Citrus Sinensis ID: 028621
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 206 | ||||||
| 449461831 | 341 | PREDICTED: uridylate kinase-like [Cucumi | 0.985 | 0.595 | 0.916 | 1e-105 | |
| 356512819 | 331 | PREDICTED: uridylate kinase-like [Glycin | 0.980 | 0.610 | 0.915 | 1e-105 | |
| 15230160 | 339 | uridylate kinase [Arabidopsis thaliana] | 0.980 | 0.595 | 0.920 | 1e-105 | |
| 297830522 | 334 | aspartate/glutamate/uridylate kinase fam | 0.980 | 0.604 | 0.920 | 1e-105 | |
| 356525588 | 325 | PREDICTED: uridylate kinase-like [Glycin | 0.975 | 0.618 | 0.910 | 1e-105 | |
| 255552374 | 328 | Uridylate kinase, putative [Ricinus comm | 0.980 | 0.615 | 0.920 | 1e-104 | |
| 217074196 | 324 | unknown [Medicago truncatula] | 0.970 | 0.617 | 0.915 | 1e-104 | |
| 224131186 | 250 | predicted protein [Populus trichocarpa] | 0.985 | 0.812 | 0.916 | 1e-104 | |
| 255637835 | 325 | unknown [Glycine max] | 0.975 | 0.618 | 0.890 | 1e-102 | |
| 357519905 | 321 | Uridylate kinase [Medicago truncatula] g | 0.941 | 0.604 | 0.917 | 1e-101 |
| >gi|449461831|ref|XP_004148645.1| PREDICTED: uridylate kinase-like [Cucumis sativus] gi|449507502|ref|XP_004163050.1| PREDICTED: uridylate kinase-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
Score = 386 bits (992), Expect = e-105, Method: Compositional matrix adjust.
Identities = 186/203 (91%), Positives = 196/203 (96%)
Query: 2 FQVAIVVGGGNIFRGASAAGNSGLDRSSADYIGMLATVMNAIFLQATMESIGIPTRVQTA 61
+VAIVVGGGNIFRG+S AG+SGLDRSSADYIGMLATVMNAIFLQATMESIGIPTRVQTA
Sbjct: 139 IEVAIVVGGGNIFRGSSWAGSSGLDRSSADYIGMLATVMNAIFLQATMESIGIPTRVQTA 198
Query: 62 FRMSEVAEPYIRRRAVRHLEKGRVVIFAAGTGNPFFTTDTAAALRCAEINAEVVLKATNV 121
FRMSEVAEPYIRRRAVRHLEKGRVVIFAAGTGNPFFTTDTAAALRCAEINAEV+LKATNV
Sbjct: 199 FRMSEVAEPYIRRRAVRHLEKGRVVIFAAGTGNPFFTTDTAAALRCAEINAEVLLKATNV 258
Query: 122 DGVYDDNPRRNPNARLLDTLTYQEVTSKDLSVMDMTAITLCQENNIPVVVFNLNQPGNIA 181
DGVYDD+PR+NPNARLL+TLTYQEVTSKDLSVMDMTAITLCQENNIPVVVFNL +P NI
Sbjct: 259 DGVYDDDPRQNPNARLLETLTYQEVTSKDLSVMDMTAITLCQENNIPVVVFNLTKPDNIT 318
Query: 182 KAIQGERVGTLIGGTWNSTVSKT 204
KAI+GERVGTLIGGTWNS V+ T
Sbjct: 319 KAIKGERVGTLIGGTWNSMVAST 341
|
Source: Cucumis sativus Species: Cucumis sativus Genus: Cucumis Family: Cucurbitaceae Order: Cucurbitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|356512819|ref|XP_003525113.1| PREDICTED: uridylate kinase-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|15230160|ref|NP_188498.1| uridylate kinase [Arabidopsis thaliana] gi|9293891|dbj|BAB01794.1| unnamed protein product [Arabidopsis thaliana] gi|15292789|gb|AAK92763.1| putative uridylate kinase [Arabidopsis thaliana] gi|20258857|gb|AAM14100.1| putative uridylate kinase [Arabidopsis thaliana] gi|332642610|gb|AEE76131.1| uridylate kinase [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|297830522|ref|XP_002883143.1| aspartate/glutamate/uridylate kinase family protein [Arabidopsis lyrata subsp. lyrata] gi|297830524|ref|XP_002883144.1| aspartate/glutamate/uridylate kinase family protein [Arabidopsis lyrata subsp. lyrata] gi|297328983|gb|EFH59402.1| aspartate/glutamate/uridylate kinase family protein [Arabidopsis lyrata subsp. lyrata] gi|297328984|gb|EFH59403.1| aspartate/glutamate/uridylate kinase family protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|356525588|ref|XP_003531406.1| PREDICTED: uridylate kinase-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|255552374|ref|XP_002517231.1| Uridylate kinase, putative [Ricinus communis] gi|223543602|gb|EEF45131.1| Uridylate kinase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|217074196|gb|ACJ85458.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|224131186|ref|XP_002328476.1| predicted protein [Populus trichocarpa] gi|222838191|gb|EEE76556.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|255637835|gb|ACU19237.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|357519905|ref|XP_003630241.1| Uridylate kinase [Medicago truncatula] gi|355524263|gb|AET04717.1| Uridylate kinase [Medicago truncatula] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 206 | ||||||
| TAIR|locus:2093949 | 339 | AT3G18680 [Arabidopsis thalian | 0.980 | 0.595 | 0.920 | 2.6e-95 | |
| TIGR_CMR|CHY_1785 | 242 | CHY_1785 "uridylate kinase" [C | 0.932 | 0.793 | 0.642 | 1.8e-64 | |
| TIGR_CMR|GSU_1919 | 239 | GSU_1919 "uridylate kinase" [G | 0.932 | 0.803 | 0.590 | 2.4e-60 | |
| TIGR_CMR|BA_3963 | 240 | BA_3963 "uridylate kinase" [Ba | 0.932 | 0.8 | 0.592 | 1.7e-57 | |
| TIGR_CMR|DET_0375 | 241 | DET_0375 "uridylate kinase" [D | 0.922 | 0.788 | 0.588 | 7.8e-55 | |
| UNIPROTKB|P65929 | 261 | pyrH "Uridylate kinase" [Mycob | 0.922 | 0.727 | 0.560 | 3e-53 | |
| TIGR_CMR|ECH_0266 | 244 | ECH_0266 "uridylate kinase" [E | 0.927 | 0.782 | 0.534 | 1.3e-52 | |
| TIGR_CMR|CBU_1384 | 243 | CBU_1384 "uridylate kinase" [C | 0.922 | 0.781 | 0.534 | 5.6e-52 | |
| TIGR_CMR|SPO_1662 | 251 | SPO_1662 "uridylate kinase" [R | 0.932 | 0.764 | 0.546 | 4e-51 | |
| TIGR_CMR|CJE_1410 | 239 | CJE_1410 "uridylate kinase" [C | 0.898 | 0.774 | 0.551 | 1.3e-50 |
| TAIR|locus:2093949 AT3G18680 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 948 (338.8 bits), Expect = 2.6e-95, P = 2.6e-95
Identities = 186/202 (92%), Positives = 198/202 (98%)
Query: 3 QVAIVVGGGNIFRGASAAGNSGLDRSSADYIGMLATVMNAIFLQATMESIGIPTRVQTAF 62
+VAIVVGGGNIFRG++ AG SGLDRSSADYIGMLATVMNAIFLQATMESIGIPTRVQTAF
Sbjct: 137 EVAIVVGGGNIFRGSTWAGCSGLDRSSADYIGMLATVMNAIFLQATMESIGIPTRVQTAF 196
Query: 63 RMSEVAEPYIRRRAVRHLEKGRVVIFAAGTGNPFFTTDTAAALRCAEINAEVVLKATNVD 122
RMSEVAEPYIRRRA+RHLEKGRVVIFAAGTGNPFFTTDTAAALRCAEINAEVVLKATNVD
Sbjct: 197 RMSEVAEPYIRRRAIRHLEKGRVVIFAAGTGNPFFTTDTAAALRCAEINAEVVLKATNVD 256
Query: 123 GVYDDNPRRNPNARLLDTLTYQEVTSKDLSVMDMTAITLCQENNIPVVVFNLNQPGNIAK 182
GV+DD+P+RNPNARLLD+LTYQEVTSKDLSVMDMTAITLCQENNIPVVVFNL++PGNIAK
Sbjct: 257 GVFDDDPKRNPNARLLDSLTYQEVTSKDLSVMDMTAITLCQENNIPVVVFNLSEPGNIAK 316
Query: 183 AIQGERVGTLIGGTWNSTVSKT 204
AI+GERVGTLIGGTWNS V+ T
Sbjct: 317 AIKGERVGTLIGGTWNSIVTTT 338
|
|
| TIGR_CMR|CHY_1785 CHY_1785 "uridylate kinase" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|GSU_1919 GSU_1919 "uridylate kinase" [Geobacter sulfurreducens PCA (taxid:243231)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|BA_3963 BA_3963 "uridylate kinase" [Bacillus anthracis str. Ames (taxid:198094)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|DET_0375 DET_0375 "uridylate kinase" [Dehalococcoides ethenogenes 195 (taxid:243164)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P65929 pyrH "Uridylate kinase" [Mycobacterium tuberculosis (taxid:1773)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|ECH_0266 ECH_0266 "uridylate kinase" [Ehrlichia chaffeensis str. Arkansas (taxid:205920)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CBU_1384 CBU_1384 "uridylate kinase" [Coxiella burnetii RSA 493 (taxid:227377)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|SPO_1662 SPO_1662 "uridylate kinase" [Ruegeria pomeroyi DSS-3 (taxid:246200)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CJE_1410 CJE_1410 "uridylate kinase" [Campylobacter jejuni RM1221 (taxid:195099)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| AT3G18680 | aspartate/glutamate/uridylate kinase family protein; aspartate/glutamate/uridylate kinase family protein; FUNCTIONS IN- uridylate kinase activity, UMP kinase activity; INVOLVED IN- amino acid biosynthetic process, 'de novo' pyrimidine base biosynthetic process, pyrimidine nucleotide biosynthetic process; LOCATED IN- chloroplast; EXPRESSED IN- 23 plant structures; EXPRESSED DURING- 13 growth stages; CONTAINS InterPro DOMAIN/s- Aspartate/glutamate/uridylate kinase (InterPro-IPR001048), Uridylate kinase, bacteria (InterPro-IPR015963); BEST Arabidopsis thaliana protein match is- aspartate/ [...] (339 aa) | ||||||||||
(Arabidopsis thaliana) | |||||||||||
| AT3G53900 | • | • | • | 0.996 | |||||||
| RRF | • | • | • | 0.993 | |||||||
| NDPK2 | • | • | • | 0.988 | |||||||
| AT3G54470 | • | • | • | 0.985 | |||||||
| RIF10 | • | • | • | • | 0.981 | ||||||
| NDPK1 | • | • | • | 0.979 | |||||||
| AT4G11120 | • | • | • | • | 0.974 | ||||||
| AT3G13120 | • | • | • | • | 0.962 | ||||||
| NDPK3 | • | • | 0.960 | ||||||||
| AT1G17410 | • | • | 0.960 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 206 | |||
| cd04254 | 231 | cd04254, AAK_UMPK-PyrH-Ec, UMP kinase (UMPK)-Ec, t | 1e-127 | |
| PRK00358 | 231 | PRK00358, pyrH, uridylate kinase; Provisional | 1e-122 | |
| cd04239 | 229 | cd04239, AAK_UMPK-like, AAK_UMPK-like: UMP kinase | 1e-112 | |
| TIGR02075 | 232 | TIGR02075, pyrH_bact, uridylate kinase | 1e-105 | |
| COG0528 | 238 | COG0528, PyrH, Uridylate kinase [Nucleotide transp | 1e-104 | |
| PRK14558 | 231 | PRK14558, pyrH, uridylate kinase; Provisional | 3e-65 | |
| PRK14557 | 247 | PRK14557, pyrH, uridylate kinase; Provisional | 1e-56 | |
| PRK14556 | 249 | PRK14556, pyrH, uridylate kinase; Provisional | 2e-48 | |
| cd04253 | 221 | cd04253, AAK_UMPK-PyrH-Pf, AAK_UMPK-PyrH-Pf: UMP k | 2e-35 | |
| TIGR02076 | 221 | TIGR02076, pyrH_arch, uridylate kinase, putative | 5e-33 | |
| cd02115 | 248 | cd02115, AAK, Amino Acid Kinases (AAK) superfamily | 3e-26 | |
| pfam00696 | 230 | pfam00696, AA_kinase, Amino acid kinase family | 4e-24 | |
| COG0527 | 447 | COG0527, LysC, Aspartokinases [Amino acid transpor | 3e-13 | |
| cd04242 | 251 | cd04242, AAK_G5K_ProB, AAK_G5K_ProB: Glutamate-5-k | 1e-12 | |
| cd04255 | 262 | cd04255, AAK_UMPK-MosAB, AAK_UMPK-MosAB: This CD i | 1e-12 | |
| TIGR00657 | 441 | TIGR00657, asp_kinases, aspartate kinase | 3e-12 | |
| cd04234 | 227 | cd04234, AAK_AK, AAK_AK: Amino Acid Kinase Superfa | 6e-12 | |
| COG1608 | 252 | COG1608, COG1608, Predicted archaeal kinase [Gener | 1e-11 | |
| COG0263 | 369 | COG0263, ProB, Glutamate 5-kinase [Amino acid tran | 2e-10 | |
| cd04241 | 252 | cd04241, AAK_FomA-like, AAK_FomA-like: This CD inc | 4e-10 | |
| TIGR01027 | 363 | TIGR01027, proB, glutamate 5-kinase | 1e-09 | |
| cd04246 | 239 | cd04246, AAK_AK-DapG-like, AAK_AK-DapG-like: Amino | 1e-09 | |
| PRK08210 | 403 | PRK08210, PRK08210, aspartate kinase I; Reviewed | 3e-09 | |
| PRK05429 | 372 | PRK05429, PRK05429, gamma-glutamyl kinase; Provisi | 3e-09 | |
| cd04260 | 244 | cd04260, AAK_AKi-DapG-BS, AAK_AKi-DapG-BS: Amino A | 5e-09 | |
| cd04256 | 284 | cd04256, AAK_P5CS_ProBA, AAK_P5CS_ProBA: Glutamate | 8e-09 | |
| cd04259 | 295 | cd04259, AAK_AK-DapDC, AAK_AK-DapDC: Amino Acid Ki | 1e-08 | |
| PRK09436 | 819 | PRK09436, thrA, bifunctional aspartokinase I/homos | 3e-08 | |
| PRK06291 | 465 | PRK06291, PRK06291, aspartate kinase; Provisional | 3e-08 | |
