Citrus Sinensis ID: 028774

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200----

MVSEQTGLVGLQAAVMEPEICRGMILLNISLRMLHIKKQPWYGRPLIRSFQNLLRNTAAGKLFYKMVATSESVRNILCQCYNDTSQVTEELVEKILQPGLETGAADVFLEFICYSGGPLPEELLPQVKCPVLIAWGDKDPWEPIELGRAYGNFDSVEDFIVLPNVGHCPQDEAPHLVNPLVESFVTRHATPPASVSAASLYSSN

ccccHHHHHHHHHHHHcccccccEEEEcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHccccccccHHHHHHHHHHcccccHHHHHHHHHHHcccccHHHHcccccccEEEEEcccccccccHHHHHHHHHcccccEEEEcccccccccccHHHHHHHHHHHHHHccccccccccccccccc

ccccHHHHHHHHHHHHcHHHEEEEEEEEcccccccccccccHHHHHHHHHHHHHccccHHHHHHHHHHcHHHHHHHHHHHHccHHHHHHHHHHHHHcccccccHHHHHHHHHcccccccHHHHHccccccEEEEEccccccccHHHHHHHHHcccccEEEEccccccccccccHHHHHHHHHHHHHHHccccccccccEEEccc

mvseqtglvglqaavmepeICRGMILLNISLRMLhikkqpwygrplIRSFQNLLRNTAAGKLFYKMVATSESVRNILCQCYNDTSQVTEELVEKILQPGLETGAADVFLEFICysggplpeellpqvkcpvliawgdkdpwepielgraygnfdsvedfivlpnvghcpqdeaphlvnpLVESFvtrhatppasvsaaslyssn

mvseqtglvglqaavmepeICRGMILLNISLRMLHIKKQPWYGRPLIRSFQNLLRNTAAGKLFYKMVATSESVRNILCQCYNDTSQVTEELVEKILQPGLETGAADVFLEFICYSGGPLPEELLPQVKCPVLIAWGDKDPWEPIELGRAYGNFDSVEDFIVLPNVGHCPQDEAPHLVNPLVESFVTrhatppasvsaaslyssn

*******LVGLQAAVMEPEICRGMILLNISLRMLHIKKQPWYGRPLIRSFQNLLRNTAAGKLFYKMVATSESVRNILCQCYNDTSQVTEELVEKILQPGLETGAADVFLEFICYSGGPLPEELLPQVKCPVLIAWGDKDPWEPIELGRAYGNFDSVEDFIVLPNVGHCPQDEAPHLVNPLVESFVT******************

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		204	2.2.26 [Sep-21-2011]
O05235		273	Uncharacterized hydrolase	yes	no	0.803	0.600	0.256	3e-06

>sp\|O05235\|YUGF_BACSU Uncharacterized hydrolase YugF OS=Bacillus subtilis (strain 168) GN=yugF PE=3 SV=1	Back alignment and function desciption

 Score = 52.0 bits (123), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 47/183 (25%), Positives = 80/183 (43%), Gaps = 19/183 (10%)

Query: 7   GLVGLQAAVMEPEICRGMILLNISLRMLHIKKQPWYGRPLIRSFQNLLRNTAA--GKLFY 64
           G + L AA+ +PE+   ++LL  S               L RS   ++  T      L+ 
Sbjct: 105 GQISLSAALQKPELFSKVVLLCSS-------------GYLKRSHPTIIFGTHIPYFHLYI 151

Query: 65  KMVATSESVRNILCQCYNDTSQVTEELVEKILQPGLETGAADVFLEFICYSGGPLPEELL 124
           K   + E V   L    +D S + EE+++   +P  +         FI +  G L  E L
Sbjct: 152 KRWLSKEGVMKNLLNVVHDKSLIDEEMIDGYGRPFQDEQIFKAMTRFIRHREGDLEPEQL 211

Query: 125 PQVKCPVLIAWGDKDPWEPIELG-RAYGNF-DSVEDFIVLPNVGHCPQDEAPHLVNPLVE 182
            ++  P L+ WG++D   P+E+G R + +  +SV     L   GH   +E P L++  + 
Sbjct: 212 KKMNKPALLIWGEEDRIVPMEIGKRLHADLPNSV--LYSLGQTGHLVPEERPELISEHIA 269

Query: 183 SFV 185
            F+
Sbjct: 270 DFI 272

Bacillus subtilis (strain 168) (taxid: 224308)
EC: 3EC: .EC: 1EC: .EC: -EC: .EC: -

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		204
297746468		375	unnamed protein product [Vitis vinifera]	0.931	0.506	0.868	3e-95
225435747		365	PREDICTED: dihydrolipoyllysine-residue a	0.931	0.520	0.868	4e-95
224073158		404	predicted protein [Populus trichocarpa]	0.936	0.472	0.827	1e-92
449514931		258	PREDICTED: LOW QUALITY PROTEIN: haloalka	0.916	0.724	0.823	6e-90
449463857		373	PREDICTED: epoxide hydrolase 4-like [Cuc	0.901	0.493	0.826	7e-90
357488653		351	Haloalkane dehalogenase [Medicago trunca	0.897	0.521	0.830	3e-89
147838658		368	hypothetical protein VITISV_022866 [Viti	0.897	0.497	0.836	6e-89
356567443		344	PREDICTED: dihydrolipoyllysine-residue a	0.931	0.552	0.805	9e-89
125558908		381	hypothetical protein OsI_26591 [Oryza sa	0.897	0.480	0.803	1e-86
326507074		357	predicted protein [Hordeum vulgare subsp	0.897	0.512	0.797	3e-86

>gi\|297746468\|emb\|CBI16524.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

 Score =  353 bits (905), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 165/190 (86%), Positives = 180/190 (94%)

Query: 7   GLVGLQAAVMEPEICRGMILLNISLRMLHIKKQPWYGRPLIRSFQNLLRNTAAGKLFYKM 66
           GLVGLQAAVMEP+IC+G++LLNISLRMLHIKKQPWYG+P+IRSFQNLLRNTA G+ FY+ 
Sbjct: 185 GLVGLQAAVMEPQICKGIMLLNISLRMLHIKKQPWYGKPVIRSFQNLLRNTAMGRFFYRS 244

Query: 67  VATSESVRNILCQCYNDTSQVTEELVEKILQPGLETGAADVFLEFICYSGGPLPEELLPQ 126
           VAT ESV++ILCQCY+DTSQVTEELV+KIL PGLE GA DVFLEFICYSGGPLPEELLPQ
Sbjct: 245 VATPESVKSILCQCYHDTSQVTEELVQKILLPGLEPGAVDVFLEFICYSGGPLPEELLPQ 304

Query: 127 VKCPVLIAWGDKDPWEPIELGRAYGNFDSVEDFIVLPNVGHCPQDEAPHLVNPLVESFVT 186
           VKCPVLIAWGDKDPWEPIELGRAYG FDSVEDFIVLP+VGHCPQDEAP+LVNPLVESFV 
Sbjct: 305 VKCPVLIAWGDKDPWEPIELGRAYGKFDSVEDFIVLPDVGHCPQDEAPNLVNPLVESFVA 364

Query: 187 RHATPPASVS 196
           RHA+P ASVS
Sbjct: 365 RHASPKASVS 374

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|225435747\|ref\|XP_002283601.1\| PREDICTED: dihydrolipoyllysine-residue acetyltransferase component of acetoin cleaving system-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|224073158\|ref\|XP_002304000.1\| predicted protein [Populus trichocarpa] gi\|222841432\|gb\|EEE78979.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|449514931\|ref\|XP_004164518.1\| PREDICTED: LOW QUALITY PROTEIN: haloalkane dehalogenase-like, partial [Cucumis sativus]	Back alignment and taxonomy information

>gi\|449463857\|ref\|XP_004149647.1\| PREDICTED: epoxide hydrolase 4-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|357488653\|ref\|XP_003614614.1\| Haloalkane dehalogenase [Medicago truncatula] gi\|355515949\|gb\|AES97572.1\| Haloalkane dehalogenase [Medicago truncatula]	Back alignment and taxonomy information

>gi\|147838658\|emb\|CAN65051.1\| hypothetical protein VITISV_022866 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|356567443\|ref\|XP_003551929.1\| PREDICTED: dihydrolipoyllysine-residue acetyltransferase component of acetoin cleaving system-like [Glycine max]	Back alignment and taxonomy information

>gi\|125558908\|gb\|EAZ04444.1\| hypothetical protein OsI_26591 [Oryza sativa Indica Group]	Back alignment and taxonomy information

>gi\|326507074\|dbj\|BAJ95614.1\| predicted protein [Hordeum vulgare subsp. vulgare] gi\|326532908\|dbj\|BAJ89299.1\| predicted protein [Hordeum vulgare subsp. vulgare]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		204
TAIR\|locus:2832896		359	AT5G19850 [Arabidopsis thalian	0.892	0.506	0.785	1.6e-79
TAIR\|locus:2159823		374	AT5G38520 [Arabidopsis thalian	0.784	0.427	0.319	3.7e-18
TAIR\|locus:2115440		378	AT4G36530 [Arabidopsis thalian	0.911	0.492	0.276	7e-14
TAIR\|locus:2159033		484	PPH "AT5G13800" [Arabidopsis t	0.852	0.359	0.257	2.8e-08

TAIR\|locus:2832896 AT5G19850 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 799 (286.3 bits), Expect = 1.6e-79, P = 1.6e-79
 Identities = 143/182 (78%), Positives = 165/182 (90%)

Query:     7 GLVGLQAAVMEPEICRGMILLNISLRMLHIKKQPWYGRPLIRSFQNLLRNTAAGKLFYKM 66
             GLVGLQAAV +PEICRG++L+NISLRMLHIKKQP+ GRP I+SFQNLLRNT  GKLF+K 
Sbjct:   178 GLVGLQAAVSKPEICRGLMLINISLRMLHIKKQPFIGRPFIKSFQNLLRNTPVGKLFFKS 237

Query:    67 VATSESVRNILCQCYNDTSQVTEELVEKILQPGLETGAADVFLEFICYSGGPLPEELLPQ 126
             +A  E+V++ILCQCY+D+SQVT+ELVE IL+PGLE GA DVFLEFICYSGGPLPE+LLP 
Sbjct:   238 IAKPETVKSILCQCYHDSSQVTDELVEAILRPGLEPGAVDVFLEFICYSGGPLPEDLLPL 297

Query:   127 VKCPVLIAWGDKDPWEPIELGRAYGNFDSVEDFIVLPNVGHCPQDEAPHLVNPLVESFVT 186
             VKCPVLIAWG+KDPWEPIELGRAY NFD+VEDF+VLP+ GHCPQDE P +VNPL+ESFV 
Sbjct:   298 VKCPVLIAWGEKDPWEPIELGRAYSNFDAVEDFVVLPDAGHCPQDEKPEMVNPLIESFVA 357

Query:   187 RH 188
             RH
Sbjct:   358 RH 359

GO:0005737 "cytoplasm" evidence=ISM

GO:0016787 "hydrolase activity" evidence=ISS

TAIR\|locus:2159823 AT5G38520 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2115440 AT4G36530 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2159033 PPH "AT5G13800" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		204
PLN02824		294	PLN02824, PLN02824, hydrolase, alpha/beta fold fam	1e-133
PLN02679		360	PLN02679, PLN02679, hydrolase, alpha/beta fold fam	3e-24
PLN02578		354	PLN02578, PLN02578, hydrolase	3e-20
COG0596		282	COG0596, MhpC, Predicted hydrolases or acyltransfe	4e-16
pfam12697		187	pfam12697, Abhydrolase_6, Alpha/beta hydrolase fam	9e-09
pfam00561		226	pfam00561, Abhydrolase_1, alpha/beta hydrolase fol	2e-07
PRK14875		371	PRK14875, PRK14875, acetoin dehydrogenase E2 subun	8e-07
pfam12695		145	pfam12695, Abhydrolase_5, Alpha/beta hydrolase fam	2e-04

