; immune protein, autoreactivity, cross | 89.28 | |
| 3m9j_A | 105 | Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} | 89.27 | |
| 3cxg_A | 133 | Putative thioredoxin; malaria, structural GEN oxid | 89.24 | |
| 1v98_A | 140 | Thioredoxin; oxidoreductase, structural genomics, | 89.19 | |
| 2o8v_B | 128 | Thioredoxin 1; disulfide crosslinked complex, oxid | 88.93 | |
| 2ppt_A | 155 | Thioredoxin-2; thiredoxin, zinc finger, oxidoreduc | 88.91 | |
| 3gv1_A | 147 | Disulfide interchange protein; neisseria gonorrhoe | 88.84 | |
| 1ttz_A | 87 | Conserved hypothetical protein; structural genomic | 88.79 | |
| 2ywi_A | 196 | Hypothetical conserved protein; uncharacterized co | 88.76 | |
| 1eej_A | 216 | Thiol:disulfide interchange protein; oxidoreductas | 88.55 | |
| 3uvt_A | 111 | Thioredoxin domain-containing protein 5; thioredox | 88.18 | |
| 1gh2_A | 107 | Thioredoxin-like protein; redox-active center, ele | 88.13 | |
| 3eur_A | 142 | Uncharacterized protein; PSI2,MCSG, conserved prot | 88.12 | |
| 4hi7_A | 228 | GI20122; GST, glutathione S-transferase, enzyme fu | 88.09 | |
| 1v58_A | 241 | Thiol:disulfide interchange protein DSBG; reduced | 88.05 | |
| 3s9f_A | 165 | Tryparedoxin; thioredoxin fold, disulfide reductas | 88.01 | |
| 2voc_A | 112 | Thioredoxin; electron transport, homodimer, disulf | 87.93 | |
| 3hd5_A | 195 | Thiol:disulfide interchange protein DSBA; protein | 87.88 | |
| 2b1k_A | 168 | Thiol:disulfide interchange protein DSBE; C-termin | 87.83 | |
| 2vup_A | 190 | Glutathione peroxidase-like protein; oxidoreductas | 87.66 | |
| 3ewl_A | 142 | Uncharacterized conserved protein BF1870; alpha-be | 87.49 | |
| 3vln_A | 241 | GSTO-1, glutathione S-transferase omega-1; GST fol | 87.35 | |
| 1t3b_A | 211 | Thiol:disulfide interchange protein DSBC; oxidored | 87.31 | |
| 1o8x_A | 146 | Tryparedoxin, TRYX, TXNI; tryparedoxin-I, synchrot | 87.29 | |
| 3d6i_A | 112 | Monothiol glutaredoxin-3; thioredoxin-like, electr | 87.15 | |
| 1wjk_A | 100 | C330018D20RIK protein; glutaredoxin, thioredoxin f | 87.11 | |
| 3qav_A | 243 | RHO-class glutathione S-transferase; cytosol; 2.10 | 86.91 | |
| 3hz8_A | 193 | Thiol:disulfide interchange protein DSBA; thiol-ox | 86.78 | |
| 1o73_A | 144 | Tryparedoxin; electron transport, trypanosomatid, | 86.77 | |
| 3l9v_A | 189 | Putative thiol-disulfide isomerase or thioredoxin; | 86.75 | |
| 3eyt_A | 158 | Uncharacterized protein SPOA0173; thioredoxin-like | 86.73 | |
| 3gnj_A | 111 | Thioredoxin domain protein; APC92103, STR genomics | 86.71 | |
| 2rem_A | 193 | Disulfide oxidoreductase; disulfide oxidoreductase | 86.59 | |
| 2fgx_A | 107 | Putative thioredoxin; NET3, NESG, GFT-glutaredoxin | 86.59 | |
| 1psq_A | 163 | Probable thiol peroxidase; structural genomics, NY | 86.44 | |
| 2obi_A | 183 | PHGPX, GPX-4, phospholipid hydroperoxide glutathio | 86.44 | |
| 3hcz_A | 148 | Possible thiol-disulfide isomerase; APC61559.2, cy | 86.37 | |
| 3tdg_A | 273 | DSBG, putative uncharacterized protein; thioredoxi | 86.15 | |
| 2imi_A | 221 | Epsilon-class glutathione S-transferase; HET: GSH; | 86.1 | |
| 3ir4_A | 218 | Glutaredoxin 2; glutathione, IDP00895, structural | 86.02 | |
| 3p2a_A | 148 | Thioredoxin 2, putative thioredoxin-like protein; | 85.99 | |
| 3emx_A | 135 | Thioredoxin; structural genomics, oxidoreductase, | 85.83 | |
| 3rbt_A | 246 | Glutathione transferase O1; glutathione S-transfer | 85.79 | |
| 3fz4_A | 120 | Putative arsenate reductase; APC61768, structural | 85.76 | |
| 3u5r_E | 218 | Uncharacterized protein; structural genomics, PSI- | 85.68 | |
| 3h93_A | 192 | Thiol:disulfide interchange protein DSBA; disulfid | 85.66 | |
| 2f51_A | 118 | Thioredoxin; electron transport; 1.90A {Trichomona | 85.49 | |
| 1x5e_A | 126 | Thioredoxin domain containing protein 1; TMX, TXND | 85.46 | |
| 3lor_A | 160 | Thiol-disulfide isomerase and thioredoxins; PSI, M | 85.4 | |
| 2p31_A | 181 | CL683, glutathione peroxidase 7; thioredoxin fold, | 85.14 | |
| 2ju5_A | 154 | Thioredoxin disulfide isomerase; protein, oxidored | 85.06 | |
| 3bby_A | 215 | Uncharacterized GST-like protein YFCF; NP_416804.1 | 85.04 | |
| 3fw2_A | 150 | Thiol-disulfide oxidoreductase; structural genomic | 84.94 | |
| 4euy_A | 105 | Uncharacterized protein; structural genomics, PSI- | 84.69 | |
| 2p5q_A | 170 | Glutathione peroxidase 5; thioredoxin fold, oxidor | 84.55 | |
| 2gs3_A | 185 | PHGPX, GPX-4, phospholipid hydroperoxide glutathio | 84.38 | |
| 1r5a_A | 218 | Glutathione transferase; glutathione S-transferase | 84.28 | |
| 3aps_A | 122 | DNAJ homolog subfamily C member 10; thioredoxin fo | 84.2 | |
| 4hz2_A | 230 | Glutathione S-transferase domain; glutathione,enzy | 84.09 | |
| 3l9s_A | 191 | Thiol:disulfide interchange protein; thioredoxin-f | 84.06 | |
| 1gnw_A | 211 | Glutathione S-transferase; herbicide detoxificatio | 84.04 | |
| 1uul_A | 202 | Tryparedoxin peroxidase homologue; peroxiredoxin, | 83.97 | |
| 4hoj_A | 210 | REGF protein; GST, glutathione S-transferase, enzy | 83.82 | |
| 1z6m_A | 175 | Conserved hypothetical protein; structural genomic | 83.63 | |
| 3lwa_A | 183 | Secreted thiol-disulfide isomerase; thioredoxin, P | 83.51 | |
| 2jad_A | 362 | Yellow fluorescent protein glutaredoxin fusion pro | 83.25 | |
| 3cmi_A | 171 | Peroxiredoxin HYR1; thioredoxin-like fold, oxidore | 82.91 | |
| 2yj7_A | 106 | LPBCA thioredoxin; oxidoreductase; 1.65A {Syntheti | 83.47 | |
| 1ljr_A | 244 | HGST T2-2, glutathione S-transferase; HET: GSH; 3. | 82.77 | |
| 4ags_A | 471 | Thiol-dependent reductase 1; transferase, leishman | 82.76 | |
| 3ein_A | 209 | GST class-theta, glutathione S-transferase 1-1; de | 82.73 | |
| 3kij_A | 180 | Probable glutathione peroxidase 8; human PDI-perox | 82.47 | |
| 1axd_A | 209 | Glutathione S-transferase I; transferase, herbicid | 82.44 | |
| 3m3m_A | 210 | Glutathione S-transferase; PSI-II, structural geno | 82.44 | |
| 2hnl_A | 225 | Glutathione S-transferase 1; prostaglandin synthas | 82.38 | |
| 1a8l_A | 226 | Protein disulfide oxidoreductase; PDI, thioredoxin | 82.29 | |
| 2dj3_A | 133 | Protein disulfide-isomerase A4; protein ERP-72, ER | 81.88 | |
| 3lyk_A | 216 | Stringent starvation protein A homolog; structural | 81.86 | |
| 1xvq_A | 175 | Thiol peroxidase; thioredoxin fold, structural gen | 81.76 | |
| 3l78_A | 120 | Regulatory protein SPX; transcription, transcripti | 81.7 | |
| 2v6k_A | 214 | Maleylpyruvate isomerase; glutathione-S-transferas | 81.6 | |
| 3ay8_A | 216 | Glutathione S-transferase; GST fold, GST binding, | 81.42 | |
| 1v2a_A | 210 | Glutathione transferase GST1-6; glutathione S-tran | 81.37 | |