| cd04261 | 239 | cd04261, AAK_AKii-LysC-BS, AAK_AKii-LysC-BS: Amino | 4e-08 | |
| cd04243 | 293 | cd04243, AAK_AK-HSDH-like, AAK_AK-HSDH-like: Amino | 5e-08 | |
| cd04257 | 294 | cd04257, AAK_AK-HSDH, AAK_AK-HSDH: Amino Acid Kina | 5e-08 | |
| PRK08961 | 861 | PRK08961, PRK08961, bifunctional aspartate kinase/ | 7e-08 | |
| cd04244 | 298 | cd04244, AAK_AK-LysC-like, AAK_AK-LysC-like: Amino | 8e-08 | |
| PRK12314 | 266 | PRK12314, PRK12314, gamma-glutamyl kinase; Provisi | 2e-07 | |
| TIGR01092 | 715 | TIGR01092, P5CS, delta l-pyrroline-5-carboxylate s | 1e-06 | |
| PLN02418 | 718 | PLN02418, PLN02418, delta-1-pyrroline-5-carboxylat | 2e-06 | |
| TIGR00656 | 401 | TIGR00656, asp_kin_monofn, aspartate kinase, monof | 5e-06 | |
| COG2054 | 212 | COG2054, COG2054, Uncharacterized archaeal kinase | 6e-06 | |
| PRK07431 | 587 | PRK07431, PRK07431, aspartate kinase; Provisional | 2e-05 | |
| PRK13402 | 368 | PRK13402, PRK13402, gamma-glutamyl kinase; Provisi | 2e-05 | |
| PRK08373 | 341 | PRK08373, PRK08373, aspartate kinase; Validated | 5e-05 | |
| PRK08841 | 392 | PRK08841, PRK08841, aspartate kinase; Validated | 5e-05 | |
| PRK06635 | 404 | PRK06635, PRK06635, aspartate kinase; Reviewed | 5e-05 | |
| cd04240 | 203 | cd04240, AAK_UC, AAK_UC: Uncharacterized (UC) amin | 2e-04 | |
| cd04245 | 288 | cd04245, AAK_AKiii-YclM-BS, AAK_AKiii-YclM-BS: Ami | 2e-04 | |
| cd04249 | 252 | cd04249, AAK_NAGK-NC, AAK_NAGK-NC: N-Acetyl-L-glut | 5e-04 | |
| TIGR02078 | 327 | TIGR02078, AspKin_pair, Pyrococcus aspartate kinas | 0.001 | |
| cd04258 | 292 | cd04258, AAK_AKiii-LysC-EC, AAK_AKiii-LysC-EC: Ami | 0.002 | |
| PRK09084 | 448 | PRK09084, PRK09084, aspartate kinase III; Validate | 0.003 |
| >gnl|CDD|239787 cd04254, AAK_UMPK-PyrH-Ec, UMP kinase (UMPK)-Ec, the microbial/chloroplast uridine monophosphate kinase (uridylate kinase) enzyme that catalyzes UMP phosphorylation and plays a key role in pyrimidine nucleotide biosynthesis; regulation of this process is via feed-back control and via gene repression of carbamoyl phosphate synthetase (the first enzyme of the pyrimidine biosynthesis pathway) | Back alignment and domain information |
|---|
Score = 357 bits (919), Expect = e-127
Identities = 136/192 (70%), Positives = 163/192 (84%), Gaps = 1/192 (0%)
Query: 3 QVAIVVGGGNIFRGASAAGNSGLDRSSADYIGMLATVMNAIFLQATMESIGIPTRVQTAF 62
+VAIVVGGGNIFRGASAA G+DR++ADY+GMLATV+NA+ LQ +ES+G+ TRV +A
Sbjct: 41 EVAIVVGGGNIFRGASAAEA-GMDRATADYMGMLATVINALALQDALESLGVKTRVMSAI 99
Query: 63 RMSEVAEPYIRRRAVRHLEKGRVVIFAAGTGNPFFTTDTAAALRCAEINAEVVLKATNVD 122
M VAEPYIRRRA+RHLEKGRVVIFA GTGNPFFTTDTAAALR EINA+V+LKAT VD
Sbjct: 100 PMQGVAEPYIRRRAIRHLEKGRVVIFAGGTGNPFFTTDTAAALRAIEINADVILKATKVD 159
Query: 123 GVYDDNPRRNPNARLLDTLTYQEVTSKDLSVMDMTAITLCQENNIPVVVFNLNQPGNIAK 182
GVYD +P++NPNA+ D LTY EV SK L VMD TA TLC++NN+P+VVFN+N+PGN+ K
Sbjct: 160 GVYDADPKKNPNAKRYDHLTYDEVLSKGLKVMDATAFTLCRDNNLPIVVFNINEPGNLLK 219
Query: 183 AIQGERVGTLIG 194
A++GE VGTLI
Sbjct: 220 AVKGEGVGTLIS 231
|
The UMP kinase of E. coli (Ec) is known to function as a homohexamer, with GTP and UTP being allosteric effectors. Like other related enzymes (carbamate kinase, aspartokinase, and N-acetylglutamate kinase) the E. coli and most bacterial and chloroplast UMPKs (this CD) have a conserved, N-terminal, lysine residue proposed to function in the catalysis of the phosphoryl group transfer, whereas most archaeal UMPKs appear to lack this residue and the Pyrococcus furiosus structure has an additional Mg ion bound to the ATP molecule which is proposed to function as the catalysis instead. Members of this CD belong to the Amino Acid Kinase Superfamily (AAK). Length = 231 |
| >gnl|CDD|234735 PRK00358, pyrH, uridylate kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|239772 cd04239, AAK_UMPK-like, AAK_UMPK-like: UMP kinase (UMPK)-like, the microbial/chloroplast uridine monophosphate kinase (uridylate kinase) enzyme that catalyzes UMP phosphorylation and plays a key role in pyrimidine nucleotide biosynthesis | Back alignment and domain information |
|---|
| >gnl|CDD|213681 TIGR02075, pyrH_bact, uridylate kinase | Back alignment and domain information |
|---|
| >gnl|CDD|223602 COG0528, PyrH, Uridylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|173023 PRK14558, pyrH, uridylate kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173022 PRK14557, pyrH, uridylate kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173021 PRK14556, pyrH, uridylate kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|239786 cd04253, AAK_UMPK-PyrH-Pf, AAK_UMPK-PyrH-Pf: UMP kinase (UMPK)-Pf, the mostly archaeal uridine monophosphate kinase (uridylate kinase) enzymes that catalyze UMP phosphorylation and play a key role in pyrimidine nucleotide biosynthesis; regulation of this process is via feed-back control and via gene repression of carbamoyl phosphate synthetase (the first enzyme of the pyrimidine biosynthesis pathway) | Back alignment and domain information |
|---|
| >gnl|CDD|233711 TIGR02076, pyrH_arch, uridylate kinase, putative | Back alignment and domain information |
|---|
| >gnl|CDD|239033 cd02115, AAK, Amino Acid Kinases (AAK) superfamily, catalytic domain; present in such enzymes like N-acetylglutamate kinase (NAGK), carbamate kinase (CK), aspartokinase (AK), glutamate-5-kinase (G5K) and UMP kinase (UMPK) | Back alignment and domain information |
|---|
| >gnl|CDD|216067 pfam00696, AA_kinase, Amino acid kinase family | Back alignment and domain information |
|---|
| >gnl|CDD|223601 COG0527, LysC, Aspartokinases [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|239775 cd04242, AAK_G5K_ProB, AAK_G5K_ProB: Glutamate-5-kinase (G5K) catalyzes glutamate-dependent ATP cleavage; G5K transfers the terminal phosphoryl group of ATP to the gamma-carboxyl group of glutamate, in the first and controlling step of proline (and, in mammals, ornithine) biosynthesis | Back alignment and domain information |
|---|
| >gnl|CDD|239788 cd04255, AAK_UMPK-MosAB, AAK_UMPK-MosAB: This CD includes the alpha and beta subunits of the Mo storage protein (MosA and MosB) which are related to uridine monophosphate kinase (UMPK) enzymes that catalyze the phosphorylation of UMP by ATP, yielding UDP, and playing a key role in pyrimidine nucleotide biosynthesis | Back alignment and domain information |
|---|
| >gnl|CDD|233076 TIGR00657, asp_kinases, aspartate kinase | Back alignment and domain information |
|---|
| >gnl|CDD|239767 cd04234, AAK_AK, AAK_AK: Amino Acid Kinase Superfamily (AAK), Aspartokinase (AK); this CD includes the N-terminal catalytic domain of aspartokinase (4-L-aspartate-4-phosphotransferase;) | Back alignment and domain information |
|---|
| >gnl|CDD|224524 COG1608, COG1608, Predicted archaeal kinase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|223341 COG0263, ProB, Glutamate 5-kinase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|239774 cd04241, AAK_FomA-like, AAK_FomA-like: This CD includes a fosfomycin biosynthetic gene product, FomA, and similar proteins found in a wide range of organisms | Back alignment and domain information |
|---|
| >gnl|CDD|162163 TIGR01027, proB, glutamate 5-kinase | Back alignment and domain information |
|---|
| >gnl|CDD|239779 cd04246, AAK_AK-DapG-like, AAK_AK-DapG-like: Amino Acid Kinase Superfamily (AAK), AK-DapG-like; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the diaminopimelate-sensitive aspartokinase isoenzyme AKI (DapG), a monofunctional enzymes found in Bacilli (Bacillus subtilis 168), Clostridia, and Actinobacteria bacterial species, as well as, the catalytic AK domain of the lysine-sensitive aspartokinase isoenzyme AKII of Bacillus subtilis 168, the lysine plus threonine-sensitive aspartokinase of Corynebacterium glutamicum, and related isoenzymes | Back alignment and domain information |
|---|
| >gnl|CDD|236188 PRK08210, PRK08210, aspartate kinase I; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|235460 PRK05429, PRK05429, gamma-glutamyl kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|239793 cd04260, AAK_AKi-DapG-BS, AAK_AKi-DapG-BS: Amino Acid Kinase Superfamily (AAK), AKi-DapG; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the diaminopimelate-sensitive aspartokinase isoenzyme AKI (DapG), a monofunctional class enzyme found in Bacilli (Bacillus subtilis 168), Clostridia, and Actinobacteria bacterial species | Back alignment and domain information |
|---|
| >gnl|CDD|239789 cd04256, AAK_P5CS_ProBA, AAK_P5CS_ProBA: Glutamate-5-kinase (G5K) domain of the bifunctional delta 1-pyrroline-5-carboxylate synthetase (P5CS), composed of an N-terminal G5K (ProB) and a C-terminal glutamyl 5- phosphate reductase (G5PR, ProA), the first and second enzyme catalyzing proline (and, in mammals, ornithine) biosynthesis | Back alignment and domain information |
|---|
| >gnl|CDD|239792 cd04259, AAK_AK-DapDC, AAK_AK-DapDC: Amino Acid Kinase Superfamily (AAK), AK-DapDC; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the bifunctional enzyme AK - DAP decarboxylase (DapDC) found in some bacteria | Back alignment and domain information |
|---|
| >gnl|CDD|181856 PRK09436, thrA, bifunctional aspartokinase I/homoserine dehydrogenase I; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235773 PRK06291, PRK06291, aspartate kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|239794 cd04261, AAK_AKii-LysC-BS, AAK_AKii-LysC-BS: Amino Acid Kinase Superfamily (AAK), AKii; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the lysine-sensitive aspartokinase isoenzyme AKII of Bacillus subtilis 168, and the lysine plus threonine-sensitive aspartokinase of Corynebacterium glutamicum, and related sequences | Back alignment and domain information |
|---|
| >gnl|CDD|239776 cd04243, AAK_AK-HSDH-like, AAK_AK-HSDH-like: Amino Acid Kinase Superfamily (AAK), AK-HSDH-like; this family includes the N-terminal catalytic domain of aspartokinase (AK) of the bifunctional enzyme AK- homoserine dehydrogenase (HSDH) | Back alignment and domain information |
|---|
| >gnl|CDD|239790 cd04257, AAK_AK-HSDH, AAK_AK-HSDH: Amino Acid Kinase Superfamily (AAK), AK-HSDH; this CD includes the N-terminal catalytic domain of aspartokinase (AK) of the bifunctional enzyme AK - homoserine dehydrogenase (HSDH) | Back alignment and domain information |
|---|
| >gnl|CDD|236358 PRK08961, PRK08961, bifunctional aspartate kinase/diaminopimelate decarboxylase protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|239777 cd04244, AAK_AK-LysC-like, AAK_AK-LysC-like: Amino Acid Kinase Superfamily (AAK), AK-LysC-like; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the lysine-sensitive AK isoenzyme found in higher plants | Back alignment and domain information |