>gnl\|CDD\|178419 PLN02824, PLN02824, hydrolase, alpha/beta fold family protein	Back alignment and domain information

 Score =  374 bits (962), Expect = e-133
 Identities = 142/182 (78%), Positives = 160/182 (87%)

Query: 7   GLVGLQAAVMEPEICRGMILLNISLRMLHIKKQPWYGRPLIRSFQNLLRNTAAGKLFYKM 66
           G+VGLQAAV  PE+ RG++L+NISLR LHIKKQPW GRP I++FQNLLR TA GK F+K 
Sbjct: 113 GVVGLQAAVDAPELVRGVMLINISLRGLHIKKQPWLGRPFIKAFQNLLRETAVGKAFFKS 172

Query: 67  VATSESVRNILCQCYNDTSQVTEELVEKILQPGLETGAADVFLEFICYSGGPLPEELLPQ 126
           VAT E+V+NILCQCY+D S VT+ELVE IL+PGLE GA DVFL+FI YSGGPLPEELLP 
Sbjct: 173 VATPETVKNILCQCYHDDSAVTDELVEAILRPGLEPGAVDVFLDFISYSGGPLPEELLPA 232

Query: 127 VKCPVLIAWGDKDPWEPIELGRAYGNFDSVEDFIVLPNVGHCPQDEAPHLVNPLVESFVT 186
           VKCPVLIAWG+KDPWEP+ELGRAY NFD+VEDFIVLP VGHCPQDEAP LVNPL+ESFV 
Sbjct: 233 VKCPVLIAWGEKDPWEPVELGRAYANFDAVEDFIVLPGVGHCPQDEAPELVNPLIESFVA 292

Query: 187 RH 188
           RH
Sbjct: 293 RH 294

Length = 294

>gnl\|CDD\|178283 PLN02679, PLN02679, hydrolase, alpha/beta fold family protein	Back alignment and domain information

>gnl\|CDD\|215315 PLN02578, PLN02578, hydrolase	Back alignment and domain information

>gnl\|CDD\|223669 COG0596, MhpC, Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|221720 pfam12697, Abhydrolase_6, Alpha/beta hydrolase family	Back alignment and domain information

>gnl\|CDD\|201306 pfam00561, Abhydrolase_1, alpha/beta hydrolase fold	Back alignment and domain information

>gnl\|CDD\|184875 PRK14875, PRK14875, acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional	Back alignment and domain information