| 2rli_A | 171 | SCO2 protein homolog, mitochondrial; copper protei | 81.34 | |
| 1x5d_A | 133 | Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC | 81.33 | |
| 3gha_A | 202 | Disulfide bond formation protein D; BDBD, DSBA-lik | 81.24 | |
| 3ul3_B | 128 | Thioredoxin, thioredoxin-2; PTEX, oxidoreductase; | 81.19 | |
| 1we0_A | 187 | Alkyl hydroperoxide reductase C; peroxiredoxin, AH | 81.08 | |
| 1e6b_A | 221 | Glutathione S-transferase; 1.65A {Arabidopsis thal | 81.08 | |
| 3hz4_A | 140 | Thioredoxin; NYSGXRC, PSI-II, reduced form, protei | 81.0 | |
| 1xzo_A | 174 | BSSCO, hypothetical protein YPMQ; thioredoxin-like | 80.83 | |
| 1k0d_A | 260 | URE2 protein; nitrate assimilation, structural gen | 80.8 | |
| 4iel_A | 229 | Glutathione S-transferase, N-terminal domain PROT; | 80.75 | |
| 4dvc_A | 184 | Thiol:disulfide interchange protein DSBA; pilus as | 80.6 | |
| 4id0_A | 214 | Glutathione S-transferase-like protein YIBF; GST, | 80.5 | |
| 3vk9_A | 216 | Glutathione S-transferase delta; glutathione bindi | 80.48 | |
| 3kp8_A | 106 | Vkorc1/thioredoxin domain protein; blood coagulati | 80.47 | |
| 1qmv_A | 197 | Human thioredoxin peroxidase-B; peroxiredoxin, sul | 80.28 |
| >3msz_A Glutaredoxin 1; alpha-beta sandwich, center for structural genomics of infec diseases, csgid, oxidoreductase; HET: GSH; 2.05A {Francisella tularensis subsp} PDB: 3lgc_A* | Back alignment and structure |
|---|
Probab=96.36 E-value=0.0089 Score=40.89 Aligned_cols=77 Identities=16% Similarity=0.256 Sum_probs=48.9
Q ss_pred CceEEEEcCCChhhHHHHHHHHhhcccCCCEEEEeCCChhh----hHH-HhCCCChhcccceEEEEEeCCeEEehHHHHH
Q 028608 82 WKIKMLYDGDCPLCMREVNMLKERNKQYGTIKFVDISSDEY----SIE-ENQGLDYKTVMGSIHAIVSDGTVVTDVEAFR 156 (206)
Q Consensus 82 ~~l~VlYDG~CplC~~~v~~L~r~d~~~~~I~fvdi~s~~~----~~l-~~~gld~e~~~~~lhvv~~dG~v~~G~dA~~ 156 (206)
.+++||....||.|.+...+|.+... .+.++++..... ..+ +..|...-.. ..+-++.-||+.+.|++.+.
T Consensus 4 m~v~ly~~~~Cp~C~~~~~~L~~~~i---~~~~~~vd~~~~~~~~~el~~~~g~~~~~~-~~vP~i~i~g~~i~g~~~i~ 79 (89)
T 3msz_A 4 MKVKIYTRNGCPYCVWAKQWFEENNI---AFDETIIDDYAQRSKFYDEMNQSGKVIFPI-STVPQIFIDDEHIGGFTELK 79 (89)
T ss_dssp CCEEEEECTTCHHHHHHHHHHHHTTC---CCEEEECCSHHHHHHHHHHHHTTTCCSSCC-CSSCEEEETTEEEESHHHHH
T ss_pred eEEEEEEcCCChhHHHHHHHHHHcCC---CceEEEeecCCChhHHHHHHHHhCCCCCCC-CccCEEEECCEEEeChHHHH
Confidence 45788888999999999999987643 466665544322 111 2223200000 12334445999999999999
Q ss_pred HHHHHc
Q 028608 157 RLYEEV 162 (206)
Q Consensus 157 ~il~~l 162 (206)
.++..+
T Consensus 80 ~~~~~~ 85 (89)
T 3msz_A 80 ANADKI 85 (89)
T ss_dssp HTHHHH
T ss_pred HHHHHH
Confidence 887753
|
| >1fov_A Glutaredoxin 3, GRX3; active site disulfide, CIS Pro 53, electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 3grx_A* | Back alignment and structure |
|---|
| >1kte_A Thioltransferase; redox-active center, electron transport, acetylation; 2.20A {Sus scrofa} SCOP: c.47.1.1 PDB: 1jhb_A 1b4q_A* | Back alignment and structure |
|---|
| >2khp_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Brucella melitensis} | Back alignment and structure |
|---|
| >2klx_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Bartonella henselae} | Back alignment and structure |
|---|
| >3qmx_A Glutaredoxin A, glutaredoxin 3; electron transport; 1.82A {Synechocystis SP} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >1aba_A Glutaredoxin; electron transport; HET: MES; 1.45A {Enterobacteria phage T4} SCOP: c.47.1.1 PDB: 1aaz_A 1de1_A 1de2_A | Back alignment and structure |
|---|
| >2l57_A Uncharacterized protein; structural genomics, unknown function, thioredoxin-like, PSI protein structure initiative; NMR {Clostridium perfringens} | Back alignment and structure |
|---|
| >2cq9_A GLRX2 protein, glutaredoxin 2; glutathione-S-transferase, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2hze_A Glutaredoxin-1; thioredoxin fold, arsenic, dimethylarsenite., electron trans oxidoreductase; 1.80A {Ectromelia virus} PDB: 2hzf_A 2hze_B | Back alignment and structure |
|---|
| >1zzo_A RV1677; thioredoxin fold, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 1.60A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 3ios_A | Back alignment and structure |
|---|
| >1lu4_A Soluble secreted antigen MPT53; thioredoxin-like fold, structural genomics, PSI, protein structure initiative; 1.12A {Mycobacterium tuberculosis} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >3ipz_A Monothiol glutaredoxin-S14, chloroplastic; electron transport, PL redox-active center, transit peptide, transport, oxidoreduc; 2.40A {Arabidopsis thaliana} PDB: 2lku_A | Back alignment and structure |
|---|
| >3c1r_A Glutaredoxin-1; oxidized form, oxidoreductase, cytoplasm, electron transport, redox-active center, transport; HET: MES; 2.00A {Saccharomyces cerevisiae} PDB: 3c1s_A* 2jac_A* | Back alignment and structure |
|---|
| >1wik_A Thioredoxin-like protein 2; picot homology 2 domain, picot protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2yan_A Glutaredoxin-3; oxidoreductase; HET: GSH; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >3ha9_A Uncharacterized thioredoxin-like protein; PSI, MCSG, structural G midwest center for structural genomics, protein structure initiative; 1.70A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >1r7h_A NRDH-redoxin; thioredoxin, glutaredoxin, redox protein, domain swapping, electron transport; 2.69A {Corynebacterium ammoniagenes} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >3gx8_A Monothiol glutaredoxin-5, mitochondrial; TRX fold, electron transport, mitochondrion, redox-active center, transit peptide, transport; 1.67A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3ctg_A Glutaredoxin-2; reduced form, electron transport, mitochondrion, redox-activ transit peptide, transport, oxidoreductase; 1.50A {Saccharomyces cerevisiae} PDB: 3ctf_A 3d4m_A 3d5j_A* | Back alignment and structure |
|---|
| >2lqo_A Putative glutaredoxin RV3198.1/MT3292; TRX fold, oxidoreductase; NMR {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2b5x_A YKUV protein, TRXY; thioredoxin-like, oxidoreductase; NMR {Bacillus subtilis} SCOP: c.47.1.10 PDB: 2b5y_A | Back alignment and structure |
|---|
| >3h8q_A Thioredoxin reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC, developmental protein, differentiation; 2.21A {Homo sapiens} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >2lrn_A Thiol:disulfide interchange protein; structural genomics, thioredoxin-like, NEW YORK structural G research consortium, oxidoreductase; NMR {Bacteroides SP} | Back alignment and structure |
|---|