|---|
| >gnl|CDD|183430 PRK12314, PRK12314, gamma-glutamyl kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|130164 TIGR01092, P5CS, delta l-pyrroline-5-carboxylate synthetase | Back alignment and domain information |
|---|
| >gnl|CDD|215230 PLN02418, PLN02418, delta-1-pyrroline-5-carboxylate synthase | Back alignment and domain information |
|---|
| >gnl|CDD|233075 TIGR00656, asp_kin_monofn, aspartate kinase, monofunctional class | Back alignment and domain information |
|---|
| >gnl|CDD|224965 COG2054, COG2054, Uncharacterized archaeal kinase related to aspartokinases, uridylate kinases [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|236018 PRK07431, PRK07431, aspartate kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184032 PRK13402, PRK13402, gamma-glutamyl kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236250 PRK08373, PRK08373, aspartate kinase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|181563 PRK08841, PRK08841, aspartate kinase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235843 PRK06635, PRK06635, aspartate kinase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|239773 cd04240, AAK_UC, AAK_UC: Uncharacterized (UC) amino acid kinase-like proteins found mainly in archaea and a few bacteria | Back alignment and domain information |
|---|
| >gnl|CDD|239778 cd04245, AAK_AKiii-YclM-BS, AAK_AKiii-YclM-BS: Amino Acid Kinase Superfamily (AAK), AKiii-YclM-BS; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the lysine plus threonine-sensitive aspartokinase isoenzyme AKIII, a monofunctional class enzyme found in Bacilli (Bacillus subtilis YclM) and Clostridia species | Back alignment and domain information |
|---|
| >gnl|CDD|239782 cd04249, AAK_NAGK-NC, AAK_NAGK-NC: N-Acetyl-L-glutamate kinase - noncyclic (NAGK-NC) catalyzes the phosphorylation of the gamma-COOH group of N-acetyl-L-glutamate (NAG) by ATP in the second step of microbial arginine biosynthesis using the acetylated, noncyclic route of ornithine biosynthesis | Back alignment and domain information |
|---|
| >gnl|CDD|131133 TIGR02078, AspKin_pair, Pyrococcus aspartate kinase subunit, putative | Back alignment and domain information |
|---|
| >gnl|CDD|239791 cd04258, AAK_AKiii-LysC-EC, AAK_AKiii-LysC-EC: Amino Acid Kinase Superfamily (AAK), AKiii-LysC-EC: this CD includes the N-terminal catalytic aspartokinase (AK) domain of the lysine-sensitive aspartokinase isoenzyme AKIII | Back alignment and domain information |
|---|
| >gnl|CDD|236376 PRK09084, PRK09084, aspartate kinase III; Validated | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 206 | |||
| COG0528 | 238 | PyrH Uridylate kinase [Nucleotide transport and me | 100.0 | |
| PRK00358 | 231 | pyrH uridylate kinase; Provisional | 100.0 | |
| PRK14556 | 249 | pyrH uridylate kinase; Provisional | 100.0 | |
| PRK14558 | 231 | pyrH uridylate kinase; Provisional | 100.0 | |
| TIGR02075 | 233 | pyrH_bact uridylate kinase. This protein, also cal | 100.0 | |
| cd04254 | 231 | AAK_UMPK-PyrH-Ec UMP kinase (UMPK)-Ec, the microbi | 100.0 | |
| cd04239 | 229 | AAK_UMPK-like AAK_UMPK-like: UMP kinase (UMPK)-lik | 100.0 | |
| PRK14557 | 247 | pyrH uridylate kinase; Provisional | 100.0 | |
| cd04253 | 221 | AAK_UMPK-PyrH-Pf AAK_UMPK-PyrH-Pf: UMP kinase (UMP | 100.0 | |
| TIGR02076 | 221 | pyrH_arch uridylate kinase, putative. This family | 100.0 | |
| cd02115 | 248 | AAK Amino Acid Kinases (AAK) superfamily, catalyti | 100.0 | |
| COG1608 | 252 | Predicted archaeal kinase [General function predic | 100.0 | |
| cd04241 | 252 | AAK_FomA-like AAK_FomA-like: This CD includes a fo | 100.0 | |
| cd04255 | 262 | AAK_UMPK-MosAB AAK_UMPK-MosAB: This CD includes th | 99.98 | |
| PRK14058 | 268 | acetylglutamate/acetylaminoadipate kinase; Provisi | 99.97 | |
| cd04261 | 239 | AAK_AKii-LysC-BS AAK_AKii-LysC-BS: Amino Acid Kina | 99.97 | |
| cd04246 | 239 | AAK_AK-DapG-like AAK_AK-DapG-like: Amino Acid Kina | 99.97 | |
| PRK12314 | 266 | gamma-glutamyl kinase; Provisional | 99.97 | |
| COG0548 | 265 | ArgB Acetylglutamate kinase [Amino acid transport | 99.97 | |
| cd04234 | 227 | AAK_AK AAK_AK: Amino Acid Kinase Superfamily (AAK) | 99.97 | |
| cd04242 | 251 | AAK_G5K_ProB AAK_G5K_ProB: Glutamate-5-kinase (G5K | 99.97 | |
| COG0527 | 447 | LysC Aspartokinases [Amino acid transport and meta | 99.97 | |
| CHL00202 | 284 | argB acetylglutamate kinase; Provisional | 99.97 | |
| TIGR00656 | 401 | asp_kin_monofn aspartate kinase, monofunctional cl | 99.97 | |
| cd04260 | 244 | AAK_AKi-DapG-BS AAK_AKi-DapG-BS: Amino Acid Kinase | 99.97 | |
| cd04240 | 203 | AAK_UC AAK_UC: Uncharacterized (UC) amino acid kin | 99.97 | |
| PRK13402 | 368 | gamma-glutamyl kinase; Provisional | 99.97 | |
| PLN02512 | 309 | acetylglutamate kinase | 99.97 | |
| PRK08841 | 392 | aspartate kinase; Validated | 99.97 | |
| cd04251 | 257 | AAK_NAGK-UC AAK_NAGK-UC: N-Acetyl-L-glutamate kina | 99.97 | |
| cd04245 | 288 | AAK_AKiii-YclM-BS AAK_AKiii-YclM-BS: Amino Acid Ki | 99.97 | |
| PRK05429 | 372 | gamma-glutamyl kinase; Provisional | 99.96 | |
| cd04244 | 298 | AAK_AK-LysC-like AAK_AK-LysC-like: Amino Acid Kina | 99.96 | |
| PRK08210 | 403 | aspartate kinase I; Reviewed | 99.96 | |
| PTZ00489 | 264 | glutamate 5-kinase; Provisional | 99.96 | |
| PRK00942 | 283 | acetylglutamate kinase; Provisional | 99.96 | |
| cd04250 | 279 | AAK_NAGK-C AAK_NAGK-C: N-Acetyl-L-glutamate kinase | 99.96 | |
| cd04249 | 252 | AAK_NAGK-NC AAK_NAGK-NC: N-Acetyl-L-glutamate kina | 99.96 | |
| cd04238 | 256 | AAK_NAGK-like AAK_NAGK-like: N-Acetyl-L-glutamate | 99.96 | |
| TIGR01027 | 363 | proB glutamate 5-kinase. Bacterial ProB proteins h | 99.96 | |
| PRK06635 | 404 | aspartate kinase; Reviewed | 99.96 | |
| cd04259 | 295 | AAK_AK-DapDC AAK_AK-DapDC: Amino Acid Kinase Super | 99.96 | |
| cd04247 | 306 | AAK_AK-Hom3 AAK_AK-Hom3: Amino Acid Kinase Superfa | 99.95 | |
| cd04257 | 294 | AAK_AK-HSDH AAK_AK-HSDH: Amino Acid Kinase Superfa | 99.95 | |
| PRK07431 | 587 | aspartate kinase; Provisional | 99.95 | |
| cd04243 | 293 | AAK_AK-HSDH-like AAK_AK-HSDH-like: Amino Acid Kina | 99.95 | |
| cd04256 | 284 | AAK_P5CS_ProBA AAK_P5CS_ProBA: Glutamate-5-kinase | 99.95 | |
| cd04258 | 292 | AAK_AKiii-LysC-EC AAK_AKiii-LysC-EC: Amino Acid Ki | 99.95 | |
| PRK06291 | 465 | aspartate kinase; Provisional | 99.95 | |
| TIGR00657 | 441 | asp_kinases aspartate kinase. The Lys-sensitive en | 99.95 | |
| PRK09034 | 454 | aspartate kinase; Reviewed | 99.95 | |
| PLN02551 | 521 | aspartokinase | 99.94 | |
| PRK08373 | 341 | aspartate kinase; Validated | 99.94 | |
| PRK09084 | 448 | aspartate kinase III; Validated | 99.94 | |
| TIGR02078 | 327 | AspKin_pair Pyrococcus aspartate kinase subunit, p | 99.94 | |
| PRK05925 | 440 | aspartate kinase; Provisional | 99.94 | |
| cd04252 | 248 | AAK_NAGK-fArgBP AAK_NAGK-fArgBP: N-Acetyl-L-glutam | 99.94 | |
| TIGR01890 | 429 | N-Ac-Glu-synth amino-acid N-acetyltransferase. Thi | 99.94 | |
| PRK09181 | 475 | aspartate kinase; Validated | 99.93 | |
| cd04237 | 280 | AAK_NAGS-ABP AAK_NAGS-ABP: N-acetylglutamate (NAG) | 99.93 | |
| COG0263 | 369 | ProB Glutamate 5-kinase [Amino acid transport and | 99.93 | |
| cd04248 | 304 | AAK_AK-Ectoine AAK_AK-Ectoine: Amino Acid Kinase S | 99.93 | |
| PRK09466 | 810 | metL bifunctional aspartate kinase II/homoserine d | 99.93 | |
| PF00696 | 242 | AA_kinase: Amino acid kinase family Match to Gluta | 99.93 | |
| PRK05279 | 441 | N-acetylglutamate synthase; Validated | 99.93 | |
| cd04235 | 308 | AAK_CK AAK_CK: Carbamate kinase (CK) catalyzes bot | 99.92 | |
| PRK12353 | 314 | putative amino acid kinase; Reviewed | 99.92 | |
| TIGR00761 | 231 | argB acetylglutamate kinase. This model describes | 99.92 | |
| PRK09436 | 819 | thrA bifunctional aspartokinase I/homoserine dehyd | 99.92 | |
| cd04236 | 271 | AAK_NAGS-Urea AAK_NAGS-Urea: N-acetylglutamate (NA | 99.92 | |
| COG2054 | 212 | Uncharacterized archaeal kinase related to asparto | 99.92 | |
| TIGR01092 | 715 | P5CS delta l-pyrroline-5-carboxylate synthetase. T | 99.92 | |
| PRK12352 | 316 | putative carbamate kinase; Reviewed | 99.91 | |
| PRK08961 | 861 | bifunctional aspartate kinase/diaminopimelate deca | 99.9 | |
| TIGR00746 | 310 | arcC carbamate kinase. The seed alignment for this | 99.9 | |
| PLN02825 | 515 | amino-acid N-acetyltransferase | 99.89 | |
| PRK12454 | 313 | carbamate kinase-like carbamoyl phosphate syntheta | 99.89 | |
| PLN02418 | 718 | delta-1-pyrroline-5-carboxylate synthase | 99.88 | |
| KOG0456 | 559 | consensus Aspartate kinase [Amino acid transport a | 99.87 | |
| PRK12686 | 312 | carbamate kinase; Reviewed | 99.87 | |
| PRK12354 | 307 | carbamate kinase; Reviewed | 99.86 | |
| PRK04531 | 398 | acetylglutamate kinase; Provisional | 99.86 | |
| KOG1154 | 285 | consensus Gamma-glutamyl kinase [Amino acid transp | 99.85 | |
| PRK09411 | 297 | carbamate kinase; Reviewed | 99.81 | |
| COG0549 | 312 | ArcC Carbamate kinase [Amino acid transport and me | 99.69 | |
| KOG2436 | 520 | consensus Acetylglutamate kinase/acetylglutamate s | 98.48 | |
| COG1778 | 170 | Low specificity phosphatase (HAD superfamily) [Gen | 84.74 |
| >COG0528 PyrH Uridylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
Probab=100.00 E-value=3e-39 Score=260.68 Aligned_cols=193 Identities=62% Similarity=0.991 Sum_probs=183.2
Q ss_pred ceEEEEEcCChhhhhhhhhhcCCCChhhhhHHHHHHHHHHHHHHHHHHHhCCCCceEecccccccccchhHHHHHHHHhh
Q 028621 2 FQVAIVVGGGNIFRGASAAGNSGLDRSSADYIGMLATVMNAIFLQATMESIGIPTRVQTAFRMSEVAEPYIRRRAVRHLE 81 (206)
Q Consensus 2 ~~~iiVhGGG~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~ll~~~l~~~gi~a~~l~~~~~~~v~~~~~~~~l~~~l~ 81 (206)
+++.||.|||+.+|++..+. .|+++...|++++++|++|+.++++.|+..|+++..+++..+..+.+|++.+...++|+
T Consensus 45 ~eV~iVvGGGni~Rg~~~~~-~g~~r~~~D~mGmlaTvmNal~L~~aL~~~~~~~~v~sai~~~~~~e~~~~~~A~~~l~ 123 (238)
T COG0528 45 VEVAVVVGGGNIARGYIGAA-AGMDRVTADYMGMLATVMNALALQDALERLGVDTRVQSAIAMPQVAEPYSRREAIRHLE 123 (238)
T ss_pred cEEEEEECCCHHHHhHHHHH-cCCchhhhhHHHHHHHHHHHHHHHHHHHhcCCcceecccccCccccCccCHHHHHHHHH
Confidence 58899999999999998666 49999999999999999999999999999999999999988877778888888899999
Q ss_pred CCCEEEEeCCCCCCCCCcHHHHHHHHHhcCCcEEEEeec-cCccccCCCCCCCCCcccccccHHHHhcCCcCcchHHHHH
Q 028621 82 KGRVVIFAAGTGNPFFTTDTAAALRCAEINAEVVLKATN-VDGVYDDNPRRNPNARLLDTLTYQEVTSKDLSVMDMTAIT 160 (206)
Q Consensus 82 ~g~ipvi~g~~g~~~~~sD~~A~~lA~~l~A~~li~ltd-V~Gv~~~dP~~~~~a~~i~~i~~~e~~~~g~~~~k~~a~~ 160 (206)
+|+|+|+++++|+|+.++|+.|++.|++++||.++..|+ |||||++||+++|+|+.++++|++|+.+.+..+||+.|+.