>gnl\|CDD\|221718 pfam12695, Abhydrolase_5, Alpha/beta hydrolase family	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		204
PLN02824		294	hydrolase, alpha/beta fold family protein	99.97
PLN02679		360	hydrolase, alpha/beta fold family protein	99.95
PRK10349		256	carboxylesterase BioH; Provisional	99.94
PLN02578		354	hydrolase	99.93
KOG1454		326	consensus Predicted hydrolase/acyltransferase (alp	99.92
TIGR01738		245	bioH putative pimeloyl-BioC--CoA transferase BioH.	99.91
PRK03592		295	haloalkane dehalogenase; Provisional	99.91
PLN02965		255	Probable pheophorbidase	99.91
TIGR03343		282	biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-die	99.91
KOG4409		365	consensus Predicted hydrolase/acyltransferase (alp	99.91
TIGR02240		276	PHA_depoly_arom poly(3-hydroxyalkanoate) depolymer	99.9
PRK07581		339	hypothetical protein; Validated	99.9
PRK06489		360	hypothetical protein; Provisional	99.9
TIGR03056		278	bchO_mg_che_rel putative magnesium chelatase acces	99.89
PRK08775		343	homoserine O-acetyltransferase; Provisional	99.89
KOG4178		322	consensus Soluble epoxide hydrolase [Lipid transpo	99.89
PLN03087		481	BODYGUARD 1 domain containing hydrolase; Provision	99.88
PRK03204		286	haloalkane dehalogenase; Provisional	99.88
PRK06765		389	homoserine O-acetyltransferase; Provisional	99.88
PRK10673		255	acyl-CoA esterase; Provisional	99.88
PLN02385		349	hydrolase; alpha/beta fold family protein	99.87
TIGR01392		351	homoserO_Ac_trn homoserine O-acetyltransferase. Th	99.87
PLN02894		402	hydrolase, alpha/beta fold family protein	99.87
PRK00175		379	metX homoserine O-acetyltransferase; Provisional	99.87
PRK00870		302	haloalkane dehalogenase; Provisional	99.87
TIGR03611		257	RutD pyrimidine utilization protein D. This protei	99.86
TIGR02427		251	protocat_pcaD 3-oxoadipate enol-lactonase. Members	99.85
PRK11126		242	2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxyl	99.85
TIGR03695		251	menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene	99.85
PHA02857		276	monoglyceride lipase; Provisional	99.85
PLN02298		330	hydrolase, alpha/beta fold family protein	99.85
PLN03084		383	alpha/beta hydrolase fold protein; Provisional	99.85
KOG2382		315	consensus Predicted alpha/beta hydrolase [General	99.82
TIGR01250		288	pro_imino_pep_2 proline-specific peptidases, Bacil	99.82
PRK14875		371	acetoin dehydrogenase E2 subunit dihydrolipoyllysi	99.82
KOG2984		277	consensus Predicted hydrolase [General function pr	99.82
PLN02980		1655	2-oxoglutarate decarboxylase/ hydro-lyase/ magnesi	99.82
PF12697		228	Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3	99.82
PF00561		230	Abhydrolase_1: alpha/beta hydrolase fold A web pag	99.81
PRK10749		330	lysophospholipase L2; Provisional	99.81
PLN02211		273	methyl indole-3-acetate methyltransferase	99.79
PLN02511		388	hydrolase	99.77
KOG1455		313	consensus Lysophospholipase [Lipid transport and m	99.77
COG2267		298	PldB Lysophospholipase [Lipid metabolism]	99.76
PLN02652		395	hydrolase; alpha/beta fold family protein	99.73
PRK05077		414	frsA fermentation/respiration switch protein; Revi	99.71
TIGR01249		306	pro_imino_pep_1 proline iminopeptidase, Neisseria-	99.7
TIGR01607		332	PST-A Plasmodium subtelomeric family (PST-A). Thes	99.67
COG1647		243	Esterase/lipase [General function prediction only]	99.66
PRK10985		324	putative hydrolase; Provisional	99.65
PRK07868		994	acyl-CoA synthetase; Validated	99.64
TIGR01836		350	PHA_synth_III_C poly(R)-hydroxyalkanoic acid synth	99.64
TIGR01838		532	PHA_synth_I poly(R)-hydroxyalkanoic acid synthase,	99.62
PRK05855		582	short chain dehydrogenase; Validated	99.61
COG2021		368	MET2 Homoserine acetyltransferase [Amino acid tran	99.61
PLN02872		395	triacylglycerol lipase	99.59
COG0596		282	MhpC Predicted hydrolases or acyltransferases (alp	99.59
COG3208		244	GrsT Predicted thioesterase involved in non-riboso	99.57
TIGR03100		274	hydr1_PEP hydrolase, ortholog 1, exosortase system	99.55
KOG2931		326	consensus Differentiation-related gene 1 protein (	99.5
PF00326		213	Peptidase_S9: Prolyl oligopeptidase family This fa	99.48
PRK11071		190	esterase YqiA; Provisional	99.47
PF03096		283	Ndr: Ndr family; InterPro: IPR004142 This family c	99.47
PRK10566		249	esterase; Provisional	99.4
PRK13604		307	luxD acyl transferase; Provisional	99.4
KOG1552		258	consensus Predicted alpha/beta hydrolase [General	99.35
PF12695		145	Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3	99.31
PRK11460		232	putative hydrolase; Provisional	99.3
PLN02442		283	S-formylglutathione hydrolase	99.28
PF02230		216	Abhydrolase_2: Phospholipase/Carboxylesterase; Int	99.23
COG1506		620	DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-pept	99.17
TIGR01839		560	PHA_synth_II poly(R)-hydroxyalkanoic acid synthase	99.16
KOG4667		269	consensus Predicted esterase [Lipid transport and	99.16
KOG2564		343	consensus Predicted acetyltransferases and hydrola	99.08
TIGR01849		406	PHB_depoly_PhaZ polyhydroxyalkanoate depolymerase,	99.07
PF06821		171	Ser_hydrolase: Serine hydrolase; InterPro: IPR0106	99.07
TIGR02821		275	fghA_ester_D S-formylglutathione hydrolase. This m	99.06
PF01738		218	DLH: Dienelactone hydrolase family; InterPro: IPR0	99.03
PF08840		213	BAAT_C: BAAT / Acyl-CoA thioester hydrolase C term	99.03
COG0429		345	Predicted hydrolase of the alpha/beta-hydrolase fo	99.0
KOG4391		300	consensus Predicted alpha/beta hydrolase BEM46 [Ge	99.0
PF05448		320	AXE1: Acetyl xylan esterase (AXE1); InterPro: IPR0	98.97
PF10230		266	DUF2305: Uncharacterised conserved protein (DUF230	98.95
COG3243		445	PhaC Poly(3-hydroxyalkanoate) synthetase [Lipid me	98.93
PF05728		187	UPF0227: Uncharacterised protein family (UPF0227);	98.92
PF06500		411	DUF1100: Alpha/beta hydrolase of unknown function	98.9
COG2945		210	Predicted hydrolase of the alpha/beta superfamily	98.83
PF08538		303	DUF1749: Protein of unknown function (DUF1749); In	98.81
PF09752		348	DUF2048: Uncharacterized conserved protein (DUF204	98.8
COG0400		207	Predicted esterase [General function prediction on	98.78
PF06342		297	DUF1057: Alpha/beta hydrolase of unknown function	98.77
KOG1838		409	consensus Alpha/beta hydrolase [General function p	98.75
PLN00021		313	chlorophyllase	98.73
PF08386		103	Abhydrolase_4: TAP-like protein; InterPro: IPR0135	98.73
PF00975		229	Thioesterase: Thioesterase domain; InterPro: IPR00	98.7
COG3545		181	Predicted esterase of the alpha/beta hydrolase fol	98.67
COG3571		213	Predicted hydrolase of the alpha/beta-hydrolase fo	98.63
TIGR01840		212	esterase_phb esterase, PHB depolymerase family. Th	98.56
PF03959		212	FSH1: Serine hydrolase (FSH1); InterPro: IPR005645	98.56
COG0412		236	Dienelactone hydrolase and related enzymes [Second	98.51
PRK10162		318	acetyl esterase; Provisional	98.5
PRK05371		767	x-prolyl-dipeptidyl aminopeptidase; Provisional	98.43
PF06028		255	DUF915: Alpha/beta hydrolase of unknown function (	98.4
PRK10115		686	protease 2; Provisional	98.39
PF11339		581	DUF3141: Protein of unknown function (DUF3141); In	98.33
KOG1551		371	consensus Uncharacterized conserved protein [Funct	98.33
KOG2624		403	consensus Triglyceride lipase-cholesterol esterase	98.32
COG4757		281	Predicted alpha/beta hydrolase [General function p	98.29
KOG3975		301	consensus Uncharacterized conserved protein [Funct	98.27
KOG2551		230	consensus Phospholipase/carboxyhydrolase [Amino ac	98.22
PRK04940		180	hypothetical protein; Provisional	98.17
cd00707		275	Pancreat_lipase_like Pancreatic lipase-like enzyme	98.13
COG3458		321	Acetyl esterase (deacetylase) [Secondary metabolit	98.12
TIGR03101		266	hydr2_PEP hydrolase, ortholog 2, exosortase system	98.11
KOG4627		270	consensus Kynurenine formamidase [Amino acid trans	98.1
PRK10252		1296	entF enterobactin synthase subunit F; Provisional	98.09
TIGR03230		442	lipo_lipase lipoprotein lipase. Members of this pr	98.07
PF07859		211	Abhydrolase_3: alpha/beta hydrolase fold A web pag	98.03
PF04301		213	DUF452: Protein of unknown function (DUF452); Inte	97.86
PRK10439		411	enterobactin/ferric enterobactin esterase; Provisi	97.86
PF10142		367	PhoPQ_related: PhoPQ-activated pathogenicity-relat	97.85
PF03403		379	PAF-AH_p_II: Platelet-activating factor acetylhydr	97.83
KOG3043		242	consensus Predicted hydrolase related to dienelact	97.79
PF05705		240	DUF829: Eukaryotic protein of unknown function (DU	97.79
smart00824		212	PKS_TE Thioesterase. Peptide synthetases are invol	97.79
KOG2100		755	consensus Dipeptidyl aminopeptidase [Posttranslati	97.77
KOG1515		336	consensus Arylacetamide deacetylase [Defense mecha	97.75
COG3319		257	Thioesterase domains of type I polyketide synthase	97.74
TIGR00976		550	/NonD putative hydrolase, CocE/NonD family. This m	97.74
PF03583		290	LIP: Secretory lipase ; InterPro: IPR005152 This e	97.63
PLN02733		440	phosphatidylcholine-sterol O-acyltransferase	97.63
PF00756		251	Esterase: Putative esterase; InterPro: IPR000801 T	97.58
PF10503		220	Esterase_phd: Esterase PHB depolymerase	97.58
PF07819		225	PGAP1: PGAP1-like protein; InterPro: IPR012908 The	97.57
PTZ00472		462	serine carboxypeptidase (CBP1); Provisional	97.46
PF06057		192	VirJ: Bacterial virulence protein (VirJ); InterPro	97.45
KOG2112		206	consensus Lysophospholipase [Lipid transport and m	97.45
PF02129		272	Peptidase_S15: X-Pro dipeptidyl-peptidase (S15 fam	97.45
KOG2565		469	consensus Predicted hydrolases or acyltransferases	97.35
COG1073		299	Hydrolases of the alpha/beta superfamily [General	97.31
COG4099		387	Predicted peptidase [General function prediction o	97.26
COG2819		264	Predicted hydrolase of the alpha/beta superfamily	97.26
PF07224		307	Chlorophyllase: Chlorophyllase; InterPro: IPR01082	97.18
cd00741		153	Lipase Lipase. Lipases are esterases that can hydr	97.11
COG0657		312	Aes Esterase/lipase [Lipid metabolism]	97.09
COG4188		365	Predicted dienelactone hydrolase [General function	97.01
KOG3253		784	consensus Predicted alpha/beta hydrolase [General	96.97
PF00450		415	Peptidase_S10: Serine carboxypeptidase; InterPro:	96.95
PLN02633		314	palmitoyl protein thioesterase family protein	96.95
KOG2281		867	consensus Dipeptidyl aminopeptidases/acylaminoacyl	96.88
KOG3847		399	consensus Phospholipase A2 (platelet-activating fa	96.84
PLN02213		319	sinapoylglucose-malate O-sinapoyltransferase/ carb	96.81
COG0627		316	Predicted esterase [General function prediction on	96.81
PLN02606		306	palmitoyl-protein thioesterase	96.71
PF12740		259	Chlorophyllase2: Chlorophyllase enzyme; InterPro:	96.65
PF11187		224	DUF2974: Protein of unknown function (DUF2974); In	96.62
PF02450		389	LCAT: Lecithin:cholesterol acyltransferase; InterP	96.61
PLN02209		437	serine carboxypeptidase	96.55
PF00151		331	Lipase: Lipase; InterPro: IPR013818 Triglyceride l	96.48
PLN03016		433	sinapoylglucose-malate O-sinapoyltransferase	96.43
PF06850		202	PHB_depo_C: PHB de-polymerase C-terminus; InterPro	96.42
PF02273		294	Acyl_transf_2: Acyl transferase; InterPro: IPR0031	96.37
KOG1282		454	consensus Serine carboxypeptidases (lysosomal cath	96.35
PF06259		177	Abhydrolase_8: Alpha/beta hydrolase; InterPro: IPR	96.15
COG2382		299	Fes Enterochelin esterase and related enzymes [Ino	96.07
PF01764		140	Lipase_3: Lipase (class 3); InterPro: IPR002921 Tr	96.03
cd00519		229	Lipase_3 Lipase (class 3). Lipases are esterases t	95.87
KOG3724		973	consensus Negative regulator of COPII vesicle form	95.83
COG2830		214	Uncharacterized protein conserved in bacteria [Fun	95.81
COG1075		336	LipA Predicted acetyltransferases and hydrolases w	95.67
COG1770		682	PtrB Protease II [Amino acid transport and metabol	95.38
COG4814		288	Uncharacterized protein with an alpha/beta hydrola	95.34
COG4947		227	Uncharacterized protein conserved in bacteria [Fun	95.27
KOG3101		283	consensus Esterase D [General function prediction	94.85
COG4287		507	PqaA PhoPQ-activated pathogenicity-related protein	94.56
PF07082		250	DUF1350: Protein of unknown function (DUF1350); In	94.55
PF12048		310	DUF3530: Protein of unknown function (DUF3530); In	94.42
PF05057		217	DUF676: Putative serine esterase (DUF676); InterPr	94.38
PLN02162		475	triacylglycerol lipase	94.12
PF12715		390	Abhydrolase_7: Abhydrolase family; PDB: 3NUZ_C 3G8	93.62
COG2936		563	Predicted acyl esterases [General function predict	93.55
KOG4840		299	consensus Predicted hydrolases or acyltransferases	93.44
PLN00413		479	triacylglycerol lipase	93.39
PF05990		233	DUF900: Alpha/beta hydrolase of unknown function (	93.2
PLN02571		413	triacylglycerol lipase	93.05
COG4553		415	DepA Poly-beta-hydroxyalkanoate depolymerase [Lipi	92.6
PLN02310		405	triacylglycerol lipase	92.55
PF07519		474	Tannase: Tannase and feruloyl esterase; InterPro:	92.49
PLN02454		414	triacylglycerol lipase	92.44
PF01674		219	Lipase_2: Lipase (class 2); InterPro: IPR002918 Li	92.27
KOG1553		517	consensus Predicted alpha/beta hydrolase BAT5 [Gen	92.21
PLN02324		415	triacylglycerol lipase	92.2
PLN02408		365	phospholipase A1	91.84
PF11144		403	DUF2920: Protein of unknown function (DUF2920); In	91.32
KOG2369		473	consensus Lecithin:cholesterol acyltransferase (LC	91.23
PLN02517		642	phosphatidylcholine-sterol O-acyltransferase	91.2
PLN02719		518	triacylglycerol lipase	90.93
PLN02847		633	triacylglycerol lipase	90.93
PLN02761		527	lipase class 3 family protein	90.86
PF02089		279	Palm_thioest: Palmitoyl protein thioesterase; Inte	90.7
PLN02753		531	triacylglycerol lipase	90.5
PLN03037		525	lipase class 3 family protein; Provisional	90.49
PF07519		474	Tannase: Tannase and feruloyl esterase; InterPro:	90.4
PF05277		345	DUF726: Protein of unknown function (DUF726); Inte	90.38
PLN02934		515	triacylglycerol lipase	90.3
PF10340		374	DUF2424: Protein of unknown function (DUF2424); In	89.98
PF05576		448	Peptidase_S37: PS-10 peptidase S37; InterPro: IPR0	89.81
PLN02802		509	triacylglycerol lipase	89.79
KOG3967		297	consensus Uncharacterized conserved protein [Funct	89.73
KOG4569		336	consensus Predicted lipase [Lipid transport and me	89.5
PF05577		434	Peptidase_S28: Serine carboxypeptidase S28; InterP	89.5
KOG2183		492	consensus Prolylcarboxypeptidase (angiotensinase C	89.01
TIGR03502		792	lipase_Pla1_cef extracellular lipase, Pla-1/cef fa	88.3
PF01083		179	Cutinase: Cutinase; InterPro: IPR000675 Aerial pla	87.35
COG3509		312	LpqC Poly(3-hydroxybutyrate) depolymerase [Seconda	84.85
KOG4540		425	consensus Putative lipase essential for disintegra	83.73
COG5153		425	CVT17 Putative lipase essential for disintegration	83.73
COG4782		377	Uncharacterized protein conserved in bacteria [Fun	82.04
PF05677		365	DUF818: Chlamydia CHLPS protein (DUF818); InterPro	81.07
COG3150		191	Predicted esterase [General function prediction on	80.71

>PLN02824 hydrolase, alpha/beta fold family protein	Back alignment and domain information

Probab=99.97  E-value=7.2e-30  Score=175.20  Aligned_cols=188  Identities=76%  Similarity=1.321  Sum_probs=122.3

Q ss_pred             CccchhHHHHHHHHhhccchhcceEEeecccchhccccCCCCCCchhHHHHHHhhcchhhhhHHhhcCCHHHHHHHHHhh
Q 028774            1 MVSEQTGLVGLQAAVMEPEICRGMILLNISLRMLHIKKQPWYGRPLIRSFQNLLRNTAAGKLFYKMVATSESVRNILCQC   80 (204)
Q Consensus         1 vGhS~Gg~ia~~~a~~~p~~v~~lvl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   80 (204)
                      |||||||++++.+|.++|++|+++|++++..........+.........+...+........++........+...+...
T Consensus       107 vGhS~Gg~va~~~a~~~p~~v~~lili~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  186 (294)
T PLN02824        107 ICNSVGGVVGLQAAVDAPELVRGVMLINISLRGLHIKKQPWLGRPFIKAFQNLLRETAVGKAFFKSVATPETVKNILCQC  186 (294)
T ss_pred             EEeCHHHHHHHHHHHhChhheeEEEEECCCcccccccccchhhhHHHHHHHHHHhchhHHHHHHHhhcCHHHHHHHHHHh
Confidence            69999999999999999999999999998643221111111112222222222222222222222222333334444434


Q ss_pred             cCCCCcccHHHHHHHhccCCCCchHHHHHHHHhhcCCCCCCccCCCCCCCeEEEeeCCCCCcchhHHHHhhccCCCccEE
Q 028774           81 YNDTSQVTEELVEKILQPGLETGAADVFLEFICYSGGPLPEELLPQVKCPVLIAWGDKDPWEPIELGRAYGNFDSVEDFI  160 (204)
Q Consensus        81 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~P~lii~g~~D~~~~~~~~~~~~~~~~~~~~~  160 (204)
                      +.+.....++..+.+............+..+............+.++++|+++|+|++|.+++.+..+.+.+..++++++
T Consensus       187 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~i~~P~lvi~G~~D~~~~~~~~~~~~~~~~~~~~~  266 (294)
T PLN02824        187 YHDDSAVTDELVEAILRPGLEPGAVDVFLDFISYSGGPLPEELLPAVKCPVLIAWGEKDPWEPVELGRAYANFDAVEDFI  266 (294)
T ss_pred             ccChhhccHHHHHHHHhccCCchHHHHHHHHhccccccchHHHHhhcCCCeEEEEecCCCCCChHHHHHHHhcCCccceE
Confidence            44444455555555544444443344444433222222223557889999999999999999999999888888889999