| >3rhb_A ATGRXC5, glutaredoxin-C5, chloroplastic; thioredoxin fold, thiol-disulfide oxidoreductase, glutaredox oxidoreductase; HET: GSH; 1.20A {Arabidopsis thaliana} PDB: 3rhc_A* 3fz9_A* 3fza_A* | Back alignment and structure |
|---|
| >1h75_A Glutaredoxin-like protein NRDH; electron transport, thioredoxin, redox protein; 1.7A {Escherichia coli} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >1ego_A Glutaredoxin; electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 1egr_A 1grx_A* 1qfn_A | Back alignment and structure |
|---|
| >2ht9_A Glutaredoxin-2; thioredoxin fold, iron-sulfur cluster, 2Fe2S, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: GSH; 1.90A {Homo sapiens} PDB: 2fls_A* | Back alignment and structure |
|---|
| >4evm_A Thioredoxin family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.51A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >3erw_A Sporulation thiol-disulfide oxidoreductase A; thioredoxin-like fold, RESA-like fold, dithiol, STOA, redox-active center; 2.50A {Bacillus subtilis} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >3ia1_A THIO-disulfide isomerase/thioredoxin; oxidoreductase, PSI-2, NYSGXRC, structu genomics, protein structure initiative; 1.76A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2vlu_A Thioredoxin, thioredoxin H isoform 2.; oxidoreductase, thioredoxin-fold, protein disulfide reductase; 1.70A {Hordeum vulgare var} PDB: 2vlt_A 2vlv_A 2iwt_A* | Back alignment and structure |
|---|
| >2e7p_A Glutaredoxin; thioredoxin fold, poplar, electron transport; HET: GSH; 2.10A {Populus tremula x populus tremuloides} PDB: 1z7p_A 1z7r_A | Back alignment and structure |
|---|
| >1t1v_A SH3BGRL3, SH3 domain-binding glutamic acid-rich protein-LIK; glutaredoxin, thioredoxin fold, protein 3D-structure, X-RAY crystallography; 1.60A {Mus musculus} SCOP: c.47.1.14 PDB: 1j0f_A 1sj6_A | Back alignment and structure |
|---|
| >3zyw_A Glutaredoxin-3; metal binding protein; 1.84A {Homo sapiens} | Back alignment and structure |
|---|
| >1xfl_A Thioredoxin H1; AT3G51030, structural genomics, protein structure initiative, CESG, center for eukaryotic structural genomics; NMR {Arabidopsis thaliana} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2oe3_A Thioredoxin-3; electron transport, alpha/beta sandwich, oxidized, dimer; 1.80A {Saccharomyces cerevisiae} PDB: 2oe1_A 2oe0_A | Back alignment and structure |
|---|
| >3fk8_A Disulphide isomerase; APC61824.1, xylella fastidiosa temecul structural genomics, PSI-2, protein structure initiative; 1.30A {Xylella fastidiosa} | Back alignment and structure |
|---|
| >1nm3_A Protein HI0572; hybrid, peroxiredoxin, glutaredoxin, electron transport; 2.80A {Haemophilus influenzae} SCOP: c.47.1.1 c.47.1.10 | Back alignment and structure |
|---|
| >2f9s_A Thiol-disulfide oxidoreductase RESA; thioredoxin-like protein; HET: MSE; 1.40A {Bacillus subtilis} SCOP: c.47.1.10 PDB: 1st9_A 1su9_A 2h1d_A 2h1b_A 2h1a_A 2h19_A 2h1g_A 3c71_A 3c73_A | Back alignment and structure |
|---|
| >2e0q_A Thioredoxin; electron transport; 1.49A {Sulfolobus tokodaii} PDB: 3hhv_A | Back alignment and structure |
|---|
| >3hdc_A Thioredoxin family protein; ATCC53774, DSM 7210, , structural genomics, PSI-2, protein structure initiative; 1.77A {Geobacter metallireducens gs-15} | Back alignment and structure |
|---|
| >1t00_A Thioredoxin, TRX; redox regulation, multifunction macromolecule, electron transport; 1.51A {Streptomyces coelicolor} | Back alignment and structure |
|---|
| >1kng_A Thiol:disulfide interchange protein CYCY; thioredoxin fold, cytochrome C maturation, atomic resolution oxidoreductase; 1.14A {Bradyrhizobium japonicum} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >3hxs_A Thioredoxin, TRXP; electron transport; 2.00A {Bacteroides fragilis} PDB: 3hyp_A | Back alignment and structure |
|---|
| >3ic4_A Glutaredoxin (GRX-1); structural genomics, PSI, MCSG, protein structure initiative, midwest center for structural genomic oxidoreductase; 1.70A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3fkf_A Thiol-disulfide oxidoreductase; structural genomics, PSI-2, structure initiative, midwest center for structural genomic oxidoreductase; 2.20A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >1w4v_A Thioredoxin, mitochondrial; antioxidant enzyme, mitochondrion, electron TRA oxidoreductase; 1.80A {Homo sapiens} PDB: 1uvz_A 1w89_A | Back alignment and structure |
|---|
| >2ct6_A SH3 domain-binding glutamic acid-rich-like protein 2; SH3BGRL2,FASH3, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1r26_A Thioredoxin; redox-active disulfide, electron transport; 1.40A {Trypanosoma} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >1dby_A Chloroplast thioredoxin M CH2; thioredoxin CH2, chloroplastic thioredoxin, oxidoreductase; NMR {Chlamydomonas reinhardtii} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2vm1_A Thioredoxin, thioredoxin H isoform 1.; oxidoreductase, protein disulfide reductase, thioredoxin-FOL; 1.7A {Hordeum vulgare var} PDB: 2vm2_A | Back alignment and structure |
|---|
| >2trx_A Thioredoxin; electron transport; 1.68A {Escherichia coli} SCOP: c.47.1.1 PDB: 1skr_B* 1skw_B* 1sl0_B* 1sks_B* 1sl2_B* 1t7p_B* 1t8e_B* 1tk0_B* 1tk5_B* 1tk8_B* 1tkd_B* 1sl1_B* 1x9s_B* 1x9w_B* 1xoa_A 1xob_A 1zyq_B* 2ajq_B* 2bto_T* 2h6x_A ... | Back alignment and structure |
|---|
| >1syr_A Thioredoxin; SGPP, structural genomics, PSI, protein structure initiative structural genomics of pathogenic protozoa consortium; 2.95A {Plasmodium falciparum} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2pu9_C TRX-F, thioredoxin F-type, chloroplast; protein-protein complex, iron-sulfur, electron transport; 1.65A {Spinacia oleracea} PDB: 2pvo_C 1f9m_A | Back alignment and structure |
|---|
| >2l5l_A Thioredoxin; structural genomics, electron transport, PSI-2, protein STRU initiative; NMR {Bacteroides vulgatus} | Back alignment and structure |
|---|
| >3l4n_A Monothiol glutaredoxin-6; C-terminal domain of GRX6, oxidoreductase; HET: GSH; 1.50A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2i4a_A Thioredoxin; acidophIle, disulfide exchange, oxidoreductase; 1.00A {Acetobacter aceti} | Back alignment and structure |
|---|
| >1xwb_A Thioredoxin; dimerization, redox regulation, THI X-RAY electron transport; 2.20A {Drosophila melanogaster} SCOP: c.47.1.1 PDB: 1xw9_A 1xwc_A 1xwa_A | Back alignment and structure |
|---|
| >3kcm_A Thioredoxin family protein; SGX, thioredoxin protein, PSI, structural genomics, protein initiative; 2.45A {Geobacter metallireducens gs-15} | Back alignment and structure |
|---|