T Consensus 124 ~grVvIf~gGtg~P~fTTDt~AALrA~ei~ad~ll~atn~VDGVY~~DPkk~pdA~~~~~Lty~e~l~~~l~vmD~tA~~ 203 (238)
T COG0528 124 KGRVVIFGGGTGNPGFTTDTAAALRAEEIEADVLLKATNKVDGVYDADPKKDPDAKKYDTLTYDEVLKIGLKVMDPTAFS 203 (238)
T ss_pred cCCEEEEeCCCCCCCCchHHHHHHHHHHhCCcEEEEeccCCCceeCCCCCCCCCceecccCCHHHHHHhcCeeecHHHHH
Confidence 999999999999999999999999999999999999995 9999999999999999999999999998889999999999
Q ss_pred HHHhCCCcEEEEcCCCCchHHHHhcCCCcceEEec
Q 028621 161 LCQENNIPVVVFNLNQPGNIAKAIQGERVGTLIGG 195 (206)
Q Consensus 161 ~a~~~gi~v~I~~g~~~~~l~~~l~g~~~GT~i~~ 195 (206)
.+.++++|++++|.+++++|.+++.|+..||+|.+
T Consensus 204 l~~~~~i~i~Vfn~~~~~~l~~~~~ge~~gT~V~~ 238 (238)
T COG0528 204 LARDNGIPIIVFNINKPGNLKRALKGEEVGTIVEP 238 (238)
T ss_pred HHHHcCCcEEEEeCCCCccHHHHHcCCCCceEecC
Confidence 99999999999999999999999999999999863
|
|
| >PRK00358 pyrH uridylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK14556 pyrH uridylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK14558 pyrH uridylate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR02075 pyrH_bact uridylate kinase | Back alignment and domain information |
|---|
| >cd04254 AAK_UMPK-PyrH-Ec UMP kinase (UMPK)-Ec, the microbial/chloroplast uridine monophosphate kinase (uridylate kinase) enzyme that catalyzes UMP phosphorylation and plays a key role in pyrimidine nucleotide biosynthesis; regulation of this process is via feed-back control and via gene repression of carbamoyl phosphate synthetase (the first enzyme of the pyrimidine biosynthesis pathway) | Back alignment and domain information |
|---|
| >cd04239 AAK_UMPK-like AAK_UMPK-like: UMP kinase (UMPK)-like, the microbial/chloroplast uridine monophosphate kinase (uridylate kinase) enzyme that catalyzes UMP phosphorylation and plays a key role in pyrimidine nucleotide biosynthesis | Back alignment and domain information |
|---|
| >PRK14557 pyrH uridylate kinase; Provisional | Back alignment and domain information |
|---|
| >cd04253 AAK_UMPK-PyrH-Pf AAK_UMPK-PyrH-Pf: UMP kinase (UMPK)-Pf, the mostly archaeal uridine monophosphate kinase (uridylate kinase) enzymes that catalyze UMP phosphorylation and play a key role in pyrimidine nucleotide biosynthesis; regulation of this process is via feed-back control and via gene repression of carbamoyl phosphate synthetase (the first enzyme of the pyrimidine biosynthesis pathway) | Back alignment and domain information |
|---|
| >TIGR02076 pyrH_arch uridylate kinase, putative | Back alignment and domain information |
|---|
| >cd02115 AAK Amino Acid Kinases (AAK) superfamily, catalytic domain; present in such enzymes like N-acetylglutamate kinase (NAGK), carbamate kinase (CK), aspartokinase (AK), glutamate-5-kinase (G5K) and UMP kinase (UMPK) | Back alignment and domain information |
|---|
| >COG1608 Predicted archaeal kinase [General function prediction only] | Back alignment and domain information |
|---|
| >cd04241 AAK_FomA-like AAK_FomA-like: This CD includes a fosfomycin biosynthetic gene product, FomA, and similar proteins found in a wide range of organisms | Back alignment and domain information |
|---|
| >cd04255 AAK_UMPK-MosAB AAK_UMPK-MosAB: This CD includes the alpha and beta subunits of the Mo storage protein (MosA and MosB) which are related to uridine monophosphate kinase (UMPK) enzymes that catalyze the phosphorylation of UMP by ATP, yielding UDP, and playing a key role in pyrimidine nucleotide biosynthesis | Back alignment and domain information |
|---|
| >PRK14058 acetylglutamate/acetylaminoadipate kinase; Provisional | Back alignment and domain information |
|---|
| >cd04261 AAK_AKii-LysC-BS AAK_AKii-LysC-BS: Amino Acid Kinase Superfamily (AAK), AKii; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the lysine-sensitive aspartokinase isoenzyme AKII of Bacillus subtilis 168, and the lysine plus threonine-sensitive aspartokinase of Corynebacterium glutamicum, and related sequences | Back alignment and domain information |
|---|
| >cd04246 AAK_AK-DapG-like AAK_AK-DapG-like: Amino Acid Kinase Superfamily (AAK), AK-DapG-like; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the diaminopimelate-sensitive aspartokinase isoenzyme AKI (DapG), a monofunctional enzymes found in Bacilli (Bacillus subtilis 168), Clostridia, and Actinobacteria bacterial species, as well as, the catalytic AK domain of the lysine-sensitive aspartokinase isoenzyme AKII of Bacillus subtilis 168, the lysine plus threonine-sensitive aspartokinase of Corynebacterium glutamicum, and related isoenzymes | Back alignment and domain information |
|---|
| >PRK12314 gamma-glutamyl kinase; Provisional | Back alignment and domain information |
|---|
| >COG0548 ArgB Acetylglutamate kinase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd04234 AAK_AK AAK_AK: Amino Acid Kinase Superfamily (AAK), Aspartokinase (AK); this CD includes the N-terminal catalytic domain of aspartokinase (4-L-aspartate-4-phosphotransferase;) | Back alignment and domain information |
|---|
| >cd04242 AAK_G5K_ProB AAK_G5K_ProB: Glutamate-5-kinase (G5K) catalyzes glutamate-dependent ATP cleavage; G5K transfers the terminal phosphoryl group of ATP to the gamma-carboxyl group of glutamate, in the first and controlling step of proline (and, in mammals, ornithine) biosynthesis | Back alignment and domain information |
|---|
| >COG0527 LysC Aspartokinases [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >CHL00202 argB acetylglutamate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR00656 asp_kin_monofn aspartate kinase, monofunctional class | Back alignment and domain information |
|---|
| >cd04260 AAK_AKi-DapG-BS AAK_AKi-DapG-BS: Amino Acid Kinase Superfamily (AAK), AKi-DapG; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the diaminopimelate-sensitive aspartokinase isoenzyme AKI (DapG), a monofunctional class enzyme found in Bacilli (Bacillus subtilis 168), Clostridia, and Actinobacteria bacterial species | Back alignment and domain information |
|---|
| >cd04240 AAK_UC AAK_UC: Uncharacterized (UC) amino acid kinase-like proteins found mainly in archaea and a few bacteria | Back alignment and domain information |
|---|
| >PRK13402 gamma-glutamyl kinase; Provisional | Back alignment and domain information |
|---|
| >PLN02512 acetylglutamate kinase | Back alignment and domain information |
|---|
| >PRK08841 aspartate kinase; Validated | Back alignment and domain information |
|---|
| >cd04251 AAK_NAGK-UC AAK_NAGK-UC: N-Acetyl-L-glutamate kinase - uncharacterized (NAGK-UC) | Back alignment and domain information |
|---|
| >cd04245 AAK_AKiii-YclM-BS AAK_AKiii-YclM-BS: Amino Acid Kinase Superfamily (AAK), AKiii-YclM-BS; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the lysine plus threonine-sensitive aspartokinase isoenzyme AKIII, a monofunctional class enzyme found in Bacilli (Bacillus subtilis YclM) and Clostridia species | Back alignment and domain information |
|---|
| >PRK05429 gamma-glutamyl kinase; Provisional | Back alignment and domain information |
|---|
| >cd04244 AAK_AK-LysC-like AAK_AK-LysC-like: Amino Acid Kinase Superfamily (AAK), AK-LysC-like; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the lysine-sensitive AK isoenzyme found in higher plants | Back alignment and domain information |
|---|
| >PRK08210 aspartate kinase I; Reviewed | Back alignment and domain information |
|---|
| >PTZ00489 glutamate 5-kinase; Provisional | Back alignment and domain information |
|---|
| >PRK00942 acetylglutamate kinase; Provisional | Back alignment and domain information |
|---|
| >cd04250 AAK_NAGK-C AAK_NAGK-C: N-Acetyl-L-glutamate kinase - cyclic (NAGK-C) catalyzes the phosphorylation of the gamma-COOH group of N-acetyl-L-glutamate (NAG) by ATP in the second step of arginine biosynthesis found in some bacteria and photosynthetic organisms using the non-acetylated, cyclic route of ornithine biosynthesis | Back alignment and domain information |
|---|
| >cd04249 AAK_NAGK-NC AAK_NAGK-NC: N-Acetyl-L-glutamate kinase - noncyclic (NAGK-NC) catalyzes the phosphorylation of the gamma-COOH group of N-acetyl-L-glutamate (NAG) by ATP in the second step of microbial arginine biosynthesis using the acetylated, noncyclic route of ornithine biosynthesis | Back alignment and domain information |
|---|
| >cd04238 AAK_NAGK-like AAK_NAGK-like: N-Acetyl-L-glutamate kinase (NAGK)-like | Back alignment and domain information |
|---|
| >TIGR01027 proB glutamate 5-kinase | Back alignment and domain information |
|---|
| >PRK06635 aspartate kinase; Reviewed | Back alignment and domain information |
|---|
| >cd04259 AAK_AK-DapDC AAK_AK-DapDC: Amino Acid Kinase Superfamily (AAK), AK-DapDC; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the bifunctional enzyme AK - DAP decarboxylase (DapDC) found in some bacteria | Back alignment and domain information |
|---|
| >cd04247 AAK_AK-Hom3 AAK_AK-Hom3: Amino Acid Kinase Superfamily (AAK), AK-Hom3; this CD includes the N-terminal catalytic domain of the aspartokinase HOM3, a monofunctional class enzyme found in Saccharomyces cerevisiae and other related AK domains | Back alignment and domain information |
|---|
| >cd04257 AAK_AK-HSDH AAK_AK-HSDH: Amino Acid Kinase Superfamily (AAK), AK-HSDH; this CD includes the N-terminal catalytic domain of aspartokinase (AK) of the bifunctional enzyme AK - homoserine dehydrogenase (HSDH) | Back alignment and domain information |
|---|
| >PRK07431 aspartate kinase; Provisional | Back alignment and domain information |
|---|
| >cd04243 AAK_AK-HSDH-like AAK_AK-HSDH-like: Amino Acid Kinase Superfamily (AAK), AK-HSDH-like; this family includes the N-terminal catalytic domain of aspartokinase (AK) of the bifunctional enzyme AK- homoserine dehydrogenase (HSDH) | Back alignment and domain information |
|---|
| >cd04256 AAK_P5CS_ProBA AAK_P5CS_ProBA: Glutamate-5-kinase (G5K) domain of the bifunctional delta 1-pyrroline-5-carboxylate synthetase (P5CS), composed of an N-terminal G5K (ProB) and a C-terminal glutamyl 5- phosphate reductase (G5PR, ProA), the first and second enzyme catalyzing proline (and, in mammals, ornithine) biosynthesis | Back alignment and domain information |
|---|
| >cd04258 AAK_AKiii-LysC-EC AAK_AKiii-LysC-EC: Amino Acid Kinase Superfamily (AAK), AKiii-LysC-EC: this CD includes the N-terminal catalytic aspartokinase (AK) domain of the lysine-sensitive aspartokinase isoenzyme AKIII | Back alignment and domain information |
|---|
| >PRK06291 aspartate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR00657 asp_kinases aspartate kinase | Back alignment and domain information |
|---|
| >PRK09034 aspartate kinase; Reviewed | Back alignment and domain information |
|---|
| >PLN02551 aspartokinase | Back alignment and domain information |
|---|
| >PRK08373 aspartate kinase; Validated | Back alignment and domain information |
|---|
| >PRK09084 aspartate kinase III; Validated | Back alignment and domain information |
|---|
| >TIGR02078 AspKin_pair Pyrococcus aspartate kinase subunit, putative | Back alignment and domain information |
|---|
| >PRK05925 aspartate kinase; Provisional | Back alignment and domain information |
|---|
| >cd04252 AAK_NAGK-fArgBP AAK_NAGK-fArgBP: N-Acetyl-L-glutamate kinase (NAGK) of the fungal arginine-biosynthetic pathway (fArgBP) | Back alignment and domain information |
|---|
| >TIGR01890 N-Ac-Glu-synth amino-acid N-acetyltransferase | Back alignment and domain information |
|---|
| >PRK09181 aspartate kinase; Validated | Back alignment and domain information |
|---|
| >cd04237 AAK_NAGS-ABP AAK_NAGS-ABP: N-acetylglutamate (NAG) kinase-like domain of the NAG Synthase (NAGS) of the arginine-biosynthesis pathway (ABP) found in gamma- and beta-proteobacteria and higher plant chloroplasts | Back alignment and domain information |