Q ss_pred             EcCCCCCCCCCCCcchhhHHHHHHhhcc
Q 028774          161 VLPNVGHCPQDEAPHLVNPLVESFVTRH  188 (204)
Q Consensus       161 ~~~~~gH~~~~e~p~~~~~~i~~fl~~~  188 (204)
                      +++++||++++|+|++|++.|.+|++++
T Consensus       267 ~i~~~gH~~~~e~p~~~~~~i~~fl~~~  294 (294)
T PLN02824        267 VLPGVGHCPQDEAPELVNPLIESFVARH  294 (294)
T ss_pred             EeCCCCCChhhhCHHHHHHHHHHHHhcC
Confidence            9999999999999999999999999864

>PLN02679 hydrolase, alpha/beta fold family protein	Back alignment and domain information

>PRK10349 carboxylesterase BioH; Provisional	Back alignment and domain information

>PLN02578 hydrolase	Back alignment and domain information

>KOG1454 consensus Predicted hydrolase/acyltransferase (alpha/beta hydrolase superfamily) [General function prediction only]	Back alignment and domain information

>TIGR01738 bioH putative pimeloyl-BioC--CoA transferase BioH	Back alignment and domain information

>PRK03592 haloalkane dehalogenase; Provisional	Back alignment and domain information

>PLN02965 Probable pheophorbidase	Back alignment and domain information

>TIGR03343 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase	Back alignment and domain information

>KOG4409 consensus Predicted hydrolase/acyltransferase (alpha/beta hydrolase superfamily) [General function prediction only]	Back alignment and domain information

>TIGR02240 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymerase	Back alignment and domain information

>PRK07581 hypothetical protein; Validated	Back alignment and domain information

>PRK06489 hypothetical protein; Provisional	Back alignment and domain information

>TIGR03056 bchO_mg_che_rel putative magnesium chelatase accessory protein	Back alignment and domain information

>PRK08775 homoserine O-acetyltransferase; Provisional	Back alignment and domain information

>KOG4178 consensus Soluble epoxide hydrolase [Lipid transport and metabolism]	Back alignment and domain information

>PLN03087 BODYGUARD 1 domain containing hydrolase; Provisional	Back alignment and domain information

>PRK03204 haloalkane dehalogenase; Provisional	Back alignment and domain information

>PRK06765 homoserine O-acetyltransferase; Provisional	Back alignment and domain information

>PRK10673 acyl-CoA esterase; Provisional	Back alignment and domain information

>PLN02385 hydrolase; alpha/beta fold family protein	Back alignment and domain information

>TIGR01392 homoserO_Ac_trn homoserine O-acetyltransferase	Back alignment and domain information

>PLN02894 hydrolase, alpha/beta fold family protein	Back alignment and domain information

>PRK00175 metX homoserine O-acetyltransferase; Provisional	Back alignment and domain information

>PRK00870 haloalkane dehalogenase; Provisional	Back alignment and domain information

>TIGR03611 RutD pyrimidine utilization protein D	Back alignment and domain information

>TIGR02427 protocat_pcaD 3-oxoadipate enol-lactonase	Back alignment and domain information

>PRK11126 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase; Provisional	Back alignment and domain information

>TIGR03695 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase	Back alignment and domain information

>PHA02857 monoglyceride lipase; Provisional	Back alignment and domain information

>PLN02298 hydrolase, alpha/beta fold family protein	Back alignment and domain information

>PLN03084 alpha/beta hydrolase fold protein; Provisional	Back alignment and domain information

>KOG2382 consensus Predicted alpha/beta hydrolase [General function prediction only]	Back alignment and domain information

>TIGR01250 pro_imino_pep_2 proline-specific peptidases, Bacillus coagulans-type subfamily	Back alignment and domain information

>PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional	Back alignment and domain information

>KOG2984 consensus Predicted hydrolase [General function prediction only]	Back alignment and domain information

>PLN02980 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesium ion binding / thiamin pyrophosphate binding	Back alignment and domain information

>PF12697 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3LLC_A 3A2N_E 3A2M_A 3A2L_A 3AFI_F 3C5V_A 3C5W_P 3E0X_A 2ZJF_A 3QYJ_A	Back alignment and domain information

>PF00561 Abhydrolase_1: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases	Back alignment and domain information

>PRK10749 lysophospholipase L2; Provisional	Back alignment and domain information

>PLN02211 methyl indole-3-acetate methyltransferase	Back alignment and domain information

>PLN02511 hydrolase	Back alignment and domain information

>KOG1455 consensus Lysophospholipase [Lipid transport and metabolism]	Back alignment and domain information

>COG2267 PldB Lysophospholipase [Lipid metabolism]	Back alignment and domain information

>PLN02652 hydrolase; alpha/beta fold family protein	Back alignment and domain information

>PRK05077 frsA fermentation/respiration switch protein; Reviewed	Back alignment and domain information

>TIGR01249 pro_imino_pep_1 proline iminopeptidase, Neisseria-type subfamily	Back alignment and domain information

>TIGR01607 PST-A Plasmodium subtelomeric family (PST-A)	Back alignment and domain information

>COG1647 Esterase/lipase [General function prediction only]	Back alignment and domain information

>PRK10985 putative hydrolase; Provisional	Back alignment and domain information

>PRK07868 acyl-CoA synthetase; Validated	Back alignment and domain information

>TIGR01836 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synthase, class III, PhaC subunit	Back alignment and domain information

>TIGR01838 PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, class I	Back alignment and domain information

>PRK05855 short chain dehydrogenase; Validated	Back alignment and domain information

>COG2021 MET2 Homoserine acetyltransferase [Amino acid transport and metabolism]	Back alignment and domain information

>PLN02872 triacylglycerol lipase	Back alignment and domain information

>COG0596 MhpC Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only]	Back alignment and domain information

>COG3208 GrsT Predicted thioesterase involved in non-ribosomal peptide biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism]	Back alignment and domain information

>TIGR03100 hydr1_PEP hydrolase, ortholog 1, exosortase system type 1 associated	Back alignment and domain information

>KOG2931 consensus Differentiation-related gene 1 protein (NDR1 protein), related proteins [Function unknown]	Back alignment and domain information

>PF00326 Peptidase_S9: Prolyl oligopeptidase family This family belongs to family S9 of the peptidase classification	Back alignment and domain information

>PRK11071 esterase YqiA; Provisional	Back alignment and domain information

>PF03096 Ndr: Ndr family; InterPro: IPR004142 This family consists of proteins from different gene families: Ndr1/RTP/Drg1, Ndr2, and Ndr3	Back alignment and domain information

>PRK10566 esterase; Provisional	Back alignment and domain information

>PRK13604 luxD acyl transferase; Provisional	Back alignment and domain information

>KOG1552 consensus Predicted alpha/beta hydrolase [General function prediction only]	Back alignment and domain information

>PF12695 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3D0K_B 2I3D_B 3DOH_B 3DOI_B 3PFB_A 3S2Z_B 3PFC_A 3QM1_A 3PF8_B 3PF9_A	Back alignment and domain information

>PRK11460 putative hydrolase; Provisional	Back alignment and domain information

>PLN02442 S-formylglutathione hydrolase	Back alignment and domain information

>PF02230 Abhydrolase_2: Phospholipase/Carboxylesterase; InterPro: IPR003140 This entry represents the alpha/beta hydrolase domain found in phospholipases [], carboxylesterases [] and thioesterases	Back alignment and domain information

>COG1506 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Amino acid transport and metabolism]	Back alignment and domain information

>TIGR01839 PHA_synth_II poly(R)-hydroxyalkanoic acid synthase, class II	Back alignment and domain information

>KOG4667 consensus Predicted esterase [Lipid transport and metabolism]	Back alignment and domain information

>KOG2564 consensus Predicted acetyltransferases and hydrolases with the alpha/beta hydrolase fold [General function prediction only]	Back alignment and domain information

>TIGR01849 PHB_depoly_PhaZ polyhydroxyalkanoate depolymerase, intracellular	Back alignment and domain information

>PF06821 Ser_hydrolase: Serine hydrolase; InterPro: IPR010662 This family contains a number of hypothetical bacterial proteins of unknown function, which may be cytosolic	Back alignment and domain information

>TIGR02821 fghA_ester_D S-formylglutathione hydrolase	Back alignment and domain information

>PF01738 DLH: Dienelactone hydrolase family; InterPro: IPR002925 Dienelactone hydrolases play a crucial role in chlorocatechol degradation via the modified ortho cleavage pathway	Back alignment and domain information

>PF08840 BAAT_C: BAAT / Acyl-CoA thioester hydrolase C terminal; InterPro: IPR014940 Acyl-CoA thioesterases are a group of enzymes that catalyse the hydrolysis of acyl-CoAs to the free fatty acid and coenzyme A (CoASH), providing the potential to regulate intracellular levels of acyl-CoAs, free fatty acids and CoASH	Back alignment and domain information

>COG0429 Predicted hydrolase of the alpha/beta-hydrolase fold [General function prediction only]	Back alignment and domain information

>KOG4391 consensus Predicted alpha/beta hydrolase BEM46 [General function prediction only]	Back alignment and domain information

>PF05448 AXE1: Acetyl xylan esterase (AXE1); InterPro: IPR008391 This family consists of several bacterial acetyl xylan esterase proteins	Back alignment and domain information

>PF10230 DUF2305: Uncharacterised conserved protein (DUF2305); InterPro: IPR019363 This entry contains proteins that have no known function	Back alignment and domain information

>COG3243 PhaC Poly(3-hydroxyalkanoate) synthetase [Lipid metabolism]	Back alignment and domain information

>PF05728 UPF0227: Uncharacterised protein family (UPF0227); InterPro: IPR008886 Despite being classed as uncharacterised proteins, the members of this family are almost certainly enzymes in that they contain a domain distantly related to IPR000073 from INTERPRO	Back alignment and domain information

>PF06500 DUF1100: Alpha/beta hydrolase of unknown function (DUF1100); InterPro: IPR010520 Proteins in this entry display esterase activity toward pNP-butyrate []	Back alignment and domain information

>COG2945 Predicted hydrolase of the alpha/beta superfamily [General function prediction only]	Back alignment and domain information

>PF08538 DUF1749: Protein of unknown function (DUF1749); InterPro: IPR013744 This is a plant and fungal family of unknown function	Back alignment and domain information

>PF09752 DUF2048: Uncharacterized conserved protein (DUF2048); InterPro: IPR019149 This family of proteins has no known function	Back alignment and domain information

>COG0400 Predicted esterase [General function prediction only]	Back alignment and domain information

>PF06342 DUF1057: Alpha/beta hydrolase of unknown function (DUF1057); InterPro: IPR010463 This entry consists of proteins of unknown function which have an alpha/beta hydrolase fold	Back alignment and domain information

>KOG1838 consensus Alpha/beta hydrolase [General function prediction only]	Back alignment and domain information

>PLN00021 chlorophyllase	Back alignment and domain information

>PF08386 Abhydrolase_4: TAP-like protein; InterPro: IPR013595 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families	Back alignment and domain information