| >1ep7_A Thioredoxin CH1, H-type; electron transport; 2.10A {Chlamydomonas reinhardtii} SCOP: c.47.1.1 PDB: 1tof_A 1ep8_A | Back alignment and structure |
|---|
| >2l5o_A Putative thioredoxin; structural genomics, unknown function, PSI-2, protein struct initiative; NMR {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >1ti3_A Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Populus tremula} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2vim_A Thioredoxin, TRX; thioredoxin fold, oxidoreductase; 1.38A {Fasciola hepatica} | Back alignment and structure |
|---|
| >1thx_A Thioredoxin, thioredoxin 2; oxido-reductase, electron transport; 1.60A {Nostoc SP} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >3die_A Thioredoxin, TRX; electron transport, SWAP domain, redox enzymology, oxidoreductase, redox-active center, transport; 1.85A {Staphylococcus aureus} SCOP: c.47.1.1 PDB: 2o7k_A 2o85_A 2o89_A 2o87_A | Back alignment and structure |
|---|
| >2wz9_A Glutaredoxin-3; protein binding; 1.55A {Homo sapiens} PDB: 2diy_A | Back alignment and structure |
|---|
| >1nsw_A Thioredoxin, TRX; thermostability, electron transport; 1.90A {Alicyclobacillus acidocaldarius} SCOP: c.47.1.1 PDB: 1rqm_A 1quw_A 1nw2_A | Back alignment and structure |
|---|
| >2wci_A Glutaredoxin-4; redox-active center, iron-sulfur cluster scaffolder, Fe2S2, homodimer, transport, glutathione, thioredoxin fold; HET: GSH; 1.90A {Escherichia coli} PDB: 1yka_A | Back alignment and structure |
|---|
| >2lrt_A Uncharacterized protein; structural genomics, thioredoxin-like, NEW YORK structural G research consortium, nysgrc, PSI-biology; NMR {Bacteroides vulgatus} | Back alignment and structure |
|---|
| >2lja_A Putative thiol-disulfide oxidoreductase; structural genomics, unknown function, thioredoxin-like; NMR {Bacteroides vulgatus} | Back alignment and structure |
|---|
| >3or5_A Thiol:disulfide interchange protein, thioredoxin protein; PSI-II, structural genomics, protein structure initiative; 1.66A {Chlorobaculum tepidum} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >2fwh_A Thiol:disulfide interchange protein DSBD; thioredoxin-like, C-terminal domain, reduced form at PH7, oxidoreductase; 0.99A {Escherichia coli} SCOP: c.47.1.1 PDB: 2fwe_A 2fwf_A 2fwg_A 1vrs_D 1uc7_A | Back alignment and structure |
|---|
| >3tco_A Thioredoxin (TRXA-1); disulfide oxidoreductase, oxidoreductase; 1.90A {Sulfolobus solfataricus} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >1fb6_A Thioredoxin M; electron transport; 2.10A {Spinacia oleracea} SCOP: c.47.1.1 PDB: 1fb0_A 1gl8_A 2puk_C | Back alignment and structure |
|---|
| >2yzu_A Thioredoxin; redox protein, electron transport, structural genomics; 1.90A {Thermus thermophilus} PDB: 2cvk_A | Back alignment and structure |
|---|
| >3drn_A Peroxiredoxin, bacterioferritin comigratory prote homolog; bacterioferritin comigratory protein, oxidore; HET: CIT; 2.15A {Sulfolobus solfataricus} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >2i1u_A Thioredoxin, TRX, MPT46; redox protein, electron transport; 1.30A {Mycobacterium tuberculosis} PDB: 3nof_A 3o6t_A* 2l4q_A 2l59_A | Back alignment and structure |
|---|
| >1xvw_A Hypothetical protein RV2238C/MT2298; thioredoxin fold, oxidized cystein sulfenic acid, structural genomics, PSI; 1.90A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 1xxu_A | Back alignment and structure |
|---|
| >2cvb_A Probable thiol-disulfide isomerase/thioredoxin; redox protein, structural genomics, riken struc genomics/proteomics initiative, RSGI; 1.80A {Thermus thermophilus} SCOP: c.47.1.10 PDB: 2ywo_A | Back alignment and structure |
|---|
| >1fo5_A Thioredoxin; disulfide oxidoreductase, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; NMR {Methanocaldococcus jannaschii} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >3raz_A Thioredoxin-related protein; structural genomics, PSI-2, protein structure initiative; 2.00A {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >3gyk_A 27KDA outer membrane protein; APC61738.2, silicibacter pomeroyi DSS-3, thioredoxin-like, oxidoreductase, structural genomics, PSI-2; HET: MSE; 1.76A {Silicibacter pomeroyi} | Back alignment and structure |
|---|
| >2xc2_A Thioredoxinn; oxidoreductase, protein disulfide reductase; 1.56A {Schistosoma mansoni} PDB: 2xbq_A 2xbi_A | Back alignment and structure |
|---|
| >3d22_A TRXH4, thioredoxin H-type; electron transport, cytoplasm, redox-active center, transport, oxidoreductase; 1.60A {Populus trichocarpa x populusdeltoides} PDB: 3d21_A | Back alignment and structure |
|---|
| >1nho_A Probable thioredoxin; beta sheet, alpha helix, oxidoreductase; NMR {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >3gl3_A Putative thiol:disulfide interchange protein DSBE; oxidoreductase, PSI-II, structural genomics, protein structure initiative; 2.09A {Chlorobium tepidum tls} | Back alignment and structure |
|---|
| >3nzn_A Glutaredoxin; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics, rossmann fold; 1.10A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >2k8s_A Thioredoxin; dimer, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Nitrosomonas europaea} | Back alignment and structure |
|---|
| >3q18_A GSTO-2, glutathione S-transferase omega-2; glutathione transferase, dehydroascorbate reductase, reductase; 1.70A {Homo sapiens} PDB: 3q19_A* 3qag_A* | Back alignment and structure |
|---|
| >1faa_A Thioredoxin F; electron transport; 1.85A {Spinacia oleracea} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >3qfa_C Thioredoxin; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_C* | Back alignment and structure |
|---|
| >2l6c_A Thioredoxin; oxidoreductase; NMR {Desulfovibrio vulgaris} PDB: 2l6d_A | Back alignment and structure |
|---|
| >2k6v_A Putative cytochrome C oxidase assembly protein; thioredoxin fold, electron transfer protein, metal binding protein, electron transport; NMR {Thermus thermophilus} | Back alignment and structure |
|---|
| >3f3q_A Thioredoxin-1; His TAG, electron transport, cytoplasm, deoxyribonucleotide synthesis, golgi apparatus, membrane, nucleus; 1.76A {Saccharomyces cerevisiae} PDB: 3f3r_A* 2i9h_A 2fa4_A 2hsy_A 3pin_A 4dss_B | Back alignment and structure |
|---|
| >1jfu_A Thiol:disulfide interchange protein TLPA; thioredoxin-like, double disulfide bridge, membrane protein; 1.60A {Bradyrhizobium japonicum} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >2wul_A Glutaredoxin related protein 5; chromosome 14 open reading frame 87, oxidoreductase, thiored family, GLRX5, FLB4739; HET: GSH; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3kh7_A Thiol:disulfide interchange protein DSBE; TRX-like, thiol-disulfide exchange, cell inner membrane, CYT C-type biogenesis, disulfide bond; 1.75A {Pseudomonas aeruginosa} PDB: 3kh9_A | Back alignment and structure |