|---|
| >COG0263 ProB Glutamate 5-kinase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd04248 AAK_AK-Ectoine AAK_AK-Ectoine: Amino Acid Kinase Superfamily (AAK), AK-Ectoine; this CD includes the N-terminal catalytic domain of the aspartokinase of the ectoine (1,4,5,6-tetrahydro-2-methyl pyrimidine-4-carboxylate) biosynthetic pathway found in Methylomicrobium alcaliphilum, Vibrio cholerae, and other various halotolerant or halophilic bacteria | Back alignment and domain information |
|---|
| >PRK09466 metL bifunctional aspartate kinase II/homoserine dehydrogenase II; Provisional | Back alignment and domain information |
|---|
| >PF00696 AA_kinase: Amino acid kinase family Match to Glutamate-5-kinases, C-terminal end of the alignment Match to Aspartate kinases; InterPro: IPR001048 This entry contains proteins with various specificities and includes the aspartate, glutamate and uridylate kinase families | Back alignment and domain information |
|---|
| >PRK05279 N-acetylglutamate synthase; Validated | Back alignment and domain information |
|---|
| >cd04235 AAK_CK AAK_CK: Carbamate kinase (CK) catalyzes both the ATP-phosphorylation of carbamate and carbamoyl phosphate (CP) utilization with the production of ATP from ADP and CP | Back alignment and domain information |
|---|
| >PRK12353 putative amino acid kinase; Reviewed | Back alignment and domain information |
|---|
| >TIGR00761 argB acetylglutamate kinase | Back alignment and domain information |
|---|
| >PRK09436 thrA bifunctional aspartokinase I/homoserine dehydrogenase I; Provisional | Back alignment and domain information |
|---|
| >cd04236 AAK_NAGS-Urea AAK_NAGS-Urea: N-acetylglutamate (NAG) kinase-like domain of the NAG Synthase (NAGS) of the urea cycle found in animals | Back alignment and domain information |
|---|
| >COG2054 Uncharacterized archaeal kinase related to aspartokinases, uridylate kinases [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01092 P5CS delta l-pyrroline-5-carboxylate synthetase | Back alignment and domain information |
|---|
| >PRK12352 putative carbamate kinase; Reviewed | Back alignment and domain information |
|---|
| >PRK08961 bifunctional aspartate kinase/diaminopimelate decarboxylase protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00746 arcC carbamate kinase | Back alignment and domain information |
|---|
| >PLN02825 amino-acid N-acetyltransferase | Back alignment and domain information |
|---|
| >PRK12454 carbamate kinase-like carbamoyl phosphate synthetase; Reviewed | Back alignment and domain information |
|---|
| >PLN02418 delta-1-pyrroline-5-carboxylate synthase | Back alignment and domain information |
|---|
| >KOG0456 consensus Aspartate kinase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK12686 carbamate kinase; Reviewed | Back alignment and domain information |
|---|
| >PRK12354 carbamate kinase; Reviewed | Back alignment and domain information |
|---|
| >PRK04531 acetylglutamate kinase; Provisional | Back alignment and domain information |
|---|
| >KOG1154 consensus Gamma-glutamyl kinase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK09411 carbamate kinase; Reviewed | Back alignment and domain information |
|---|
| >COG0549 ArcC Carbamate kinase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG2436 consensus Acetylglutamate kinase/acetylglutamate synthase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG1778 Low specificity phosphatase (HAD superfamily) [General function prediction only] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 206 | ||||
| 3ek5_A | 243 | Unique Gtp-Binding Pocket And Allostery Of Ump Kina | 3e-59 | ||
| 3nwy_A | 281 | Structure And Allosteric Regulation Of The Uridine | 1e-58 | ||
| 1z9d_A | 252 | Crystal Structure Of A Putative Uridylate Kinase (U | 1e-52 | ||
| 4a7w_A | 240 | Crystal Structure Of Uridylate Kinase From Helicoba | 8e-52 | ||
| 1ybd_A | 239 | Crystal Structure Analysis Of Uridylate Kinase From | 5e-51 | ||
| 2a1f_A | 247 | Crystal Structure Of Uridylate Kinase Length = 247 | 2e-48 | ||
| 2bnd_A | 241 | The Structure Of E.Coli Ump Kinase In Complex With | 7e-48 | ||
| 2bne_A | 241 | The Structure Of E. Coli Ump Kinase In Complex With | 9e-48 | ||
| 2bnf_A | 241 | The Structure Of E. Coli Ump Kinase In Complex With | 2e-43 | ||
| 2jjx_A | 255 | The Crystal Structure Of Ump Kinase From Bacillus A | 4e-41 | ||
| 2va1_A | 256 | Crystal Structure Of Ump Kinase From Ureaplasma Par | 3e-39 | ||
| 2ij9_A | 219 | Crystal Structure Of Uridylate Kinase From Archaeog | 5e-17 | ||
| 2brx_A | 244 | Ump Kinase From Pyrococcus Furiosus Without Ligands | 1e-11 | ||
| 2ji5_A | 227 | Structure Of Ump Kinase From Pyrococcus Furiosus Co | 2e-11 | ||
| 2j4j_A | 226 | Crystal Structure Of Uridylate Kinase From Sulfolob | 6e-10 | ||
| 3ll9_A | 269 | X-Ray Structures Of Isopentenyl Phosphate Kinase Le | 2e-07 | ||
| 2bmu_A | 226 | Ump Kinase From Pyrococcus Furiosus Complexed With | 3e-07 | ||
| 2bri_A | 225 | Ump Kinase From Pyrococcus Furiosus Complexed With | 3e-07 | ||
| 4f6t_B | 268 | The Crystal Structure Of The Molybdenum Storage Pro | 2e-06 | ||
| 2ogx_B | 270 | The Crystal Structure Of The Molybdenum Storage Pro | 5e-06 | ||
| 2hmf_A | 469 | Structure Of A Threonine Sensitive Aspartokinase Fr | 2e-04 | ||
| 3c1n_C | 473 | Crystal Structure Of Allosteric Inhibition Threonin | 2e-04 |
| >pdb|3EK5|A Chain A, Unique Gtp-Binding Pocket And Allostery Of Ump Kinase From A Gram- Negative Phytopathogen Bacterium Length = 243 | Back alignment and structure |
|
| >pdb|3NWY|A Chain A, Structure And Allosteric Regulation Of The Uridine Monophosphate Kinase From Mycobacterium Tuberculosis Length = 281 | Back alignment and structure |
| >pdb|1Z9D|A Chain A, Crystal Structure Of A Putative Uridylate Kinase (Ump-Kinase) From Streptococcus Pyogenes Length = 252 | Back alignment and structure |
| >pdb|4A7W|A Chain A, Crystal Structure Of Uridylate Kinase From Helicobacter Pylori Length = 240 | Back alignment and structure |
| >pdb|1YBD|A Chain A, Crystal Structure Analysis Of Uridylate Kinase From Neisseria Meningitidis Length = 239 | Back alignment and structure |
| >pdb|2A1F|A Chain A, Crystal Structure Of Uridylate Kinase Length = 247 | Back alignment and structure |
| >pdb|2BND|A Chain A, The Structure Of E.Coli Ump Kinase In Complex With Udp Length = 241 | Back alignment and structure |
| >pdb|2BNE|A Chain A, The Structure Of E. Coli Ump Kinase In Complex With Ump Length = 241 | Back alignment and structure |
| >pdb|2BNF|A Chain A, The Structure Of E. Coli Ump Kinase In Complex With Utp Length = 241 | Back alignment and structure |
| >pdb|2JJX|A Chain A, The Crystal Structure Of Ump Kinase From Bacillus Anthracis (Ba1797) Length = 255 | Back alignment and structure |
| >pdb|2VA1|A Chain A, Crystal Structure Of Ump Kinase From Ureaplasma Parvum Length = 256 | Back alignment and structure |
| >pdb|2IJ9|A Chain A, Crystal Structure Of Uridylate Kinase From Archaeoglobus Fulgidus Length = 219 | Back alignment and structure |
| >pdb|2BRX|A Chain A, Ump Kinase From Pyrococcus Furiosus Without Ligands Length = 244 | Back alignment and structure |
| >pdb|2JI5|A Chain A, Structure Of Ump Kinase From Pyrococcus Furiosus Complexed With Utp Length = 227 | Back alignment and structure |
| >pdb|2J4J|A Chain A, Crystal Structure Of Uridylate Kinase From Sulfolobus Solfataricus In Complex With Ump And Amppcp To 2.1 Angstrom Resolution Length = 226 | Back alignment and structure |
| >pdb|3LL9|A Chain A, X-Ray Structures Of Isopentenyl Phosphate Kinase Length = 269 | Back alignment and structure |
| >pdb|2BMU|A Chain A, Ump Kinase From Pyrococcus Furiosus Complexed With Its Substrate Ump And Its Substrate Analog Amppnp Length = 226 | Back alignment and structure |
| >pdb|2BRI|A Chain A, Ump Kinase From Pyrococcus Furiosus Complexed With Its Substrate Analog Amppnp Length = 225 | Back alignment and structure |
| >pdb|4F6T|B Chain B, The Crystal Structure Of The Molybdenum Storage Protein (Mosto) From Azotobacter Vinelandii Loaded With Various Polyoxometalates Length = 268 | Back alignment and structure |
| >pdb|2OGX|B Chain B, The Crystal Structure Of The Molybdenum Storage Protein From Azotobacter Vinelandii Loaded With Polyoxotungstates (Wsto) Length = 270 | Back alignment and structure |
| >pdb|2HMF|A Chain A, Structure Of A Threonine Sensitive Aspartokinase From Methanococcus Jannaschii Complexed With Mg-Adp And Aspartate Length = 469 | Back alignment and structure |
| >pdb|3C1N|C Chain C, Crystal Structure Of Allosteric Inhibition Threonine-Sensitive Aspartokinase From Methanococcus Jannaschii With L-Threonine Length = 473 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 206 | |||
| 2ogx_B | 270 | Molybdenum storage protein subunit beta; open alph | 1e-93 | |
| 2brx_A | 244 | Uridylate kinase; UMP kinase, amino acid kinase, p | 9e-88 | |
| 4a7w_A | 240 | Uridylate kinase; transferase; HET: GTP; 1.80A {He | 4e-87 | |
| 2j4j_A | 226 | Uridylate kinase; transferase, nucleoside monophos | 1e-86 | |
| 2a1f_A | 247 | Uridylate kinase; PYRH, structural genomics, PSI, | 3e-86 | |
| 3ek6_A | 243 | Uridylate kinase; UMPK unique GTP B site, alloster | 3e-86 | |
| 2va1_A | 256 | Uridylate kinase; UMPK, transferase, pyrimidine bi | 1e-84 | |
| 1ybd_A | 239 | Uridylate kinase; alpha/beta/alpha fold, hexamer, | 8e-84 | |
| 2ij9_A | 219 | Uridylate kinase; structural genomics, protein str | 1e-83 | |
| 3nwy_A | 281 | Uridylate kinase; allosterically activated form, A | 4e-83 | |
| 1z9d_A | 252 | Uridylate kinase, UK, UMP kinase; structural genom | 2e-82 | |
| 2jjx_A | 255 | Uridylate kinase, UMP kinase; structural genomics, | 4e-81 | |
| 2ogx_A | 276 | Molybdenum storage protein subunit alpha; open alp | 9e-69 | |
| 3k4o_A | 266 | Isopentenyl phosphate kinase; small molecule kinas | 1e-41 | |
| 3ll5_A | 249 | Gamma-glutamyl kinase related protein; alternate m | 1e-16 | |
| 3ll9_A | 269 | Isopentenyl phosphate kinase; mevalonate biosynthe | 4e-15 | |
| 3c1m_A | 473 | Probable aspartokinase; allosteric inhibition, thr | 9e-13 | |
| 3d40_A | 286 | FOMA protein; fosfomycin, antibiotic resistance, k | 1e-12 | |
| 3tvi_A | 446 | Aspartokinase; structural genomics, ACT domains, r | 2e-11 | |
| 2j0w_A | 449 | Lysine-sensitive aspartokinase 3; feedback inhibit | 6e-11 | |
| 2j5v_A | 367 | Glutamate 5-kinase; proline biosynthesis, gamma gl | 2e-10 | |
| 2cdq_A | 510 | Aspartokinase; aspartate kinase, amino acid metabo | 1e-09 | |
| 2ako_A | 251 | Glutamate 5-kinase; structural genomics, PSI, prot | 2e-08 | |
| 3ab4_A | 421 | Aspartokinase; aspartate kinase, concerted inhibit | 4e-07 | |
| 3l76_A | 600 | Aspartokinase; allostery, ACT domains, kinase tran | 8e-07 | |
| 1qzv_F | 154 | Plant photosystem I: subunit PSAF; photosynthesis, | 2e-05 | |
| 1e19_A | 314 | Carbamate kinase-like carbamoylphosphate synthetas | 6e-05 | |
| 2we5_A | 310 | Carbamate kinase 1; arginine catabolism, arginine | 5e-04 | |
| 2e9y_A | 316 | Carbamate kinase; transferase, structural genomics | 6e-04 | |
| 3kzf_A | 317 | Carbamate kinase; arginine dihydrolase pathway, gi | 8e-04 |
| >2ogx_B Molybdenum storage protein subunit beta; open alpha/beta structure, metal binding protein; HET: ATP; 1.60A {Azotobacter vinelandii} Length = 270 | Back alignment and structure |
|---|
Score = 273 bits (700), Expect = 1e-93
Identities = 44/200 (22%), Positives = 82/200 (41%), Gaps = 6/200 (3%)
Query: 3 QVAIVVGGGNIFRGASAAG-NSGLDRSSADYIGMLATVMNAIFLQATMESIGIPTRVQTA 61
++ I G G R + GL +G NA L + GIP
Sbjct: 71 KLLIGTGAGTRARHLYSIAAGLGLPAGVLAQLGSSVADQNAAMLGQLLAKHGIPVVGGAG 130
Query: 62 FRMSEVAEPYIRRRAVRHLEKGRVVIFAAGTGN-PFFTTDTAAALRCAEINAEVVLKATN 120