>PF00975 Thioesterase: Thioesterase domain; InterPro: IPR001031 Thioesterase domains often occur integrated in or associated with peptide synthetases which are involved in the non-ribosomal synthesis of peptide antibiotics []	Back alignment and domain information

>COG3545 Predicted esterase of the alpha/beta hydrolase fold [General function prediction only]	Back alignment and domain information

>COG3571 Predicted hydrolase of the alpha/beta-hydrolase fold [General function prediction only]	Back alignment and domain information

>TIGR01840 esterase_phb esterase, PHB depolymerase family	Back alignment and domain information

>PF03959 FSH1: Serine hydrolase (FSH1); InterPro: IPR005645 This entry represents proteins belonging to the AB hydrolase family	Back alignment and domain information

>COG0412 Dienelactone hydrolase and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism]	Back alignment and domain information

>PRK10162 acetyl esterase; Provisional	Back alignment and domain information

>PRK05371 x-prolyl-dipeptidyl aminopeptidase; Provisional	Back alignment and domain information

>PF06028 DUF915: Alpha/beta hydrolase of unknown function (DUF915); InterPro: IPR010315 This family consists of bacterial proteins of unknown function, which are hydrolase-like	Back alignment and domain information

>PRK10115 protease 2; Provisional	Back alignment and domain information

>PF11339 DUF3141: Protein of unknown function (DUF3141); InterPro: IPR024501 This family of proteins appears to be predominantly expressed in Proteobacteria	Back alignment and domain information

>KOG1551 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG2624 consensus Triglyceride lipase-cholesterol esterase [Lipid transport and metabolism]	Back alignment and domain information

>COG4757 Predicted alpha/beta hydrolase [General function prediction only]	Back alignment and domain information

>KOG3975 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG2551 consensus Phospholipase/carboxyhydrolase [Amino acid transport and metabolism]	Back alignment and domain information

>PRK04940 hypothetical protein; Provisional	Back alignment and domain information

>cd00707 Pancreat_lipase_like Pancreatic lipase-like enzymes	Back alignment and domain information

>COG3458 Acetyl esterase (deacetylase) [Secondary metabolites biosynthesis, transport, and catabolism]	Back alignment and domain information

>TIGR03101 hydr2_PEP hydrolase, ortholog 2, exosortase system type 1 associated	Back alignment and domain information

>KOG4627 consensus Kynurenine formamidase [Amino acid transport and metabolism]	Back alignment and domain information

>PRK10252 entF enterobactin synthase subunit F; Provisional	Back alignment and domain information

>TIGR03230 lipo_lipase lipoprotein lipase	Back alignment and domain information

>PF07859 Abhydrolase_3: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases	Back alignment and domain information

>PF04301 DUF452: Protein of unknown function (DUF452); InterPro: IPR007398 This is a family of uncharacterised proteins	Back alignment and domain information

>PRK10439 enterobactin/ferric enterobactin esterase; Provisional	Back alignment and domain information

>PF10142 PhoPQ_related: PhoPQ-activated pathogenicity-related protein; InterPro: IPR009199 Proteins in this entry are believed to play a role in virulence/pathogenicity in Salmonella	Back alignment and domain information

>PF03403 PAF-AH_p_II: Platelet-activating factor acetylhydrolase, isoform II; PDB: 3F98_B 3F97_B 3D59_A 3F96_A 3D5E_B 3F9C_A	Back alignment and domain information

>KOG3043 consensus Predicted hydrolase related to dienelactone hydrolase [General function prediction only]	Back alignment and domain information

>PF05705 DUF829: Eukaryotic protein of unknown function (DUF829); InterPro: IPR008547 This signature identifies Transmembrane protein 53, that have no known function but are predicted to be integral membrane proteins	Back alignment and domain information

>smart00824 PKS_TE Thioesterase	Back alignment and domain information

>KOG2100 consensus Dipeptidyl aminopeptidase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1515 consensus Arylacetamide deacetylase [Defense mechanisms]	Back alignment and domain information

>COG3319 Thioesterase domains of type I polyketide synthases or non-ribosomal peptide synthetases [Secondary metabolites biosynthesis, transport, and catabolism]	Back alignment and domain information

>TIGR00976 /NonD putative hydrolase, CocE/NonD family	Back alignment and domain information

>PF03583 LIP: Secretory lipase ; InterPro: IPR005152 This entry represents a family of secreted lipases	Back alignment and domain information

>PLN02733 phosphatidylcholine-sterol O-acyltransferase	Back alignment and domain information

>PF00756 Esterase: Putative esterase; InterPro: IPR000801 This family contains several seemingly unrelated proteins, including human esterase D; mycobacterial antigen 85, which is responsible for the high affinity of mycobacteria to fibronectin; Corynebacterium glutamicum major secreted protein PS1; and hypothetical proteins from Escherichia coli, yeast, mycobacteria and Haemophilus influenzae	Back alignment and domain information

>PF10503 Esterase_phd: Esterase PHB depolymerase	Back alignment and domain information

>PF07819 PGAP1: PGAP1-like protein; InterPro: IPR012908 The sequences found in this family are similar to PGAP1 (Q765A7 from SWISSPROT)	Back alignment and domain information

>PTZ00472 serine carboxypeptidase (CBP1); Provisional	Back alignment and domain information

>PF06057 VirJ: Bacterial virulence protein (VirJ); InterPro: IPR010333 This entry contains several bacterial VirJ virulence proteins	Back alignment and domain information

>KOG2112 consensus Lysophospholipase [Lipid transport and metabolism]	Back alignment and domain information

>PF02129 Peptidase_S15: X-Pro dipeptidyl-peptidase (S15 family); InterPro: IPR000383 This entry represents a domain found peptidases Xaa-Pro dipeptidyl-peptidase and glutaryl-7-aminocephalosporanic-acid acylase, which belong to MEROPS peptidase families S15 and S45 respectively []	Back alignment and domain information

>KOG2565 consensus Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only]	Back alignment and domain information

>COG1073 Hydrolases of the alpha/beta superfamily [General function prediction only]	Back alignment and domain information

>COG4099 Predicted peptidase [General function prediction only]	Back alignment and domain information

>COG2819 Predicted hydrolase of the alpha/beta superfamily [General function prediction only]	Back alignment and domain information

>PF07224 Chlorophyllase: Chlorophyllase; InterPro: IPR010821 This family consists of several chlorophyllase proteins (3	Back alignment and domain information

>cd00741 Lipase Lipase	Back alignment and domain information

>COG0657 Aes Esterase/lipase [Lipid metabolism]	Back alignment and domain information

>COG4188 Predicted dienelactone hydrolase [General function prediction only]	Back alignment and domain information

>KOG3253 consensus Predicted alpha/beta hydrolase [General function prediction only]	Back alignment and domain information

>PF00450 Peptidase_S10: Serine carboxypeptidase; InterPro: IPR001563 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families	Back alignment and domain information

>PLN02633 palmitoyl protein thioesterase family protein	Back alignment and domain information

>KOG2281 consensus Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG3847 consensus Phospholipase A2 (platelet-activating factor acetylhydrolase in humans) [Lipid transport and metabolism]	Back alignment and domain information

>PLN02213 sinapoylglucose-malate O-sinapoyltransferase/ carboxypeptidase	Back alignment and domain information

>COG0627 Predicted esterase [General function prediction only]	Back alignment and domain information

>PLN02606 palmitoyl-protein thioesterase	Back alignment and domain information

>PF12740 Chlorophyllase2: Chlorophyllase enzyme; InterPro: IPR010821 This family consists of several chlorophyllase proteins (3	Back alignment and domain information

>PF11187 DUF2974: Protein of unknown function (DUF2974); InterPro: IPR024499 This family of proteins has no known function	Back alignment and domain information

>PF02450 LCAT: Lecithin:cholesterol acyltransferase; InterPro: IPR003386 Lecithin:cholesterol acyltransferase (LACT), also known as phosphatidylcholine-sterol acyltransferase (2	Back alignment and domain information

>PLN02209 serine carboxypeptidase	Back alignment and domain information

>PF00151 Lipase: Lipase; InterPro: IPR013818 Triglyceride lipases (3	Back alignment and domain information

>PLN03016 sinapoylglucose-malate O-sinapoyltransferase	Back alignment and domain information

>PF06850 PHB_depo_C: PHB de-polymerase C-terminus; InterPro: IPR009656 This entry represents the C terminus of bacterial poly(3-hydroxybutyrate) (PHB) de-polymerase	Back alignment and domain information

>PF02273 Acyl_transf_2: Acyl transferase; InterPro: IPR003157 LuxD proteins are bacterial acyl transferases	Back alignment and domain information

>KOG1282 consensus Serine carboxypeptidases (lysosomal cathepsin A) [Posttranslational modification, protein turnover, chaperones; Amino acid transport and metabolism]	Back alignment and domain information

>PF06259 Abhydrolase_8: Alpha/beta hydrolase; InterPro: IPR010427 This is a family of uncharacterised proteins found in Actinobacteria	Back alignment and domain information

>COG2382 Fes Enterochelin esterase and related enzymes [Inorganic ion transport and metabolism]	Back alignment and domain information

>PF01764 Lipase_3: Lipase (class 3); InterPro: IPR002921 Triglyceride lipases are lipolytic enzymes that hydrolyse ester linkages of triglycerides []	Back alignment and domain information

>cd00519 Lipase_3 Lipase (class 3)	Back alignment and domain information

>KOG3724 consensus Negative regulator of COPII vesicle formation [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>COG2830 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>COG1075 LipA Predicted acetyltransferases and hydrolases with the alpha/beta hydrolase fold [General function prediction only]	Back alignment and domain information

>COG1770 PtrB Protease II [Amino acid transport and metabolism]	Back alignment and domain information

>COG4814 Uncharacterized protein with an alpha/beta hydrolase fold [General function prediction only]	Back alignment and domain information

>COG4947 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>KOG3101 consensus Esterase D [General function prediction only]	Back alignment and domain information

>COG4287 PqaA PhoPQ-activated pathogenicity-related protein [General function prediction only]	Back alignment and domain information

>PF07082 DUF1350: Protein of unknown function (DUF1350); InterPro: IPR010765 This family consists of several hypothetical proteins from both cyanobacteria and plants	Back alignment and domain information

>PF12048 DUF3530: Protein of unknown function (DUF3530); InterPro: IPR022529 This family of proteins is functionally uncharacterised	Back alignment and domain information

>PF05057 DUF676: Putative serine esterase (DUF676); InterPro: IPR007751 This domain, whose function is unknown, is found within a group of putative lipases	Back alignment and domain information

>PLN02162 triacylglycerol lipase	Back alignment and domain information

>PF12715 Abhydrolase_7: Abhydrolase family; PDB: 3NUZ_C 3G8Y_A	Back alignment and domain information

>COG2936 Predicted acyl esterases [General function prediction only]	Back alignment and domain information

>KOG4840 consensus Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only]	Back alignment and domain information

>PLN00413 triacylglycerol lipase	Back alignment and domain information

>PF05990 DUF900: Alpha/beta hydrolase of unknown function (DUF900); InterPro: IPR010297 This domain is associated with proteins of unknown function, which are hydrolase-like	Back alignment and domain information

>PLN02571 triacylglycerol lipase	Back alignment and domain information

>COG4553 DepA Poly-beta-hydroxyalkanoate depolymerase [Lipid metabolism]	Back alignment and domain information