|---|
| >1i5g_A Tryparedoxin II; electron transport; HET: TS5; 1.40A {Crithidia fasciculata} SCOP: c.47.1.10 PDB: 1o6j_A 1o81_A 1oc8_A 1oc9_B 1fg4_A 1oc9_A | Back alignment and structure |
|---|
| >2j23_A Thioredoxin; immune protein, autoreactivity, cross-reactivity, IGE, fungi, epitope, allergen; 1.41A {Malassezia sympodialis} | Back alignment and structure |
|---|
| >3m9j_A Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} SCOP: c.47.1.1 PDB: 3m9k_A 2hsh_A 1erv_A 2ifq_A 2ifq_B 1auc_A 1eru_A 1ert_A 3kd0_A 1aiu_A 3trx_A 4trx_A 1trs_A 1tru_A 1trv_A 1trw_A 3e3e_A* 1cqg_A 1cqh_A 1mdi_A ... | Back alignment and structure |
|---|
| >3cxg_A Putative thioredoxin; malaria, structural GEN oxidoreductase, structural genomics consortium, SGC; 2.00A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1v98_A Thioredoxin; oxidoreductase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.82A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2o8v_B Thioredoxin 1; disulfide crosslinked complex, oxidoreductase; 3.00A {Escherichia coli} | Back alignment and structure |
|---|
| >2ppt_A Thioredoxin-2; thiredoxin, zinc finger, oxidoreductase; 1.92A {Rhodobacter capsulatus} | Back alignment and structure |
|---|
| >3gv1_A Disulfide interchange protein; neisseria gonorrhoeae (strain 700825 / FA 1090), DSBC, structural genomics, unknown funct 2; 2.00A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >1ttz_A Conserved hypothetical protein; structural genomics, unknown function, PSI, protein structure initiative; 2.11A {Xanthomonas campestris} SCOP: c.47.1.1 PDB: 1xpv_A | Back alignment and structure |
|---|
| >2ywi_A Hypothetical conserved protein; uncharacterized conserved protein, NPPSFA, national project protein structural and functional analyses; 1.60A {Geobacillus kaustophilus} | Back alignment and structure |
|---|
| >1eej_A Thiol:disulfide interchange protein; oxidoreductase, protein disulfide isomerase, protein folding, redox protein, redox-active center; HET: MES; 1.90A {Escherichia coli} SCOP: c.47.1.9 d.17.3.1 PDB: 1tjd_A 1jzd_A 1jzo_A 1g0t_A 2iyj_A | Back alignment and structure |
|---|
| >3uvt_A Thioredoxin domain-containing protein 5; thioredoxin-like fold, isomerase; 2.00A {Homo sapiens} PDB: 2diz_A 3uj1_A | Back alignment and structure |
|---|
| >1gh2_A Thioredoxin-like protein; redox-active center, electron transport; 2.22A {Homo sapiens} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >3eur_A Uncharacterized protein; PSI2,MCSG, conserved protein, structural genomics, protein S initiative, midwest center for structural genomics; HET: MSE; 1.30A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >4hi7_A GI20122; GST, glutathione S-transferase, enzyme function initiative, structural genomics, unknown function; HET: GSH; 1.25A {Drosophila mojavensis} | Back alignment and structure |
|---|
| >1v58_A Thiol:disulfide interchange protein DSBG; reduced DSBG, redox protein, protein disulfide isomerase, thioredoxin fold; 1.70A {Escherichia coli} SCOP: c.47.1.9 d.17.3.1 PDB: 1v57_A 2h0i_A 2h0h_A 2h0g_A 2iy2_A | Back alignment and structure |
|---|
| >3s9f_A Tryparedoxin; thioredoxin fold, disulfide reductase, electron transport; 1.80A {Leishmania major} | Back alignment and structure |
|---|
| >2voc_A Thioredoxin; electron transport, homodimer, disulfide, transport, redox-active center; 1.50A {Bacillus subtilis} PDB: 2ipa_A 2gzy_A 2gzz_A | Back alignment and structure |
|---|
| >3hd5_A Thiol:disulfide interchange protein DSBA; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.35A {Bordetella parapertussis} | Back alignment and structure |
|---|
| >2b1k_A Thiol:disulfide interchange protein DSBE; C-terminal thioredoxin-like domain, N-terminal beta-sheet, fingerprint rigion, oxidoreductase; 1.90A {Escherichia coli} PDB: 3k8n_A 2g0f_A 1z5y_E 2b1l_A | Back alignment and structure |
|---|
| >2vup_A Glutathione peroxidase-like protein; oxidoreductase, trypanothione, dithiol-dependant peroxidase; 2.10A {Trypanosoma brucei} | Back alignment and structure |
|---|
| >3ewl_A Uncharacterized conserved protein BF1870; alpha-beta fold, structural genomics, PSI-2, protein structu initiative; 2.00A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3vln_A GSTO-1, glutathione S-transferase omega-1; GST fold, reductase; HET: ASC; 1.70A {Homo sapiens} PDB: 1eem_A* 3lfl_A* | Back alignment and structure |
|---|
| >1t3b_A Thiol:disulfide interchange protein DSBC; oxidoreductase, protein disulfide isomerase, protein folding, redox protein; 2.50A {Haemophilus influenzae} SCOP: c.47.1.9 d.17.3.1 | Back alignment and structure |
|---|
| >1o8x_A Tryparedoxin, TRYX, TXNI; tryparedoxin-I, synchrotron radiation, disulfide bonds tryparedoxin, thioredoxin, trypanosome; 1.3A {Crithidia fasciculata} SCOP: c.47.1.10 PDB: 1okd_A 1qk8_A 1o85_A 1o8w_A 1o7u_A 1ezk_A 1ewx_A | Back alignment and structure |
|---|
| >3d6i_A Monothiol glutaredoxin-3; thioredoxin-like, electron transport, redox- active center, transport, oxidoreductase; HET: CME; 1.50A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1wjk_A C330018D20RIK protein; glutaredoxin, thioredoxin fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >3qav_A RHO-class glutathione S-transferase; cytosol; 2.10A {Laternula elliptica} PDB: 3qaw_A* | Back alignment and structure |
|---|
| >3hz8_A Thiol:disulfide interchange protein DSBA; thiol-oxidoreductase, disulfide bond; 1.45A {Neisseria meningitidis MC58} PDB: 3dvw_A 3a3t_A | Back alignment and structure |
|---|
| >1o73_A Tryparedoxin; electron transport, trypanosomatid, thioredoxin; 2.28A {Trypanosoma brucei brucei} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >3l9v_A Putative thiol-disulfide isomerase or thioredoxin; thioredoxin-fold, SRGA, thiol-disulfide oxidoreductase, ISOM oxidoreductase; HET: PE8 P4C P6G; 2.15A {Salmonella enterica subsp} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >3eyt_A Uncharacterized protein SPOA0173; thioredoxin-like superfamily protein SPOA0173, silicibacter DSS, structural genomics, PSI-2; 1.95A {Silicibacter pomeroyi} | Back alignment and structure |
|---|
| >3gnj_A Thioredoxin domain protein; APC92103, STR genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.99A {Desulfitobacterium hafniense dcb-2} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >2rem_A Disulfide oxidoreductase; disulfide oxidoreductase, DSBA, thioredoxin fold, redox- active center; 1.90A {Xylella fastidiosa} | Back alignment and structure |