++ + + ++ + A G P + TD L + + ++ +
Sbjct: 131 LSAVPLSLAEVNAVVFSGMPPYKLWMRPAAEGVIPPYRTDAGCFLLAEQFGCKQMIFVKD 190
Query: 121 VDGVYDDNPRRNPNARLLDTLTYQEVTSKDL--SVMDMTAITLCQ--ENNIPVVVFNLNQ 176
DG+Y NP+ + +A + ++ E+ +K L S+++ + L Q ++ V V N
Sbjct: 191 EDGLYTANPKTSKDATFIPRISVDEMKAKGLHDSILEFPVLDLLQSAQHVREVQVVNGLV 250
Query: 177 PGNIAKAIQGERVGTLIGGT 196
PGN+ +A+ GE VGT+I +
Sbjct: 251 PGNLTRALAGEHVGTIITAS 270
|
| >2brx_A Uridylate kinase; UMP kinase, amino acid kinase, phosphoryl group transfer, pyrimidine biosynthesis, transferase; 2.40A {Pyrococcus furiosus} SCOP: c.73.1.3 PDB: 2ji5_A* 2bmu_A* 2bri_A* Length = 244 | Back alignment and structure |
|---|
| >4a7w_A Uridylate kinase; transferase; HET: GTP; 1.80A {Helicobacter pylori} PDB: 4a7x_A* Length = 240 | Back alignment and structure |
|---|
| >2j4j_A Uridylate kinase; transferase, nucleoside monophosphate kinase, UMP kinase, aspartokinase fold, pyrimidine nucleotide synthesis; HET: U5P ACP 4TC; 2.1A {Sulfolobus solfataricus} PDB: 2j4k_A* 2j4l_A* Length = 226 | Back alignment and structure |
|---|
| >2a1f_A Uridylate kinase; PYRH, structural genomics, PSI, protein ST initiative, NEW YORK SGX research center for structural GEN nysgxrc; 2.10A {Haemophilus influenzae} SCOP: c.73.1.3 PDB: 2bne_A* 2bnf_A* 2v4y_A* 2bnd_A* Length = 247 | Back alignment and structure |
|---|
| >3ek6_A Uridylate kinase; UMPK unique GTP B site, allosteric regulation, ATP-binding, nucleotid binding, pyrimidine biosynthesis, transferase; 2.34A {Xanthomonas campestris PV} PDB: 3ek5_A Length = 243 | Back alignment and structure |
|---|
| >2va1_A Uridylate kinase; UMPK, transferase, pyrimidine biosynthesis, amino acid kinase family; 2.50A {Ureaplasma parvum} Length = 256 | Back alignment and structure |
|---|
| >1ybd_A Uridylate kinase; alpha/beta/alpha fold, hexamer, structural genomics, structure initiative, PSI; 2.60A {Neisseria meningitidis} SCOP: c.73.1.3 Length = 239 | Back alignment and structure |
|---|
| >2ij9_A Uridylate kinase; structural genomics, protein structure initiative, P nysgxrc; 2.90A {Archaeoglobus fulgidus} SCOP: c.73.1.3 Length = 219 | Back alignment and structure |
|---|
| >3nwy_A Uridylate kinase; allosterically activated form, AAK fold, UMP kinase, transfe; HET: GTP UDP; 2.54A {Mycobacterium tuberculosis} Length = 281 | Back alignment and structure |
|---|
| >1z9d_A Uridylate kinase, UK, UMP kinase; structural genomics, protein structure initiative, NYSGXRC, PYRH, putative uridylate kinase, PSI; 2.80A {Streptococcus pyogenes} SCOP: c.73.1.3 Length = 252 | Back alignment and structure |
|---|
| >2jjx_A Uridylate kinase, UMP kinase; structural genomics, pyrimidine biosynthesis, ATP-binding, nucleotide-binding, OPPF, PYRH, cytoplasm; HET: ATP; 2.82A {Bacillus anthracis} Length = 255 | Back alignment and structure |
|---|
| >2ogx_A Molybdenum storage protein subunit alpha; open alpha/beta structure, metal binding protein; HET: ATP; 1.60A {Azotobacter vinelandii} Length = 276 | Back alignment and structure |
|---|
| >3k4o_A Isopentenyl phosphate kinase; small molecule kinase, ATP-binding, transferase, methanocald jannaschii, isopentenyl monophosphate; 2.05A {Methanocaldococcus jannaschii} PDB: 3k4y_A* 3k52_A* 3k56_A* Length = 266 | Back alignment and structure |
|---|
| >3ll5_A Gamma-glutamyl kinase related protein; alternate mevalonate pathway, isopentenyl phsophate kinase, beta-alpha sandwich fold; HET: MSE ADP IPE ATP IP8; 1.99A {Thermoplasma acidophilum} PDB: 3lkk_A* Length = 249 | Back alignment and structure |
|---|
| >3ll9_A Isopentenyl phosphate kinase; mevalonate biosynthesis isoprenoid, transferase; HET: ADP; 2.15A {Methanothermobacter thermautotrophicusorganism_taxid} Length = 269 | Back alignment and structure |
|---|
| >3d40_A FOMA protein; fosfomycin, antibiotic resistance, kinase, phosphoryl transfer, transferase; 1.53A {Streptomyces wedmorensis} PDB: 3d41_A* 3qun_A* 3quo_A* 3qur_A* 3qvf_A* 3qvh_A* Length = 286 | Back alignment and structure |
|---|
| >3tvi_A Aspartokinase; structural genomics, ACT domains, regulatory domains, kinase transferase, PSI-2, protein structure initiative; HET: LYS; 3.00A {Clostridium acetobutylicum} Length = 446 | Back alignment and structure |
|---|
| >2j0w_A Lysine-sensitive aspartokinase 3; feedback inhibition, allosteric regulation, ACT domain, transferase, amino acid biosynthesis; HET: ADP; 2.5A {Escherichia coli} SCOP: c.73.1.3 d.58.18.10 d.58.18.10 PDB: 2j0x_A* Length = 449 | Back alignment and structure |
|---|
| >2j5v_A Glutamate 5-kinase; proline biosynthesis, gamma glutamyl kinase, amino-acid biosynthesis, transferase, feedback regulation, PUA domain; HET: RGP; 2.5A {Escherichia coli} PDB: 2j5t_A* 2w21_A Length = 367 | Back alignment and structure |
|---|
| >2cdq_A Aspartokinase; aspartate kinase, amino acid metabolism, ACT domain, alloste S-adenosylmethionine, lysine, allosteric effector, plant; HET: TAR SAM LYS; 2.85A {Arabidopsis thaliana} SCOP: c.73.1.3 d.58.18.10 d.58.18.10 Length = 510 | Back alignment and structure |
|---|
| >2ako_A Glutamate 5-kinase; structural genomics, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics, nysgxrc; HET: ADP; 2.20A {Campylobacter jejuni} SCOP: c.73.1.3 Length = 251 | Back alignment and structure |
|---|
| >3ab4_A Aspartokinase; aspartate kinase, concerted inhibition, alternative initiati amino-acid biosynthesis, ATP-binding; HET: LYS; 2.47A {Corynebacterium glutamicum} PDB: 3aaw_A* 3ab2_A Length = 421 | Back alignment and structure |
|---|
| >3l76_A Aspartokinase; allostery, ACT domains, kinase transferase; HET: LYS; 2.54A {Synechocystis} Length = 600 | Back alignment and structure |
|---|
| >1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 | Back alignment and structure |
|---|
| >1e19_A Carbamate kinase-like carbamoylphosphate synthetase; transferase, hyperthermophiles, ADP site, phosphoryl group transfer; HET: ADP; 1.5A {Pyrococcus furiosus} SCOP: c.73.1.1 Length = 314 | Back alignment and structure |
|---|
| >2we5_A Carbamate kinase 1; arginine catabolism, arginine metabolism, ATP synthesys, open alpha/beta sheet, phosphotransferase, transferase; HET: ADP; 1.39A {Enterococcus faecalis} PDB: 1b7b_A 2we4_A* Length = 310 | Back alignment and structure |
|---|
| >2e9y_A Carbamate kinase; transferase, structural genomics, NPPSFA, national project O structural and functional analyses; 1.80A {Aeropyrum pernix} Length = 316 | Back alignment and structure |
|---|
| >3kzf_A Carbamate kinase; arginine dihydrolase pathway, giardia LAMB target, transferase; 3.00A {Giardia lamblia atcc 50803} Length = 317 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 206 | |||
| 3ek6_A | 243 | Uridylate kinase; UMPK unique GTP B site, alloster | 100.0 | |
| 1ybd_A | 239 | Uridylate kinase; alpha/beta/alpha fold, hexamer, | 100.0 | |
| 4a7w_A | 240 | Uridylate kinase; transferase; HET: GTP; 1.80A {He | 100.0 | |
| 1z9d_A | 252 | Uridylate kinase, UK, UMP kinase; structural genom | 100.0 | |
| 2a1f_A | 247 | Uridylate kinase; PYRH, structural genomics, PSI, | 100.0 | |
| 2va1_A | 256 | Uridylate kinase; UMPK, transferase, pyrimidine bi | 100.0 | |
| 2jjx_A | 255 | Uridylate kinase, UMP kinase; structural genomics, | 100.0 | |
| 3nwy_A | 281 | Uridylate kinase; allosterically activated form, A | 100.0 | |
| 2j4j_A | 226 | Uridylate kinase; transferase, nucleoside monophos | 100.0 | |
| 2brx_A | 244 | Uridylate kinase; UMP kinase, amino acid kinase, p | 100.0 | |
| 3ll9_A | 269 | Isopentenyl phosphate kinase; mevalonate biosynthe | 100.0 | |
| 2ij9_A | 219 | Uridylate kinase; structural genomics, protein str | 100.0 | |
| 3ll5_A | 249 | Gamma-glutamyl kinase related protein; alternate m | 100.0 | |
| 2ogx_A | 276 | Molybdenum storage protein subunit alpha; open alp | 100.0 | |
| 2ap9_A | 299 | NAG kinase, acetylglutamate kinase, AGK; structura | 100.0 | |
| 2ogx_B | 270 | Molybdenum storage protein subunit beta; open alph | 99.98 | |
| 2rd5_A | 298 | Acetylglutamate kinase-like protein; protein-prote | 99.98 | |
| 2v5h_A | 321 | Acetylglutamate kinase; amino-acid biosynthesis, t | 99.98 | |
| 3k4o_A | 266 | Isopentenyl phosphate kinase; small molecule kinas | 99.98 | |
| 2ako_A | 251 | Glutamate 5-kinase; structural genomics, PSI, prot | 99.97 | |
| 2j5v_A | 367 | Glutamate 5-kinase; proline biosynthesis, gamma gl | 99.97 | |
| 2egx_A | 269 | Putative acetylglutamate kinase; struc genomics, N | 99.97 | |
| 3d40_A | 286 | FOMA protein; fosfomycin, antibiotic resistance, k | 99.97 | |
| 3ab4_A | 421 | Aspartokinase; aspartate kinase, concerted inhibit | 99.97 | |
| 2buf_A | 300 | Acetylglutamate kinase; acetyglutamate kinase, ADP | 99.97 | |
| 1gs5_A | 258 | Acetylglutamate kinase; carbamate kinase, amino ac | 99.97 | |
| 2bty_A | 282 | Acetylglutamate kinase; N-acetyl-L-glutamate kinas | 99.97 | |
| 3l76_A | 600 | Aspartokinase; allostery, ACT domains, kinase tran | 99.97 | |
| 3zzh_A | 307 | Acetylglutamate kinase; transferase, arginine bios | 99.96 | |
| 2e9y_A | 316 | Carbamate kinase; transferase, structural genomics | 99.95 | |
| 3c1m_A | 473 | Probable aspartokinase; allosteric inhibition, thr | 99.95 | |
| 2cdq_A | 510 | Aspartokinase; aspartate kinase, amino acid metabo | 99.95 | |
| 2we5_A | 310 | Carbamate kinase 1; arginine catabolism, arginine | 99.95 | |
| 4ab7_A | 464 | Protein Arg5,6, mitochondrial; transferase, argini | 99.95 | |
| 3d2m_A | 456 | Putative acetylglutamate synthase; protein-COA-Glu | 99.95 | |
| 3s6g_A | 460 | N-acetylglutamate kinase / N-acetylglutamate SYNT; | 99.94 | |
| 1e19_A | 314 | Carbamate kinase-like carbamoylphosphate synthetas | 99.94 | |
| 3tvi_A | 446 | Aspartokinase; structural genomics, ACT domains, r | 99.94 | |
| 2j0w_A | 449 | Lysine-sensitive aspartokinase 3; feedback inhibit | 99.94 | |
| 3l86_A | 279 | Acetylglutamate kinase; ARGB, amino-acid biosynthe | 99.94 | |
| 3s6k_A | 467 | Acetylglutamate kinase; synthase, transferase; 2.8 | 99.92 | |
| 3kzf_A | 317 | Carbamate kinase; arginine dihydrolase pathway, gi | 99.9 | |
| 4axs_A | 332 | Carbamate kinase; oxidoreductase; 2.50A {Mycoplasm | 99.9 |
| >3ek6_A Uridylate kinase; UMPK unique GTP B site, allosteric regulation, ATP-binding, nucleotid binding, pyrimidine biosynthesis, transferase; 2.34A {Xanthomonas campestris PV} SCOP: c.73.1.0 PDB: 3ek5_A | Back alignment and structure |
|---|
Probab=100.00 E-value=2.6e-41 Score=279.20 Aligned_cols=193 Identities=52% Similarity=0.922 Sum_probs=177.8
Q ss_pred ceEEEEEcCChhhhhhhhhhcCCCChhhhhHHHHHHHHHHHHHHHHHHHhCCCCceEecccccccccchhHHHHHHHHhh
Q 028621 2 FQVAIVVGGGNIFRGASAAGNSGLDRSSADYIGMLATVMNAIFLQATMESIGIPTRVQTAFRMSEVAEPYIRRRAVRHLE 81 (206)
Q Consensus 2 ~~~iiVhGGG~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~ll~~~l~~~gi~a~~l~~~~~~~v~~~~~~~~l~~~l~ 81 (206)
++++||||||+++++.. ..+++++....|+++++++++|+.+++.+|++.|+++..+++++...+.+++..+.+.++|+
T Consensus 49 ~~vviV~gGG~~~~~~~-~~~~g~~~~~~d~~g~l~t~~N~~~l~~al~~~G~~a~~~~~~~~~~v~~~~~~~~~~~lL~ 127 (243)
T 3ek6_A 49 AQVALVIGGGNIFRGAG-LAASGMDRVTGDHMGMLATVINALAMQDALEKLGAKVRVMSAIKINDVCEDFIRRRAIRHLE 127 (243)
T ss_dssp CEEEEEECSTTTSCSTT-TSCSSSCHHHHHHHHHHHHHHHHHHHHHHHHHTTCCEEEEESSCBTTTBEECCHHHHHHHHH
T ss_pred CeEEEEECCCHHHHHHH-HHHcCCCCCCHHHHHHHHHHHHHHHHHHHHHHcCCCeEEechhhcCcccCcCCHHHHHHHHH
Confidence 58999999999877653 45689988888999999999999988889999999999999999877666655677889999
Q ss_pred CCCEEEEeCCCCCCCCCcHHHHHHHHHhcCCcEEEEeeccCccccCCCCCCCCCcccccccHHHHhcCCcCcchHHHHHH
Q 028621 82 KGRVVIFAAGTGNPFFTTDTAAALRCAEINAEVVLKATNVDGVYDDNPRRNPNARLLDTLTYQEVTSKDLSVMDMTAITL 161 (206)
Q Consensus 82 ~g~ipvi~g~~g~~~~~sD~~A~~lA~~l~A~~li~ltdV~Gv~~~dP~~~~~a~~i~~i~~~e~~~~g~~~~k~~a~~~ 161 (206)
+|.|||++|+.|.+++++|++|+++|.+|+||+|+++|||||||++||+.+|+++++++++++|+.+.|.++||++|+..