>PLN02310 triacylglycerol lipase	Back alignment and domain information

>PF07519 Tannase: Tannase and feruloyl esterase; InterPro: IPR011118 This family includes fungal tannase [] and feruloyl esterase [, ]	Back alignment and domain information

>PLN02454 triacylglycerol lipase	Back alignment and domain information

>PF01674 Lipase_2: Lipase (class 2); InterPro: IPR002918 Lipases or triacylglycerol acylhydrolases hydrolyse ester bonds in triacylglycerol giving diacylglycerol, monoacylglycerol, glycerol and free fatty acids []	Back alignment and domain information

>KOG1553 consensus Predicted alpha/beta hydrolase BAT5 [General function prediction only]	Back alignment and domain information

>PLN02324 triacylglycerol lipase	Back alignment and domain information

>PLN02408 phospholipase A1	Back alignment and domain information

>PF11144 DUF2920: Protein of unknown function (DUF2920); InterPro: IPR022605 This bacterial family of proteins has no known function	Back alignment and domain information

>KOG2369 consensus Lecithin:cholesterol acyltransferase (LCAT)/Acyl-ceramide synthase [Lipid transport and metabolism]	Back alignment and domain information

>PLN02517 phosphatidylcholine-sterol O-acyltransferase	Back alignment and domain information

>PLN02719 triacylglycerol lipase	Back alignment and domain information

>PLN02847 triacylglycerol lipase	Back alignment and domain information

>PLN02761 lipase class 3 family protein	Back alignment and domain information

>PF02089 Palm_thioest: Palmitoyl protein thioesterase; InterPro: IPR002472 Neuronal ceroid lipofuscinoses (NCL) represent a group of encephalopathies that occur in 1 in 12,500 children	Back alignment and domain information

>PLN02753 triacylglycerol lipase	Back alignment and domain information

>PLN03037 lipase class 3 family protein; Provisional	Back alignment and domain information

>PF07519 Tannase: Tannase and feruloyl esterase; InterPro: IPR011118 This family includes fungal tannase [] and feruloyl esterase [, ]	Back alignment and domain information

>PF05277 DUF726: Protein of unknown function (DUF726); InterPro: IPR007941 This family consists of several uncharacterised eukaryotic proteins	Back alignment and domain information

>PLN02934 triacylglycerol lipase	Back alignment and domain information

>PF10340 DUF2424: Protein of unknown function (DUF2424); InterPro: IPR019436 Sterol homeostasis in eukaryotic cells relies on the reciprocal interconversion of free sterols and steryl esters	Back alignment and domain information

>PF05576 Peptidase_S37: PS-10 peptidase S37; InterPro: IPR008761 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families	Back alignment and domain information

>PLN02802 triacylglycerol lipase	Back alignment and domain information

>KOG3967 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG4569 consensus Predicted lipase [Lipid transport and metabolism]	Back alignment and domain information

>PF05577 Peptidase_S28: Serine carboxypeptidase S28; InterPro: IPR008758 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families	Back alignment and domain information

>KOG2183 consensus Prolylcarboxypeptidase (angiotensinase C) [Posttranslational modification, protein turnover, chaperones; General function prediction only]	Back alignment and domain information

>TIGR03502 lipase_Pla1_cef extracellular lipase, Pla-1/cef family	Back alignment and domain information

>PF01083 Cutinase: Cutinase; InterPro: IPR000675 Aerial plant organs are protected by a cuticle composed of an insoluble polymeric structural compound, cutin, which is a polyester composed of hydroxy and hydroxyepoxy fatty acids []	Back alignment and domain information

>COG3509 LpqC Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport, and catabolism]	Back alignment and domain information

>KOG4540 consensus Putative lipase essential for disintegration of autophagic bodies inside the vacuole [Intracellular trafficking, secretion, and vesicular transport; Lipid transport and metabolism]	Back alignment and domain information

>COG5153 CVT17 Putative lipase essential for disintegration of autophagic bodies inside the vacuole [Intracellular trafficking and secretion / Lipid metabolism]	Back alignment and domain information

>COG4782 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>PF05677 DUF818: Chlamydia CHLPS protein (DUF818); InterPro: IPR008536 This family of unknown function includes several Chlamydia CHLPS proteins and Legionella SidB proteins	Back alignment and domain information

>COG3150 Predicted esterase [General function prediction only]	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		204
1j1i_A		296	META cleavage compound hydrolase; carbazole degrad	7e-32
1iup_A		282	META-cleavage product hydrolase; aromatic compound	2e-28
2wue_A		291	2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolas	1e-20
2puj_A		286	2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola;	1e-19
1u2e_A		289	2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase	2e-19
1c4x_A		285	BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-di	5e-18
4f0j_A		315	Probable hydrolytic enzyme; alpha/beta hydrolase f	1e-16
3fsg_A		272	Alpha/beta superfamily hydrolase; PF00561, MCSG, P	1e-15
3kxp_A		314	Alpha-(N-acetylaminomethylene)succinic acid hydrol	4e-15
3oos_A		278	Alpha/beta hydrolase family protein; APC67239.0, p	5e-15
3g9x_A		299	Haloalkane dehalogenase; alpha/beta hydrolase, hel	5e-15
2r11_A		306	Carboxylesterase NP; 2632844, putative hydrolase,	1e-14
2ocg_A		254	Valacyclovir hydrolase; alpha beta hydrolase fold;	2e-14
1m33_A		258	BIOH protein; alpha-betta-alpha sandwich, structur	1e-13
1wom_A		271	RSBQ, sigma factor SIGB regulation protein RSBQ; a	5e-13
3r0v_A		262	Alpha/beta hydrolase fold protein; structural geno	5e-13
3qvm_A		282	OLEI00960; structural genomics, PSI-biology, midwe	1e-12
2y6u_A		398	Peroxisomal membrane protein LPX1; hydrolase, puta	1e-12
3u1t_A		309	DMMA haloalkane dehalogenase; alpha/beta-hydrolase	2e-12
2xmz_A		269	Hydrolase, alpha/beta hydrolase fold family; menaq	3e-12
3afi_E		316	Haloalkane dehalogenase; A/B-hydrolase, hydrolase;	4e-12
3e0x_A		245	Lipase-esterase related protein; APC60309, clostri	5e-12
2wj6_A		276	1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxid	1e-11
3v48_A		268	Aminohydrolase, putative aminoacrylate hydrolase R	3e-11
2qvb_A		297	Haloalkane dehalogenase 3; RV2579, alpha-beta hydr	6e-11
2xt0_A		297	Haloalkane dehalogenase; hydrolase, alpha-beta hyd	6e-11
3i28_A		555	Epoxide hydrolase 2; aromatic hydrocarbons catabol	1e-10
1b6g_A		310	Haloalkane dehalogenase; hydrolase, alpha/beta-hyd	2e-10
3bf7_A		255	Esterase YBFF; thioesterase, helical CAP, hydrolas	2e-10
2qmq_A		286	Protein NDRG2, protein NDR2; alpha/beta-hydrolases	2e-10
3vdx_A		456	Designed 16NM tetrahedral protein CAGE containing	2e-10
3hss_A		293	Putative bromoperoxidase; alpha beta hydrolase, ox	3e-10
3c5v_A		316	PME-1, protein phosphatase methylesterase 1; demet	4e-10
1brt_A		277	Bromoperoxidase A2; haloperoxidase, oxidoreductase	4e-10
1mj5_A		302	1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase;	5e-10
1a8s_A		273	Chloroperoxidase F; haloperoxidase, oxidoreductase	2e-09
1a88_A		275	Chloroperoxidase L; haloperoxidase, oxidoreductase	3e-09
3ia2_A		271	Arylesterase; alpha-beta hydrolase fold, transitio	3e-09
3fob_A		281	Bromoperoxidase; structural genomics, IDP00046, ba	3e-09
2yys_A		286	Proline iminopeptidase-related protein; TTHA1809,	5e-09
3l80_A		292	Putative uncharacterized protein SMU.1393C; alpha/	7e-09
1q0r_A		298	RDMC, aclacinomycin methylesterase; anthracycline,	8e-09
3qit_A		286	CURM TE, polyketide synthase; thioesterase, alpha/	2e-08
2cjp_A		328	Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tu	4e-08
1zoi_A		276	Esterase; alpha/beta hydrolase fold; 1.60A {Pseudo	5e-08
3nwo_A		330	PIP, proline iminopeptidase; structural genomics,	5e-08
1hkh_A		279	Gamma lactamase; hydrolase, alpha/beta hydrolase,	6e-08
2xua_A		266	PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, cate	4e-07
1a8q_A		274	Bromoperoxidase A1; haloperoxidase, oxidoreductase	4e-07
3kda_A		301	CFTR inhibitory factor (CIF); alpha/beta hydrolase	7e-07
2e3j_A		356	Epoxide hydrolase EPHB; epoxide hydrolase B, struc	2e-06
1ehy_A		294	Protein (soluble epoxide hydrolase); alpha/beta hy	3e-06
3om8_A		266	Probable hydrolase; structural genomics, PSI-2, pr	4e-06
2psd_A		318	Renilla-luciferin 2-monooxygenase; alpha/beta-hydr	9e-06
3p2m_A		330	Possible hydrolase; alpha/beta hydrolase superfami	1e-05
3b12_A		304	Fluoroacetate dehalogenase; dehalogease, hydrolase	3e-05
1tqh_A		247	Carboxylesterase precursor; tetrahedral intermedia	3e-05
3bdi_A		207	Uncharacterized protein TA0194; NP_393672.1, predi	4e-05
1r3d_A		264	Conserved hypothetical protein VC1974; structural	4e-05
3bwx_A		285	Alpha/beta hydrolase; YP_496220.1, joint center fo	4e-05
3r40_A		306	Fluoroacetate dehalogenase; FACD, defluorinase, al	6e-05
1imj_A		210	CIB, CCG1-interacting factor B; alpha/beta hydrola	6e-05
1mtz_A		293	Proline iminopeptidase; alpha-beta hydrolase, CAP	1e-04
3dkr_A		251	Esterase D; alpha beta hydrolase, mechanism, catal	1e-04
3rm3_A		270	MGLP, thermostable monoacylglycerol lipase; alpha/	1e-04
3qyj_A		291	ALR0039 protein; alpha/beta fold, hydrolase; 1.78A	2e-04
1zi8_A		236	Carboxymethylenebutenolidase; alpha and beta prote	2e-04
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	2e-04
2wtm_A		251	EST1E; hydrolase; 1.60A {Clostridium proteoclastic	8e-04

>1j1i_A META cleavage compound hydrolase; carbazole degradation, META cleavage product hydrolase, histidine tagged protein, alpha/beta-hydrolase; 1.86A {Janthinobacterium} SCOP: c.69.1.10 Length = 296	Back alignment and structure

 Score =  115 bits (291), Expect = 7e-32
 Identities = 30/198 (15%), Positives = 68/198 (34%), Gaps = 32/198 (16%)

Query: 7   GLVGLQAAVMEPEICRGMILLNISLRMLHIKK--QPWYGRPLIRSFQNLLRNTAAGKLFY 64
           G  GL  +V+  E+   ++L+  +  ++ I +  +P       R                
Sbjct: 117 GATGLGVSVLHSELVNALVLMGSAGLVVEIHEDLRPIINYDFTR---------------- 160

Query: 65  KMVATSESVRNILCQCYNDTSQVTEELVEKILQPGLETGAADVFLEFI----CYSGGPLP 120
                 E + +++    ND  ++ + ++        +      ++  +       G    
Sbjct: 161 ------EGMVHLVKALTNDGFKIDDAMINSRYTYATDEATRKAYVATMQWIREQGGLFYD 214