|---|
| >2fgx_A Putative thioredoxin; NET3, NESG, GFT-glutaredoxin-like, structural genomics, PSI, protein structure initiative; NMR {Nitrosomonas europaea} | Back alignment and structure |
|---|
| >1psq_A Probable thiol peroxidase; structural genomics, NYSGXRC, PSI, structure initiative, NEW YORK SGX research center for STRU genomics; 2.30A {Streptococcus pneumoniae} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >2obi_A PHGPX, GPX-4, phospholipid hydroperoxide glutathione peroxidase (GPX4); human GPX4, selenoprotein, thioredoxin-fold, anti-oxidatve defense system; 1.55A {Homo sapiens} | Back alignment and structure |
|---|
| >3hcz_A Possible thiol-disulfide isomerase; APC61559.2, cytophaga hutchinsoni structural genomics, PSI-2, protein structure initiative; 1.88A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >3tdg_A DSBG, putative uncharacterized protein; thioredoxin fold, reductase, oxidoreductase; HET: P6G; 2.10A {Helicobacter pylori} | Back alignment and structure |
|---|
| >2imi_A Epsilon-class glutathione S-transferase; HET: GSH; 1.40A {Anopheles gambiae} PDB: 2il3_A* 2imk_A* | Back alignment and structure |
|---|
| >3ir4_A Glutaredoxin 2; glutathione, IDP00895, structural genomics, for structural genomics of infectious diseases, csgid, oxidoreductase; HET: MSE GSH; 1.20A {Salmonella enterica subsp} PDB: 1g7o_A | Back alignment and structure |
|---|
| >3p2a_A Thioredoxin 2, putative thioredoxin-like protein; structural genomics, center for structural genomics of infec diseases, csgid; 2.19A {Yersinia pestis} | Back alignment and structure |
|---|
| >3emx_A Thioredoxin; structural genomics, oxidoreductase, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.25A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >3rbt_A Glutathione transferase O1; glutathione S-transferase omega3; 2.20A {Bombyx mori} | Back alignment and structure |
|---|
| >3fz4_A Putative arsenate reductase; APC61768, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.38A {Streptococcus mutans UA159} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >3u5r_E Uncharacterized protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, hypothetical protein; 2.05A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3h93_A Thiol:disulfide interchange protein DSBA; disulfide bond, redox-active center, transcription regulator; HET: MSE GOL; 1.50A {Pseudomonas aeruginosa PAO1} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >2f51_A Thioredoxin; electron transport; 1.90A {Trichomonas vaginalis} | Back alignment and structure |
|---|
| >1x5e_A Thioredoxin domain containing protein 1; TMX, TXNDC1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3lor_A Thiol-disulfide isomerase and thioredoxins; PSI, MCSG, structural genomics, midwest CE structural genomics; HET: MSE; 2.20A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >2p31_A CL683, glutathione peroxidase 7; thioredoxin fold, NPGPX, phospholipid hydroperoxidase, struc genomics, structural genomics consortium, SGC; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2ju5_A Thioredoxin disulfide isomerase; protein, oxidoreductase; NMR {Chlamydophila pneumoniae} | Back alignment and structure |
|---|
| >3bby_A Uncharacterized GST-like protein YFCF; NP_416804.1, glutathione S-transferase, N-terminal domain, S genomics; 1.85A {Escherichia coli} | Back alignment and structure |
|---|
| >3fw2_A Thiol-disulfide oxidoreductase; structural genomics, APC61456.1, thiol-disulfide oxidoreduct TLPA-like family, PSI-2; 1.74A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >4euy_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; 2.90A {Bacillus cereus} | Back alignment and structure |
|---|
| >2p5q_A Glutathione peroxidase 5; thioredoxin fold, oxidoreductase; 2.00A {Populus trichocarpa x populusdeltoides} PDB: 2p5r_A | Back alignment and structure |
|---|
| >2gs3_A PHGPX, GPX-4, phospholipid hydroperoxide glutathione peroxidase; GSHPX-4,phospholipid hydroperoxide; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1r5a_A Glutathione transferase; glutathione S-transferase, GST, GSH, mosquito, detoxification, xenobiotics; HET: GTS; 2.50A {Anopheles cracens} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >3aps_A DNAJ homolog subfamily C member 10; thioredoxin fold, CXXC motif, endoplasmic reticulum, oxidore; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >4hz2_A Glutathione S-transferase domain; glutathione,enzyme function initiative; HET: GSH; 1.50A {Xanthobacter autotrophicus} | Back alignment and structure |
|---|
| >3l9s_A Thiol:disulfide interchange protein; thioredoxin-fold, DSBA, thiol-disulfide oxidoreductase, DISU bond, redox-active center; 1.58A {Salmonella enterica subsp} SCOP: c.47.1.13 PDB: 1a23_A 1a24_A 1a2j_A 1a2l_A 1a2m_A 1dsb_A 1fvk_A 3dks_A 1bq7_A 1fvj_A 1acv_A 1u3a_A* 1ti1_A* 2hi7_A* 2leg_A* 2zup_A* 3e9j_B* 1ac1_A 2b6m_A 2b3s_A | Back alignment and structure |
|---|
| >1gnw_A Glutathione S-transferase; herbicide detoxification; HET: GTX; 2.20A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 PDB: 1bx9_A* | Back alignment and structure |
|---|
| >1uul_A Tryparedoxin peroxidase homologue; peroxiredoxin, oxidoreductase; 2.8A {Trypanosoma cruzi} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >4hoj_A REGF protein; GST, glutathione S-transferase, enzyme function initiative, structural genomics, transferase; HET: GSH; 1.40A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >1z6m_A Conserved hypothetical protein; structural genomics, MCSG,, protein structure initiative, midwest center for structural genomics; HET: MSE; 1.30A {Enterococcus faecalis} SCOP: c.47.1.13 | Back alignment and structure |
|---|
| >3lwa_A Secreted thiol-disulfide isomerase; thioredoxin, PSI, MCSG, structural genomics, midwest center for structural genomics; 1.75A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >2jad_A Yellow fluorescent protein glutaredoxin fusion protein; electron transport, redox- active center, yeast, GRX1P, transport; HET: PIA; 2.7A {Aequorea victoria} | Back alignment and structure |
|---|
| >3cmi_A Peroxiredoxin HYR1; thioredoxin-like fold, oxidoreductase, peroxidase, redox-ACT center; 2.02A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2yj7_A LPBCA thioredoxin; oxidoreductase; 1.65A {Synthetic construct} | Back alignment and structure |
|---|
| >1ljr_A HGST T2-2, glutathione S-transferase; HET: GSH; 3.20A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 2ljr_A 3ljr_A* | Back alignment and structure |