T Consensus 128 ~g~IpVv~~~~g~~~~~~D~~Aa~lA~~l~Ad~li~lTdVdGvy~~dp~~~p~a~~i~~i~~~e~~~~g~~~~~~~a~~~ 207 (243)
T 3ek6_A 128 KGRIAIFAAGTGNPFFTTDSGAALRAIEIGADLLLKATKVDGVYDKDPKKHSDAVRYDSLTYDEVIMQGLEVMDTAAFAL 207 (243)
T ss_dssp TTCEEEEESTTSSTTCCHHHHHHHHHHHHTCSEEEEECSSSSCBSSCGGGCTTCCBCSEECHHHHHHHTCCSSCHHHHHH
T ss_pred CCcEEEEECCCCCCcCChHHHHHHHHHHcCCCEEEEEeCCCccCCCCCCCCCCceecccccHHHHHhCCchhHHHHHHHH
Confidence 99999999988899999999999999999999999999999999999999999999999999988766777899999999
Q ss_pred HHhCCCcEEEEcCCCCchHHHHhcCCCcceEEec
Q 028621 162 CQENNIPVVVFNLNQPGNIAKAIQGERVGTLIGG 195 (206)
Q Consensus 162 a~~~gi~v~I~~g~~~~~l~~~l~g~~~GT~i~~ 195 (206)
|.++|++++|+|+++|++|.++|+|+.+||+|.+
T Consensus 208 a~~~gv~v~I~~g~~~~~l~~~l~g~~~GT~i~~ 241 (243)
T 3ek6_A 208 ARDSDLPLRIFGMSEPGVLLRILHGAQIGTLVQG 241 (243)
T ss_dssp HHHTTCCEEEECCCSTTHHHHHHTTCCCSEEECC
T ss_pred HHHCCCeEEEEcCCCccHHHHHHCCCCCceEEee
Confidence 9999999999999999999999999999999987
|
| >1ybd_A Uridylate kinase; alpha/beta/alpha fold, hexamer, structural genomics, structure initiative, PSI; 2.60A {Neisseria meningitidis} SCOP: c.73.1.3 | Back alignment and structure |
|---|
| >4a7w_A Uridylate kinase; transferase; HET: GTP; 1.80A {Helicobacter pylori} PDB: 4a7x_A* | Back alignment and structure |
|---|
| >1z9d_A Uridylate kinase, UK, UMP kinase; structural genomics, protein structure initiative, NYSGXRC, PYRH, putative uridylate kinase, PSI; 2.80A {Streptococcus pyogenes} SCOP: c.73.1.3 | Back alignment and structure |
|---|
| >2a1f_A Uridylate kinase; PYRH, structural genomics, PSI, protein ST initiative, NEW YORK SGX research center for structural GEN nysgxrc; 2.10A {Haemophilus influenzae} SCOP: c.73.1.3 PDB: 2bne_A* 2bnf_A* 2v4y_A* 2bnd_A* | Back alignment and structure |
|---|
| >2va1_A Uridylate kinase; UMPK, transferase, pyrimidine biosynthesis, amino acid kinase family; 2.50A {Ureaplasma parvum} | Back alignment and structure |
|---|
| >2jjx_A Uridylate kinase, UMP kinase; structural genomics, pyrimidine biosynthesis, ATP-binding, nucleotide-binding, OPPF, PYRH, cytoplasm; HET: ATP; 2.82A {Bacillus anthracis} | Back alignment and structure |
|---|
| >3nwy_A Uridylate kinase; allosterically activated form, AAK fold, UMP kinase, transfe; HET: GTP UDP; 2.54A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2j4j_A Uridylate kinase; transferase, nucleoside monophosphate kinase, UMP kinase, aspartokinase fold, pyrimidine nucleotide synthesis; HET: U5P ACP 4TC; 2.1A {Sulfolobus solfataricus} PDB: 2j4k_A* 2j4l_A* | Back alignment and structure |
|---|
| >2brx_A Uridylate kinase; UMP kinase, amino acid kinase, phosphoryl group transfer, pyrimidine biosynthesis, transferase; 2.40A {Pyrococcus furiosus} SCOP: c.73.1.3 PDB: 2ji5_A* 2bmu_A* 2bri_A* | Back alignment and structure |
|---|
| >3ll9_A Isopentenyl phosphate kinase; mevalonate biosynthesis isoprenoid, transferase; HET: ADP; 2.15A {Methanothermobacter thermautotrophicusorganism_taxid} | Back alignment and structure |
|---|
| >2ij9_A Uridylate kinase; structural genomics, protein structure initiative, P nysgxrc; 2.90A {Archaeoglobus fulgidus} SCOP: c.73.1.3 | Back alignment and structure |
|---|
| >3ll5_A Gamma-glutamyl kinase related protein; alternate mevalonate pathway, isopentenyl phsophate kinase, beta-alpha sandwich fold; HET: MSE ADP IPE ATP IP8; 1.99A {Thermoplasma acidophilum} PDB: 3lkk_A* | Back alignment and structure |
|---|
| >2ogx_A Molybdenum storage protein subunit alpha; open alpha/beta structure, metal binding protein; HET: ATP; 1.60A {Azotobacter vinelandii} | Back alignment and structure |
|---|
| >2ap9_A NAG kinase, acetylglutamate kinase, AGK; structural genomics, protein structure initiative, NYSGXRC, PSI; 2.80A {Mycobacterium tuberculosis} SCOP: c.73.1.2 | Back alignment and structure |
|---|
| >2ogx_B Molybdenum storage protein subunit beta; open alpha/beta structure, metal binding protein; HET: ATP; 1.60A {Azotobacter vinelandii} | Back alignment and structure |
|---|
| >2rd5_A Acetylglutamate kinase-like protein; protein-protein complex, regulation of arginine biosynthesis nitrogen metabolism, kinase, transferase, transcription; HET: ARG ADP NLG ATP; 2.51A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2v5h_A Acetylglutamate kinase; amino-acid biosynthesis, transcription regulation, transfera cyanobacteria, transcription; HET: NLG; 2.75A {Synechococcus elongatus} PDB: 2jj4_A* | Back alignment and structure |
|---|
| >3k4o_A Isopentenyl phosphate kinase; small molecule kinase, ATP-binding, transferase, methanocald jannaschii, isopentenyl monophosphate; 2.05A {Methanocaldococcus jannaschii} PDB: 3k4y_A* 3k52_A* 3k56_A* | Back alignment and structure |
|---|
| >2ako_A Glutamate 5-kinase; structural genomics, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics, nysgxrc; HET: ADP; 2.20A {Campylobacter jejuni} SCOP: c.73.1.3 | Back alignment and structure |
|---|
| >2j5v_A Glutamate 5-kinase; proline biosynthesis, gamma glutamyl kinase, amino-acid biosynthesis, transferase, feedback regulation, PUA domain; HET: RGP; 2.5A {Escherichia coli} PDB: 2j5t_A* 2w21_A | Back alignment and structure |
|---|
| >3d40_A FOMA protein; fosfomycin, antibiotic resistance, kinase, phosphoryl transfer, transferase; 1.53A {Streptomyces wedmorensis} PDB: 3d41_A* 3qun_A* 3quo_A* 3qur_A* 3qvf_A* 3qvh_A* | Back alignment and structure |
|---|
| >3ab4_A Aspartokinase; aspartate kinase, concerted inhibition, alternative initiati amino-acid biosynthesis, ATP-binding; HET: LYS; 2.47A {Corynebacterium glutamicum} PDB: 3aaw_A* 3ab2_A | Back alignment and structure |
|---|
| >2buf_A Acetylglutamate kinase; acetyglutamate kinase, ADP, arginine biosynthesis, FEED-BACK inhibition, hexamer, transferase; HET: NLG ADP; 2.95A {Pseudomonas aeruginosa} SCOP: c.73.1.2 | Back alignment and structure |
|---|
| >1gs5_A Acetylglutamate kinase; carbamate kinase, amino acid kinase, arginine biosynthesis, phosphoryl group transfer, protein crystallography; HET: NLG ANP; 1.5A {Escherichia coli} SCOP: c.73.1.2 PDB: 1gsj_A* 1oh9_A* 1oha_A* 1ohb_A* 2wxb_A 2x2w_A* 3t7b_A* | Back alignment and structure |
|---|
| >2bty_A Acetylglutamate kinase; N-acetyl-L-glutamate kinase, amino acid kinase, phosphoryl group transfer, arginine metabolism, transferase; HET: ARG NLG; 2.75A {Thermotoga maritima} SCOP: c.73.1.2 | Back alignment and structure |
|---|
| >3l76_A Aspartokinase; allostery, ACT domains, kinase transferase; HET: LYS; 2.54A {Synechocystis} | Back alignment and structure |
|---|
| >3zzh_A Acetylglutamate kinase; transferase, arginine biosynthesis; HET: ARG NLG; 2.10A {Saccharomyces cerevisiae} PDB: 3zzg_A 3zzf_A* | Back alignment and structure |
|---|
| >2e9y_A Carbamate kinase; transferase, structural genomics, NPPSFA, national project O structural and functional analyses; 1.80A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >2cdq_A Aspartokinase; aspartate kinase, amino acid metabolism, ACT domain, alloste S-adenosylmethionine, lysine, allosteric effector, plant; HET: TAR SAM LYS; 2.85A {Arabidopsis thaliana} SCOP: c.73.1.3 d.58.18.10 d.58.18.10 | Back alignment and structure |
|---|
| >2we5_A Carbamate kinase 1; arginine catabolism, arginine metabolism, ATP synthesys, open alpha/beta sheet, phosphotransferase, transferase; HET: ADP; 1.39A {Enterococcus faecalis} PDB: 1b7b_A 2we4_A* | Back alignment and structure |
|---|
| >4ab7_A Protein Arg5,6, mitochondrial; transferase, arginine biosynthesis, amino acid kinase domain GCN5-related acetyltransferase, GNAT; HET: NLG; 3.25A {Saccharomyces cerevisiae} PDB: 3zzi_A* | Back alignment and structure |
|---|
| >3d2m_A Putative acetylglutamate synthase; protein-COA-Glu ternary complex, transferase; HET: COA GLU; 2.21A {Neisseria gonorrhoeae} PDB: 2r8v_A* 3b8g_A* 2r98_A* 3d2p_A* | Back alignment and structure |
|---|
| >3s6g_A N-acetylglutamate kinase / N-acetylglutamate SYNT; synthase, transferase; HET: COA; 2.67A {Maricaulis maris} PDB: 3s7y_A 3s6h_A* | Back alignment and structure |
|---|
| >1e19_A Carbamate kinase-like carbamoylphosphate synthetase; transferase, hyperthermophiles, ADP site, phosphoryl group transfer; HET: ADP; 1.5A {Pyrococcus furiosus} SCOP: c.73.1.1 | Back alignment and structure |
|---|
| >3tvi_A Aspartokinase; structural genomics, ACT domains, regulatory domains, kinase transferase, PSI-2, protein structure initiative; HET: LYS; 3.00A {Clostridium acetobutylicum} | Back alignment and structure |
|---|
| >2j0w_A Lysine-sensitive aspartokinase 3; feedback inhibition, allosteric regulation, ACT domain, transferase, amino acid biosynthesis; HET: ADP; 2.5A {Escherichia coli} SCOP: c.73.1.3 d.58.18.10 d.58.18.10 PDB: 2j0x_A* | Back alignment and structure |
|---|
| >3l86_A Acetylglutamate kinase; ARGB, amino-acid biosynthesis, arginine biosynthesi binding, nucleotide-binding, transferase; HET: ADP NLG; 2.06A {Streptococcus mutans} | Back alignment and structure |
|---|