Query: 121 EELLPQVKCPVLIAWGDKDPWEPIELGRAYGNF--DSVEDFIVLPNVGHCPQDEAPHLVN 178
            E + +V+ P L+  G  D   P+E    + +   DS     ++P+ GH    E P    
Sbjct: 215 PEFIRKVQVPTLVVQGKDDKVVPVETAYKFLDLIDDS--WGYIIPHCGHWAMIEHPEDFA 272

Query: 179 PLVESFVTRHATPPASVS 196
               SF++       + +
Sbjct: 273 NATLSFLSLRVDITPAAA 290

PyMOL of 1j1i

>1iup_A META-cleavage product hydrolase; aromatic compounds, cumene, isopropylbenzene, META-cleavage compound hydrolase; 1.60A {Pseudomonas fluorescens} SCOP: c.69.1.10 PDB: 1iun_A 1iuo_A 1uk6_A 1uk7_A 1uk8_A 1uk9_A 1uka_A 1ukb_A 2d0d_A Length = 282	Back alignment and structure

>2wue_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolase BPHD; HET: KEK; 1.80A {Mycobacterium tuberculosis} PDB: 2wud_A* 2wuf_A* 2wug_A* 2vf2_A Length = 291	Back alignment and structure

>2puj_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; C-C bond hydrolase, hydrolase; HET: HPZ; 1.57A {Burkholderia xenovorans} PDB: 2pu7_A* 3v1m_A* 3v1l_A* 2puh_A* 3v1n_A* 3v1k_A* 2og1_A 2pu5_A 2rhw_A* 2rht_A* 2ri6_A Length = 286	Back alignment and structure

>1u2e_A 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase; alpha/beta hydrolase fold; 2.10A {Escherichia coli} Length = 289	Back alignment and structure

>1c4x_A BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoat hydrolase); PCB degradation; 2.40A {Rhodococcus SP} SCOP: c.69.1.10 Length = 285	Back alignment and structure

>4f0j_A Probable hydrolytic enzyme; alpha/beta hydrolase fold, structural genomics, joint center structural genomics, JCSG; HET: MSE; 1.50A {Pseudomonas aeruginosa} Length = 315	Back alignment and structure

>3fsg_A Alpha/beta superfamily hydrolase; PF00561, MCSG, PSI, PSI-2, structural genomics, protein structure initiative, midwest for structural genomics; 2.00A {Oenococcus oeni} Length = 272	Back alignment and structure

>3kxp_A Alpha-(N-acetylaminomethylene)succinic acid hydrolase; alpha/beta hydrolase, PLP degradation, E-2- (acetamidomethylene)succinate; 2.26A {Mesorhizobium loti} Length = 314	Back alignment and structure

>3oos_A Alpha/beta hydrolase family protein; APC67239.0, protein structure initiative, PSI-2, structural midwest center for structural genomics, MCSG; HET: MSE PG4; 1.65A {Bacillus anthracis} Length = 278	Back alignment and structure

>3g9x_A Haloalkane dehalogenase; alpha/beta hydrolase, helical CAP domain, catalytic triad (A His272, Glu130), mutant, I135F, haloalkanes; 0.95A {Rhodococcus SP} PDB: 3fwh_A 3fbw_A 3rlt_A 3rk4_A 1bn6_A 1bn7_A 1cqw_A 2v9z_A Length = 299	Back alignment and structure

>2r11_A Carboxylesterase NP; 2632844, putative hydrolase, structural genomics, joint center for structural genomics, JCSG; HET: MSE PGE; 1.96A {Bacillus subtilis} Length = 306	Back alignment and structure

>2ocg_A Valacyclovir hydrolase; alpha beta hydrolase fold; 1.75A {Homo sapiens} PDB: 2oci_A* 2ock_A 2ocl_A Length = 254	Back alignment and structure

>1m33_A BIOH protein; alpha-betta-alpha sandwich, structural genomics, PSI, protei structure initiative; HET: MSE 3OH; 1.70A {Escherichia coli} SCOP: c.69.1.26 Length = 258	Back alignment and structure

>1wom_A RSBQ, sigma factor SIGB regulation protein RSBQ; alpha/beta hydrolase, signaling protein; 2.50A {Bacillus subtilis} PDB: 1wpr_A* Length = 271	Back alignment and structure

>3r0v_A Alpha/beta hydrolase fold protein; structural genomics, PSI-biology, protein structure initiati alpha/beta hydrolase; HET: MSE; 1.38A {Sphaerobacter thermophilus} Length = 262	Back alignment and structure

>3qvm_A OLEI00960; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta hydrolase fold, hydrolase; 2.00A {Oleispira antarctica} Length = 282	Back alignment and structure

>2y6u_A Peroxisomal membrane protein LPX1; hydrolase, putative esterase, putative lipase; HET: CME CSO; 1.90A {Saccharomyces cerevisiae} PDB: 2y6v_A* Length = 398	Back alignment and structure

>3u1t_A DMMA haloalkane dehalogenase; alpha/beta-hydrolase, hydrolase; 2.20A {Unidentified} Length = 309	Back alignment and structure

>2xmz_A Hydrolase, alpha/beta hydrolase fold family; menaquinone biosynthesis, lyase; 1.94A {Staphylococcus aureus} Length = 269	Back alignment and structure

>3afi_E Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 1.75A {Bradyrhizobium japonicum} PDB: 3a2m_A* 3a2n_A 3a2l_A* Length = 316	Back alignment and structure

>3e0x_A Lipase-esterase related protein; APC60309, clostridium acetobutylicum ATCC 824, structural genomics, PSI-2; HET: MSE; 1.45A {Clostridium acetobutylicum} Length = 245	Back alignment and structure

>2wj6_A 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxidoreductase, alpha/beta hydrolase; HET: ZZ8 SRT; 2.00A {Arthrobacter nitroguajacolicus} PDB: 2wj4_A* 2wj3_A* 2wm2_A* Length = 276	Back alignment and structure

>3v48_A Aminohydrolase, putative aminoacrylate hydrolase RUTD; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.10A {Escherichia coli SE11} Length = 268	Back alignment and structure

>2qvb_A Haloalkane dehalogenase 3; RV2579, alpha-beta hydrolase protei structural genomics consortium, TBSGC, hydrolase; 1.19A {Mycobacterium tuberculosis} PDB: 2o2i_A 2o2h_A Length = 297	Back alignment and structure

>2xt0_A Haloalkane dehalogenase; hydrolase, alpha-beta hydrolase fold; 1.90A {Plesiocystis pacifica} Length = 297	Back alignment and structure

>3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* Length = 555	Back alignment and structure

>1b6g_A Haloalkane dehalogenase; hydrolase, alpha/beta-hydrolase; 1.15A {Xanthobacter autotrophicus} SCOP: c.69.1.8 PDB: 1be0_A 1cij_A 2yxp_X 1edd_A 1edb_A 2dhc_A 2dhe_A 2eda_A 2edc_A 2had_A 1ede_A 2pky_X 1bez_A 1bee_A 2dhd_A* 1hde_A Length = 310	Back alignment and structure

>3bf7_A Esterase YBFF; thioesterase, helical CAP, hydrolase; 1.10A {Escherichia coli} PDB: 3bf8_A Length = 255	Back alignment and structure

>2qmq_A Protein NDRG2, protein NDR2; alpha/beta-hydrolases fold, NDR family, developmental protei differentiation, neurogenesis, phosphorylation; HET: 2PE; 1.70A {Mus musculus} PDB: 2xmq_A 2xmr_A 2xms_A Length = 286	Back alignment and structure

>3vdx_A Designed 16NM tetrahedral protein CAGE containing bromoperoxidase BPO-A2 and matrix...; protein design, bionanotechnology; 3.00A {Streptomyces aureofaciens} PDB: 4d9j_A Length = 456	Back alignment and structure

>3hss_A Putative bromoperoxidase; alpha beta hydrolase, oxidoreductase, hydrolase; 1.90A {Mycobacterium tuberculosis} PDB: 3e3a_A 3hys_A 3hzo_A Length = 293	Back alignment and structure

>3c5v_A PME-1, protein phosphatase methylesterase 1; demethylase, PP2A, alternative splicing, hydrolase, phosphoprotein, serine esterase; 2.00A {Homo sapiens} PDB: 3c5w_P Length = 316	Back alignment and structure

>1brt_A Bromoperoxidase A2; haloperoxidase, oxidoreductase, alpha/beta hydrolase fold, mutant M99T; 1.50A {Streptomyces aureofaciens} SCOP: c.69.1.12 PDB: 1bro_A 1a8u_A 1a7u_A Length = 277	Back alignment and structure

>1mj5_A 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; LINB, haloalkane dehalogenase, 1, 3, 4, 4-cyclohexadiene dehalogenase; 0.95A {Sphingomonas paucimobilis} SCOP: c.69.1.8 PDB: 1cv2_A 1d07_A 2bfn_A 1g42_A* 1g4h_A* 1g5f_A* 1iz7_A 1iz8_A* 1k5p_A 1k63_A 1k6e_A Length = 302	Back alignment and structure

>1a8s_A Chloroperoxidase F; haloperoxidase, oxidoreductase, propionate complex; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.12 Length = 273	Back alignment and structure

>1a88_A Chloroperoxidase L; haloperoxidase, oxidoreductase; 1.90A {Streptomyces lividans} SCOP: c.69.1.12 Length = 275	Back alignment and structure

>3ia2_A Arylesterase; alpha-beta hydrolase fold, transition state analog, hydrolas oxidoreductase, peroxidase; 1.65A {Pseudomonas fluorescens} PDB: 1va4_A 3hi4_A 3hea_A Length = 271	Back alignment and structure

>3fob_A Bromoperoxidase; structural genomics, IDP00046, bacillus ANT peroxidase, oxidoreductase; 1.74A {Bacillus anthracis str} Length = 281	Back alignment and structure

>2yys_A Proline iminopeptidase-related protein; TTHA1809, structural genomics, unknown function; 2.20A {Thermus thermophilus} Length = 286	Back alignment and structure

>3l80_A Putative uncharacterized protein SMU.1393C; alpha/beta hydrolase fold, carboxylesterase, Ser- hydrolase; 2.00A {Streptococcus mutans} Length = 292	Back alignment and structure

>1q0r_A RDMC, aclacinomycin methylesterase; anthracycline, hydrolase, polyketide, tailoring enzyme, structural proteomics in europe, spine; HET: AKT 1PE; 1.45A {Streptomyces purpurascens} SCOP: c.69.1.28 PDB: 1q0z_A* Length = 298	Back alignment and structure

>3qit_A CURM TE, polyketide synthase; thioesterase, alpha/beta hydrolase, decarboxylase, sulfate elimination, terminal alkene production; 1.68A {Lyngbya majuscula 19L} Length = 286	Back alignment and structure

>2cjp_A Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tuberosum} PDB: 3cxu_A* Length = 328	Back alignment and structure

>1zoi_A Esterase; alpha/beta hydrolase fold; 1.60A {Pseudomonas putida} PDB: 4dgq_A Length = 276	Back alignment and structure

>3nwo_A PIP, proline iminopeptidase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, mycobac smegmatis; 1.90A {Mycobacterium smegmatis} Length = 330	Back alignment and structure

>1hkh_A Gamma lactamase; hydrolase, alpha/beta hydrolase, CO-factor free haloperoxidase,; 1.73A {Microbacterium} SCOP: c.69.1.12 PDB: 1hl7_A* Length = 279	Back alignment and structure