|---|
| >4ags_A Thiol-dependent reductase 1; transferase, leishmaniasis, DE-gluathionylation; HET: MSE GSH; 2.30A {Leishmania infantum} | Back alignment and structure |
|---|
| >3ein_A GST class-theta, glutathione S-transferase 1-1; delta-class GST; HET: GSH; 1.13A {Drosophila melanogaster} PDB: 3mak_A* 3f6f_A 3gh6_A* 1jlv_A* | Back alignment and structure |
|---|
| >3kij_A Probable glutathione peroxidase 8; human PDI-peroxidase, membrane, oxidoreductase, transmembrane; 1.80A {Homo sapiens} SCOP: c.47.1.0 PDB: 3cyn_A | Back alignment and structure |
|---|
| >1axd_A Glutathione S-transferase I; transferase, herbicide detoxification, transferase-transfera inhibitor complex; HET: GGL CYW; 2.50A {Zea mays} SCOP: a.45.1.1 c.47.1.5 PDB: 1bye_A* | Back alignment and structure |
|---|
| >3m3m_A Glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, N SGX research center for structural genomics; HET: GSH; 1.75A {Pseudomonas fluorescens} | Back alignment and structure |
|---|
| >2hnl_A Glutathione S-transferase 1; prostaglandin synthase, river BLI onchocerca volvulus, immune modulation; HET: GSH; 2.00A {Onchocerca volvulus} | Back alignment and structure |
|---|
| >1a8l_A Protein disulfide oxidoreductase; PDI, thioredoxin fold; 1.90A {Pyrococcus furiosus} SCOP: c.47.1.2 c.47.1.2 PDB: 1j08_A | Back alignment and structure |
|---|
| >2dj3_A Protein disulfide-isomerase A4; protein ERP-72, ERP72, CAI, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3lyk_A Stringent starvation protein A homolog; structural genomics, GST-superfamily, SSPA, PSI-2, protein structure initiative; 2.10A {Haemophilus influenzae} | Back alignment and structure |
|---|
| >1xvq_A Thiol peroxidase; thioredoxin fold, structural genomics, PSI, protein structur initiative, TB structural genomics consortium, TBSGC; 1.75A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 1y25_A | Back alignment and structure |
|---|
| >3l78_A Regulatory protein SPX; transcription, transcriptional factor, disulfide bond, redox-active center, transcription regulati; 1.90A {Streptococcus mutans} SCOP: c.47.1.12 | Back alignment and structure |
|---|
| >2v6k_A Maleylpyruvate isomerase; glutathione-S-transferase, GST, plasmid, bacterial, biodegradation, fumaryl pyruvate; HET: TGG; 1.3A {Ralstonia SP} PDB: 2jl4_A* | Back alignment and structure |
|---|
| >3ay8_A Glutathione S-transferase; GST fold, GST binding, cytosolic; 2.10A {Bombyx mori} | Back alignment and structure |
|---|
| >1v2a_A Glutathione transferase GST1-6; glutathione S-transferase, detoxification, xenobiotics; HET: GTS; 2.15A {Anopheles dirus} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >2rli_A SCO2 protein homolog, mitochondrial; copper protein, thioredoxin fold, metal transport, structural genomics, spine2-complexes; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x5d_A Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC7, thioredoxin like domain, redox, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3gha_A Disulfide bond formation protein D; BDBD, DSBA-like, TRX-like, oxidoreductase, competence, redox-active center; 1.40A {Bacillus subtilis} PDB: 3eu4_A 3gh9_A 3eu3_A | Back alignment and structure |
|---|
| >3ul3_B Thioredoxin, thioredoxin-2; PTEX, oxidoreductase; 2.90A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1we0_A Alkyl hydroperoxide reductase C; peroxiredoxin, AHPC, oxidoreductase; 2.90A {Amphibacillus xylanus} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >1e6b_A Glutathione S-transferase; 1.65A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >3hz4_A Thioredoxin; NYSGXRC, PSI-II, reduced form, protein structure initiative, structural genomics; 2.30A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >1xzo_A BSSCO, hypothetical protein YPMQ; thioredoxin-like fold, structural genomics, montreal-kingsto bacterial structural genomics initiative, BSGI; 1.70A {Bacillus subtilis} SCOP: c.47.1.10 PDB: 1on4_A | Back alignment and structure |
|---|
| >1k0d_A URE2 protein; nitrate assimilation, structural genomics, gene regulation; HET: GSH; 2.20A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5 PDB: 1jzr_A* 1k0b_A* 1k0c_A* 1k0a_A* 1g6w_A 1g6y_A 1hqo_A | Back alignment and structure |
|---|
| >4iel_A Glutathione S-transferase, N-terminal domain PROT; GST, glutathione S-transferase, enzyme function initiative, structural genomics; HET: GSH; 1.60A {Burkholderia ambifaria} | Back alignment and structure |
|---|
| >4dvc_A Thiol:disulfide interchange protein DSBA; pilus assembly, oxidoreductase, thioredoxin fold, D disulfide bond, DSBB; HET: DMS; 1.20A {Vibrio cholerae} PDB: 2ijy_A 1bed_A | Back alignment and structure |
|---|
| >4id0_A Glutathione S-transferase-like protein YIBF; GST, enzyme function initiative, structural genomics; HET: GSF; 1.10A {Pseudomonas fluorescens} PDB: 4ibp_A* | Back alignment and structure |
|---|
| >3vk9_A Glutathione S-transferase delta; glutathione binding; 2.00A {Bombyx mori} | Back alignment and structure |
|---|
| >3kp8_A Vkorc1/thioredoxin domain protein; blood coagulation, disulfide formation, redox partner, oxidoreductase; 1.66A {Synechococcus SP} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 206 | |||
| d1ktea_ | 105 | Glutaredoxin (Grx, thioltransferase) {Pig (Sus scr | 94.54 | |
| d1g7oa2 | 75 | Glutaredoxin 2 {Escherichia coli [TaxId: 562]} | 94.45 | |
| d1gwca2 | 83 | Class tau GST {Aegilops tauschii, also known as Tr | 93.65 | |
| d1e6ba2 | 80 | Class zeta GST {Mouse-ear cress (Arabidopsis thali | 93.61 | |
| d1k0ma2 | 86 | Chloride intracellular channel 1 (clic1) {Human (H | 93.33 | |
| d1t3ba1 | 150 | Disulfide bond isomerase, DsbC, C-terminal domain | 93.04 | |
| d1eema2 | 98 | Class omega GST {Human (Homo sapiens) [TaxId: 9606 | 92.96 | |
| d1eeja1 | 156 | Disulfide bond isomerase, DsbC, C-terminal domain | 92.7 | |
| d1ljra2 | 79 | Class theta GST {Human (Homo sapiens) [TaxId: 9606 | 92.49 | |
| d1v2aa2 | 83 | Class delta GST {Mosquito (Anopheles dirus b), iso | 92.06 | |
| d1v58a1 | 169 | Thiol:disulfide interchange protein DsbG, C-termin | 91.86 | |
| d1hyua4 | 96 | Alkyl hydroperoxide reductase subunit F (AhpF), N- | 91.86 | |
| d1fova_ | 82 | Glutaredoxin (Grx, thioltransferase) {Escherichia | 91.38 | |
| d1k0da2 | 92 | Yeast prion protein ure2p, nitrogen regulation fra | 91.33 | |
| d1nm3a1 | 74 | C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus | 91.1 | |
| d1r5aa2 | 85 | Class delta GST {Mosquito (Anopheles dirus b), iso | 90.42 | |
| d1h75a_ | 76 | Glutaredoxin-like NRDH-redoxin {Escherichia coli [ | 90.16 | |