| >3s6k_A Acetylglutamate kinase; synthase, transferase; 2.80A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >3kzf_A Carbamate kinase; arginine dihydrolase pathway, giardia LAMB target, transferase; 3.00A {Giardia lamblia atcc 50803} | Back alignment and structure |
|---|
| >4axs_A Carbamate kinase; oxidoreductase; 2.50A {Mycoplasma penetrans} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 206 | ||||
| d2a1fa1 | 236 | c.73.1.3 (A:2-237) Uridylate kinase PyrH {Haemophi | 7e-42 | |
| d2ij9a1 | 219 | c.73.1.3 (A:1-219) Uridylate kinase PyrH {Archaeog | 2e-38 | |
| d1ybda1 | 236 | c.73.1.3 (A:6-241) Uridylate kinase PyrH {Neisseri | 8e-38 | |
| d1z9da1 | 238 | c.73.1.3 (A:4-241) Uridylate kinase PyrH {Streptoc | 3e-35 | |
| d2brxa1 | 225 | c.73.1.3 (A:1-225) Uridylate kinase PyrH {Pyrococc | 2e-28 | |
| d2cdqa1 | 304 | c.73.1.3 (A:25-328) Aspartokinase {Thale cress (Ar | 2e-19 | |
| d2hmfa1 | 302 | c.73.1.3 (A:2-303) Aspartokinase {Methanococcus ja | 6e-18 | |
| d2j0wa1 | 292 | c.73.1.3 (A:3-294) Aspartokinase {Escherichia coli | 3e-17 | |
| d2akoa1 | 250 | c.73.1.3 (A:2-251) Glutamate 5-kinase {Campylobact | 6e-11 |
| >d2a1fa1 c.73.1.3 (A:2-237) Uridylate kinase PyrH {Haemophilus influenzae [TaxId: 727]} Length = 236 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Carbamate kinase-like superfamily: Carbamate kinase-like family: PyrH-like domain: Uridylate kinase PyrH species: Haemophilus influenzae [TaxId: 727]
Score = 139 bits (350), Expect = 7e-42
Identities = 81/188 (43%), Positives = 125/188 (66%)
Query: 6 IVVGGGNIFRGASAAGNSGLDRSSADYIGMLATVMNAIFLQATMESIGIPTRVQTAFRMS 65
VV GG + +G++R D++GMLATVMN + ++ ++ + ++ +AF+++
Sbjct: 48 SVVLGGGNLFRGAKLAKAGMNRVVGDHMGMLATVMNGLAMRDSLFRADVNAKLMSAFQLN 107
Query: 66 EVAEPYIRRRAVRHLEKGRVVIFAAGTGNPFFTTDTAAALRCAEINAEVVLKATNVDGVY 125
+ + Y A++ L + RVVIF+AGTGNPFFTTD+ A LR EI A+VVLKAT VDGVY
Sbjct: 108 GICDTYNWSEAIKMLREKRVVIFSAGTGNPFFTTDSTACLRGIEIEADVVLKATKVDGVY 167
Query: 126 DDNPRRNPNARLLDTLTYQEVTSKDLSVMDMTAITLCQENNIPVVVFNLNQPGNIAKAIQ 185
D +P +NP+A+L L+Y EV K+L VMD++A TL +++ +P+ VFN+ +PG + + +
Sbjct: 168 DCDPAKNPDAKLYKNLSYAEVIDKELKVMDLSAFTLARDHGMPIRVFNMGKPGALRQVVT 227
Query: 186 GERVGTLI 193
G GT I
Sbjct: 228 GTEEGTTI 235
|
| >d2ij9a1 c.73.1.3 (A:1-219) Uridylate kinase PyrH {Archaeoglobus fulgidus [TaxId: 2234]} Length = 219 | Back information, alignment and structure |
|---|
| >d1ybda1 c.73.1.3 (A:6-241) Uridylate kinase PyrH {Neisseria meningitidis [TaxId: 487]} Length = 236 | Back information, alignment and structure |
|---|
| >d1z9da1 c.73.1.3 (A:4-241) Uridylate kinase PyrH {Streptococcus pyogenes [TaxId: 1314]} Length = 238 | Back information, alignment and structure |
|---|
| >d2brxa1 c.73.1.3 (A:1-225) Uridylate kinase PyrH {Pyrococcus furiosus [TaxId: 2261]} Length = 225 | Back information, alignment and structure |
|---|
| >d2cdqa1 c.73.1.3 (A:25-328) Aspartokinase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 304 | Back information, alignment and structure |
|---|
| >d2hmfa1 c.73.1.3 (A:2-303) Aspartokinase {Methanococcus jannaschii [TaxId: 2190]} Length = 302 | Back information, alignment and structure |
|---|
| >d2j0wa1 c.73.1.3 (A:3-294) Aspartokinase {Escherichia coli [TaxId: 562]} Length = 292 | Back information, alignment and structure |
|---|
| >d2akoa1 c.73.1.3 (A:2-251) Glutamate 5-kinase {Campylobacter jejuni [TaxId: 197]} Length = 250 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 206 | |||
| d2brxa1 | 225 | Uridylate kinase PyrH {Pyrococcus furiosus [TaxId: | 100.0 | |
| d2ij9a1 | 219 | Uridylate kinase PyrH {Archaeoglobus fulgidus [Tax | 100.0 | |
| d2a1fa1 | 236 | Uridylate kinase PyrH {Haemophilus influenzae [Tax | 99.97 | |
| d1ybda1 | 236 | Uridylate kinase PyrH {Neisseria meningitidis [Tax | 99.97 | |
| d2cdqa1 | 304 | Aspartokinase {Thale cress (Arabidopsis thaliana) | 99.97 | |
| d2j0wa1 | 292 | Aspartokinase {Escherichia coli [TaxId: 562]} | 99.96 | |
| d2akoa1 | 250 | Glutamate 5-kinase {Campylobacter jejuni [TaxId: 1 | 99.96 | |
| d2bufa1 | 300 | N-acetyl-l-glutamate kinase {Pseudomonas aeruginos | 99.96 | |
| d2hmfa1 | 302 | Aspartokinase {Methanococcus jannaschii [TaxId: 21 | 99.96 | |
| d2ap9a1 | 291 | N-acetyl-l-glutamate kinase {Mycobacterium tubercu | 99.95 | |
| d2btya1 | 282 | N-acetyl-l-glutamate kinase {Thermotoga maritima [ | 99.95 | |
| d1z9da1 | 238 | Uridylate kinase PyrH {Streptococcus pyogenes [Tax | 99.94 | |
| d1e19a_ | 313 | Carbamate kinase {Archaeon Pyrococcus furiosus [Ta | 99.91 | |
| d1b7ba_ | 307 | Carbamate kinase {Enterococcus faecium [TaxId: 135 | 99.87 | |
| d1gs5a_ | 258 | N-acetyl-l-glutamate kinase {Escherichia coli [Tax | 99.81 | |
| d2ftsa3 | 155 | Gephyrin, domain 5 {Rat (Rattus norvegicus) [TaxId | 88.28 |
| >d2brxa1 c.73.1.3 (A:1-225) Uridylate kinase PyrH {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Carbamate kinase-like superfamily: Carbamate kinase-like family: PyrH-like domain: Uridylate kinase PyrH species: Pyrococcus furiosus [TaxId: 2261]
Probab=100.00 E-value=2.8e-36 Score=244.22 Aligned_cols=180 Identities=27% Similarity=0.443 Sum_probs=154.4
Q ss_pred ceEEEEEcCChhhhhhh-hhhcCCCChhhhhHHHHHHHHHHHHHHHHHHHhCCCCceEecccccccccchhHHHHHHHHh
Q 028621 2 FQVAIVVGGGNIFRGAS-AAGNSGLDRSSADYIGMLATVMNAIFLQATMESIGIPTRVQTAFRMSEVAEPYIRRRAVRHL 80 (206)
Q Consensus 2 ~~~iiVhGGG~~~~~~~-~~~~~~l~~~~~~~~~~~~~~~~~~ll~~~l~~~gi~a~~l~~~~~~~v~~~~~~~~l~~~l 80 (206)
++++||||||++++++. .+++++.++...+.....++++|+.+++..|++.|++....+ + ....+++
T Consensus 36 ~~~viV~ggG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~----------~--~~~~~~l 103 (225)
T d2brxa1 36 HEVAVVVGGGKLARKYIEVAEKFNSSETFKDFIGIQITRANAMLLIAALREKAYPVVVED----------F--WEAWKAV 103 (225)
T ss_dssp SEEEEEECCHHHHHHHHHHHHTTTCCHHHHHHHHHHHHHHHHHHHHHHHGGGBCSSCBCS----------H--HHHHHHH
T ss_pred CcEEEEECccHHHHHHHHhhhhcchhhHHHHHhhhhHHHHHHHHHHHHHHhhhccccccc----------H--HHHHHHH
Confidence 47899999999998875 556788888888999999999999999999998888764321 1 1234678
Q ss_pred hCCCEEEEeCCCCCCCCCcHHHHHHHHHhcCCcEEEEeeccCccccCCCCCCCCCcccccccHHHHhcC--------CcC
Q 028621 81 EKGRVVIFAAGTGNPFFTTDTAAALRCAEINAEVVLKATNVDGVYDDNPRRNPNARLLDTLTYQEVTSK--------DLS 152 (206)
Q Consensus 81 ~~g~ipvi~g~~g~~~~~sD~~A~~lA~~l~A~~li~ltdV~Gv~~~dP~~~~~a~~i~~i~~~e~~~~--------g~~ 152 (206)
+.+.+|+++++ .++.+||++|+++|..++||+|+++||||||||+||+++|++++|++++++|+.++ |++
T Consensus 104 ~~~~ipv~~~~--~~~~~~D~lAa~lA~~l~Ad~lii~TDVdGVyt~dP~~~~~Ak~i~~i~~~e~~~~~~~~~~~~g~g 181 (225)
T d2brxa1 104 QLKKIPVMGGT--HPGHTTDAVAALLAEFLKADLLVVITNVDGVYTADPKKDPTAKKIKKMKPEELLEIVGKGIEKAGSS 181 (225)
T ss_dssp HTTCBCEECCC--STTCCHHHHHHHHHHHTTCSEEEEECSSSSCBSSCTTTCTTCCBCSEECHHHHHHHHHC--------
T ss_pred HhcccccccCC--CCCcchhHHHHHHHHHhCchhhhhhhhhhhhhhcccccccccccceEEecchHHHHhccCccccCCC
Confidence 89999999764 57889999999999999999999999999999999999999999999999987754 233
Q ss_pred cc-hHHHHHHHHhCCCcEEEEcCCCCchHHHHhcCCCcceEEec
Q 028621 153 VM-DMTAITLCQENNIPVVVFNLNQPGNIAKAIQGERVGTLIGG 195 (206)
Q Consensus 153 ~~-k~~a~~~a~~~gi~v~I~~g~~~~~l~~~l~g~~~GT~i~~ 195 (206)
+| +..|++.|.++|++++|+||++|++|.++++|+.+||+|.|
T Consensus 182 g~~~k~Aa~~a~~~gi~v~I~ng~~~~~l~~~l~ge~~GT~i~P 225 (225)
T d2brxa1 182 SVIDPLAAKIIARSGIKTIVIGKEDAKDLFRVIKGDHNGTTIEP 225 (225)
T ss_dssp CCSCHHHHHHHHHHTCCEEEECHHHHTCHHHHHTTCSSSEEECC
T ss_pred CcccHHHHHHHHHCCCcEEEEeCCCcchHHHHHCCCCCCcEecC
Confidence 34 55588999999999999999999999999999999999976
|
| >d2ij9a1 c.73.1.3 (A:1-219) Uridylate kinase PyrH {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2a1fa1 c.73.1.3 (A:2-237) Uridylate kinase PyrH {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1ybda1 c.73.1.3 (A:6-241) Uridylate kinase PyrH {Neisseria meningitidis [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d2cdqa1 c.73.1.3 (A:25-328) Aspartokinase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2j0wa1 c.73.1.3 (A:3-294) Aspartokinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2akoa1 c.73.1.3 (A:2-251) Glutamate 5-kinase {Campylobacter jejuni [TaxId: 197]} | Back information, alignment and structure |
|---|
| >d2bufa1 c.73.1.2 (A:2-301) N-acetyl-l-glutamate kinase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2hmfa1 c.73.1.3 (A:2-303) Aspartokinase {Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2ap9a1 c.73.1.2 (A:6-296) N-acetyl-l-glutamate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2btya1 c.73.1.2 (A:1-282) N-acetyl-l-glutamate kinase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1z9da1 c.73.1.3 (A:4-241) Uridylate kinase PyrH {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1e19a_ c.73.1.1 (A:) Carbamate kinase {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1b7ba_ c.73.1.1 (A:) Carbamate kinase {Enterococcus faecium [TaxId: 1352]} | Back information, alignment and structure |
|---|
| >d1gs5a_ c.73.1.2 (A:) N-acetyl-l-glutamate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2ftsa3 c.57.1.2 (A:499-653) Gephyrin, domain 5 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|