| d1r7ha_ | 74 | Glutaredoxin-like NRDH-redoxin {Corynebacterium am | 89.49 | |
| d1axda2 | 80 | Class phi GST {Maize (Zea mays), type I [TaxId: 45 | 89.3 | |
| d1wika_ | 109 | Thioredoxin-like protein 2 {Mouse (Mus musculus) [ | 88.26 | |
| d1wjka_ | 100 | Thioredoxin-like structure containing protein C330 | 88.09 | |
| d1abaa_ | 87 | Glutaredoxin (Grx, thioltransferase) {Bacteriophag | 87.3 | |
| d1jlva2 | 84 | Class delta GST {Mosquito (Anopheles dirus b), iso | 86.56 | |
| d1gnwa2 | 84 | Class phi GST {Mouse-ear cress (Arabidopsis thalia | 86.46 | |
| d1fw1a2 | 83 | Class zeta GST {Human (Homo sapiens) [TaxId: 9606] | 86.03 | |
| d1oyja2 | 84 | Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} | 85.98 | |
| d1aw9a2 | 81 | Class phi GST {Maize (Zea mays), type III [TaxId: | 85.43 | |
| d1z9ha2 | 113 | Microsomal prostaglandin E synthase-2 {Crab-eating | 85.03 | |
| d2djja1 | 116 | Protein disulfide isomerase, PDI {Fungi (Humicola | 83.69 | |
| d2cvba1 | 187 | Probable thiol-disulfide isomerase/thioredoxin TTH | 82.6 | |
| d1gh2a_ | 107 | Thioredoxin-like protein, N-terminal domain {Human | 82.16 | |
| d1beda_ | 181 | Disulfide-bond formation facilitator (DsbA) {Vibri | 82.13 | |
| d1zzoa1 | 134 | Lipoprotein DsbF {Mycobacterium tuberculosis [TaxI | 82.1 | |
| d1qxha_ | 164 | Thiol peroxidase Tpx {Escherichia coli [TaxId: 562 | 81.84 | |
| d1egoa_ | 85 | Glutaredoxin (Grx, thioltransferase) {Escherichia | 80.78 |
| >d1ktea_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Thioredoxin fold superfamily: Thioredoxin-like family: Thioltransferase domain: Glutaredoxin (Grx, thioltransferase) species: Pig (Sus scrofa) [TaxId: 9823]
Probab=94.54 E-value=0.047 Score=38.26 Aligned_cols=81 Identities=15% Similarity=0.285 Sum_probs=50.2
Q ss_pred CCCceEEEEcCCChhhHHHHHHHHhhcccCCCEEEEeCCChhh-hHHHhCCCChhcccceEEEEEeCCeEEehHHHHHHH
Q 028608 80 ENWKIKMLYDGDCPLCMREVNMLKERNKQYGTIKFVDISSDEY-SIEENQGLDYKTVMGSIHAIVSDGTVVTDVEAFRRL 158 (206)
Q Consensus 80 ~~~~l~VlYDG~CplC~~~v~~L~r~d~~~~~I~fvdi~s~~~-~~l~~~gld~e~~~~~lhvv~~dG~v~~G~dA~~~i 158 (206)
++.+++||-=..||+|.+..++|.+.......+.+.++..... ...+. .+....-...+-.+--+|+.+.|.+-+..+
T Consensus 10 ~~~~Vviysk~~Cp~C~~ak~ll~~~~~~~~~~~~~e~d~~~d~~~~~~-~l~~~~g~~tvPqIfi~g~~IGG~~el~~l 88 (105)
T d1ktea_ 10 QPGKVVVFIKPTCPFCRKTQELLSQLPFKEGLLEFVDITATSDTNEIQD-YLQQLTGARTVPRVFIGKECIGGCTDLESM 88 (105)
T ss_dssp CTTCEEEEECSSCHHHHHHHHHHHHSCBCTTSEEEEEGGGSTTHHHHHH-HHHHHHSCCCSCEEEETTEEEESHHHHHHH
T ss_pred ccCCEEEEECCCCchHHHHHHHHHHhCCccceeeeeecccccccHHHHH-HHhhccCCCcCcEEEECCEEEecHHHHHHH
Confidence 4567899999999999999999988764445677877643221 11110 000000011222334599999999987776
Q ss_pred HHH
Q 028608 159 YEE 161 (206)
Q Consensus 159 l~~ 161 (206)
...
T Consensus 89 ~~~ 91 (105)
T d1ktea_ 89 HKR 91 (105)
T ss_dssp HHH
T ss_pred HHC
Confidence 554
|
| >d1g7oa2 c.47.1.5 (A:1-75) Glutaredoxin 2 {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gwca2 c.47.1.5 (A:4-86) Class tau GST {Aegilops tauschii, also known as Triticum tauschii [TaxId: 37682]} | Back information, alignment and structure |
|---|
| >d1e6ba2 c.47.1.5 (A:8-87) Class zeta GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1k0ma2 c.47.1.5 (A:6-91) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t3ba1 c.47.1.9 (A:61-210) Disulfide bond isomerase, DsbC, C-terminal domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1eema2 c.47.1.5 (A:5-102) Class omega GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1eeja1 c.47.1.9 (A:61-216) Disulfide bond isomerase, DsbC, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ljra2 c.47.1.5 (A:1-79) Class theta GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v2aa2 c.47.1.5 (A:1-83) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-6 [TaxId: 123217]} | Back information, alignment and structure |
|---|
| >d1v58a1 c.47.1.9 (A:62-230) Thiol:disulfide interchange protein DsbG, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1hyua4 c.47.1.2 (A:103-198) Alkyl hydroperoxide reductase subunit F (AhpF), N-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1fova_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli, Grx3 [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1k0da2 c.47.1.5 (A:109-200) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1nm3a1 c.47.1.1 (A:166-239) C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1r5aa2 c.47.1.5 (A:2-86) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-5 [TaxId: 123217]} | Back information, alignment and structure |
|---|
| >d1h75a_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1r7ha_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Corynebacterium ammoniagenes [TaxId: 1697]} | Back information, alignment and structure |
|---|
| >d1axda2 c.47.1.5 (A:1-80) Class phi GST {Maize (Zea mays), type I [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1wika_ c.47.1.1 (A:) Thioredoxin-like protein 2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wjka_ c.47.1.1 (A:) Thioredoxin-like structure containing protein C330018D20Rik {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1abaa_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1jlva2 c.47.1.5 (A:1-84) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-3 [TaxId: 123217]} | Back information, alignment and structure |
|---|
| >d1gnwa2 c.47.1.5 (A:2-85) Class phi GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1fw1a2 c.47.1.5 (A:5-87) Class zeta GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oyja2 c.47.1.5 (A:2-85) Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
| >d1aw9a2 c.47.1.5 (A:2-82) Class phi GST {Maize (Zea mays), type III [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1z9ha2 c.47.1.5 (A:100-212) Microsomal prostaglandin E synthase-2 {Crab-eating macaque (Macaca fascicularis) [TaxId: 9541]} | Back information, alignment and structure |
|---|
| >d2djja1 c.47.1.2 (A:6-121) Protein disulfide isomerase, PDI {Fungi (Humicola insolens) [TaxId: 34413]} | Back information, alignment and structure |
|---|
| >d2cvba1 c.47.1.10 (A:2-188) Probable thiol-disulfide isomerase/thioredoxin TTHA0593 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1gh2a_ c.47.1.1 (A:) Thioredoxin-like protein, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1beda_ c.47.1.13 (A:) Disulfide-bond formation facilitator (DsbA) {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1zzoa1 c.47.1.10 (A:45-178) Lipoprotein DsbF {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1qxha_ c.47.1.10 (A:) Thiol peroxidase Tpx {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1egoa_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|