>2xua_A PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, catechol metabolism; 1.90A {Burkholderia xenovorans} Length = 266	Back alignment and structure

>1a8q_A Bromoperoxidase A1; haloperoxidase, oxidoreductase; 1.75A {Streptomyces aureofaciens} SCOP: c.69.1.12 Length = 274	Back alignment and structure

>3kda_A CFTR inhibitory factor (CIF); alpha/beta hydrolase, hydrolase; 1.50A {Pseudomonas aeruginosa ucbpp-pa14} PDB: 3kd2_A 3pi6_A Length = 301	Back alignment and structure

>2e3j_A Epoxide hydrolase EPHB; epoxide hydrolase B, structural mycobacterium tuberculosis structural proteomics project, X hydrolase; 2.10A {Mycobacterium tuberculosis} PDB: 2zjf_A* Length = 356	Back alignment and structure

>1ehy_A Protein (soluble epoxide hydrolase); alpha/beta hydrolase fold, epoxide degradation, epichlorohydrin; 2.10A {Agrobacterium tumefaciens} SCOP: c.69.1.11 Length = 294	Back alignment and structure

>3om8_A Probable hydrolase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MES; 2.25A {Pseudomonas aeruginosa} Length = 266	Back alignment and structure

>2psd_A Renilla-luciferin 2-monooxygenase; alpha/beta-hydrolase, luciferase, oxidoreductase; 1.40A {Renilla reniformis} PDB: 2pse_A 2psj_A* 2psh_A 2psf_A Length = 318	Back alignment and structure

>3p2m_A Possible hydrolase; alpha/beta hydrolase superfamily; 2.80A {Mycobacterium tuberculosis} Length = 330	Back alignment and structure

>3b12_A Fluoroacetate dehalogenase; dehalogease, hydrolase; 1.20A {Burkholderia SP} PDB: 1y37_A Length = 304	Back alignment and structure

>1tqh_A Carboxylesterase precursor; tetrahedral intermediate, alpha/beta hydrolase; 1.63A {Geobacillus stearothermophilus} SCOP: c.69.1.29 PDB: 1r1d_A* 4diu_A Length = 247	Back alignment and structure

>3bdi_A Uncharacterized protein TA0194; NP_393672.1, predicted CIB-like hydrolase, structural genomi center for structural genomics; HET: MSE; 1.45A {Thermoplasma acidophilum dsm 1728} Length = 207	Back alignment and structure

>1r3d_A Conserved hypothetical protein VC1974; structural genomics, hydrolase, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI; 1.90A {Vibrio cholerae} SCOP: c.69.1.35 Length = 264	Back alignment and structure

>3bwx_A Alpha/beta hydrolase; YP_496220.1, joint center for structural genomics, protein structure initiative, PSI-2; HET: MSE; 1.50A {Novosphingobium aromaticivorans} Length = 285	Back alignment and structure

>3r40_A Fluoroacetate dehalogenase; FACD, defluorinase, alpha/beta hydrolase, hydrolase; 1.05A {Rhodopseudomonas palustris} PDB: 3r3w_A 3r3x_A 3r3v_A 3r3u_A 3r3z_A 3r41_A 3r3y_A Length = 306	Back alignment and structure

>1imj_A CIB, CCG1-interacting factor B; alpha/beta hydrolase, CCG1 interactor; 2.20A {Homo sapiens} SCOP: c.69.1.23 Length = 210	Back alignment and structure

>1mtz_A Proline iminopeptidase; alpha-beta hydrolase, CAP domain, caged active site, prolyl peptidase; 1.80A {Thermoplasma acidophilum} SCOP: c.69.1.7 PDB: 1mt3_A 1mu0_A* 1xrr_A 1xrq_A 1xro_A 1xrn_A 1xrm_A 1xrp_A 1xrl_A* 1xqw_A* 1xqx_A* 1xqy_A 1xqv_A Length = 293	Back alignment and structure

>3dkr_A Esterase D; alpha beta hydrolase, mechanism, catalytic triad, rotation; 1.60A {Lactobacillus rhamnosus} PDB: 3dlt_A 3dyi_A 3dyv_A 3e1g_A Length = 251	Back alignment and structure

>3rm3_A MGLP, thermostable monoacylglycerol lipase; alpha/beta hydrolase fold, hydrolase; 1.20A {Bacillus SP} Length = 270	Back alignment and structure

>3qyj_A ALR0039 protein; alpha/beta fold, hydrolase; 1.78A {Nostoc SP} Length = 291	Back alignment and structure

>1zi8_A Carboxymethylenebutenolidase; alpha and beta proteins, 3-D structure, serine esterase, HYD aromatic hydrocarbons, catabolism; 1.40A {Pseudomonas putida} PDB: 1zj5_A* 1zi9_A 1zi6_A 1zj4_A* 1din_A 1ziy_A* 1zic_A 1zix_A 1ggv_A* Length = 236	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>2wtm_A EST1E; hydrolase; 1.60A {Clostridium proteoclasticum} PDB: 2wtn_A* Length = 251	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

No hit with probability above 80.00

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		204
d1zd3a2		322	c.69.1.11 (A:225-547) Mammalian epoxide hydrolase,	5e-14
d1j1ia_		268	c.69.1.10 (A:) Meta cleavage compound hydrolase Ca	6e-13
d2rhwa1		283	c.69.1.10 (A:4-286) 2-hydroxy-6-oxo-6-phenylhexa-2	1e-11
d1uk8a_		271	c.69.1.10 (A:) Meta-cleavage product hydrolase Cum	5e-11
d1bn7a_		291	c.69.1.8 (A:) Haloalkane dehalogenase {Rhodococcus	2e-10
d1b6ga_		310	c.69.1.8 (A:) Haloalkane dehalogenase {Xanthobacte	7e-10
d1pjaa_		268	c.69.1.13 (A:) Palmitoyl protein thioesterase 2 {H	2e-09
d1q0ra_		297	c.69.1.28 (A:) Aclacinomycin methylesterase RdmC {	3e-09
d1mtza_		290	c.69.1.7 (A:) Tricorn interacting factor F1 {Archa	3e-09
d1qo7a_		394	c.69.1.11 (A:) Bacterial epoxide hydrolase {Asperg	7e-09
d1c4xa_		281	c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-di	2e-08
d1brta_		277	c.69.1.12 (A:) Bromoperoxidase A2 {Streptomyces au	2e-08
d1m33a_		256	c.69.1.26 (A:) Biotin biosynthesis protein BioH {E	3e-08
d1xkla_		258	c.69.1.20 (A:) Salicylic acid-binding protein 2 (S	5e-08
d1azwa_		313	c.69.1.7 (A:) Proline iminopeptidase {Xanthomonas	6e-08
d1ehya_		293	c.69.1.11 (A:) Bacterial epoxide hydrolase {Agroba	7e-08
d1k8qa_		377	c.69.1.6 (A:) Gastric lipase {Dog (Canis familiari	7e-08
d1hkha_		279	c.69.1.12 (A:) Gamma-lactamase {Aureobacterium sp.	1e-07
d1va4a_		271	c.69.1.12 (A:) Arylesterase {Pseudomonas fluoresce	1e-07
d1a88a_		275	c.69.1.12 (A:) Chloroperoxidase L {Streptomyces li	2e-07
d1wm1a_		313	c.69.1.7 (A:) Proline aminopeptidase {Serratia mar	2e-07
d1a8sa_		273	c.69.1.12 (A:) Chloroperoxidase F {Pseudomonas flu	2e-07
d1mj5a_		298	c.69.1.8 (A:) Haloalkane dehalogenase {Sphingomona	3e-07
d3c70a1		256	c.69.1.20 (A:2-257) Hydroxynitrile lyase {Rubber t	1e-06
d1r3da_		264	c.69.1.35 (A:) Hypothetical protein VC1974 {Vibrio	2e-06
d1qlwa_		318	c.69.1.15 (A:) A novel bacterial esterase {Alcalig	9e-05
d1imja_		208	c.69.1.23 (A:) Ccg1/TafII250-interacting factor B	1e-04
d1a8qa_		274	c.69.1.12 (A:) Bromoperoxidase A1 {Streptomyces au	2e-04
d2jbwa1		360	c.69.1.41 (A:8-367) 2,6-dihydropseudooxynicotine h	0.001
d1vlqa_		322	c.69.1.25 (A:) Acetyl xylan esterase TM0077 {Therm	0.004

>d1zd3a2 c.69.1.11 (A:225-547) Mammalian epoxide hydrolase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 322	Back information, alignment and structure


class: Alpha and beta proteins (a/b)
fold: alpha/beta-Hydrolases
superfamily: alpha/beta-Hydrolases
family: Epoxide hydrolase
domain: Mammalian epoxide hydrolase, C-terminal domain
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 67.2 bits (162), Expect = 5e-14
 Identities = 25/153 (16%), Positives = 60/153 (39%), Gaps = 2/153 (1%)

Query: 39  QPWYGRPLIRSFQNLLRNTAAGKLFYKMVATSESVRNILCQCYNDTSQVTEELVEKILQP 98
           +    + L R+F++L R +    L    V  +  +     +  + +  VTEE ++  +Q 
Sbjct: 168 EAELEQNLSRTFKSLFRASDESVLSMHKVCEAGGLFVNSPEEPSLSRMVTEEEIQFYVQQ 227

Query: 99  GLETGAADVF--LEFICYSGGPLPEELLPQVKCPVLIAWGDKDPWEPIELGRAYGNFDSV 156
             ++G          +  +     + L  ++  P L+   +KD     ++ +   ++   
Sbjct: 228 FKKSGFRGPLNWYRNMERNWKWACKSLGRKILIPALMVTAEKDFVLVPQMSQHMEDWIPH 287

Query: 157 EDFIVLPNVGHCPQDEAPHLVNPLVESFVTRHA 189
                + + GH  Q + P  VN ++  ++   A
Sbjct: 288 LKRGHIEDCGHWTQMDKPTEVNQILIKWLDSDA 320

PyMOL of d1zd3a2

>d1j1ia_ c.69.1.10 (A:) Meta cleavage compound hydrolase CarC {Janthinobacterium sp. J3 [TaxId: 213804]} Length = 268	Back information, alignment and structure

>d2rhwa1 c.69.1.10 (A:4-286) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Burkholderia xenovorans [TaxId: 36873]} Length = 283	Back information, alignment and structure

>d1uk8a_ c.69.1.10 (A:) Meta-cleavage product hydrolase CumD {Pseudomonas fluorescens [TaxId: 294]} Length = 271	Back information, alignment and structure

>d1bn7a_ c.69.1.8 (A:) Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1831]} Length = 291	Back information, alignment and structure

>d1b6ga_ c.69.1.8 (A:) Haloalkane dehalogenase {Xanthobacter autotrophicus [TaxId: 280]} Length = 310	Back information, alignment and structure

>d1pjaa_ c.69.1.13 (A:) Palmitoyl protein thioesterase 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 268	Back information, alignment and structure

>d1q0ra_ c.69.1.28 (A:) Aclacinomycin methylesterase RdmC {Streptomyces purpurascens [TaxId: 1924]} Length = 297	Back information, alignment and structure

>d1mtza_ c.69.1.7 (A:) Tricorn interacting factor F1 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 290	Back information, alignment and structure

>d1qo7a_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Aspergillus niger [TaxId: 5061]} Length = 394	Back information, alignment and structure

>d1c4xa_ c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Rhodococcus sp., strain rha1 [TaxId: 1831]} Length = 281	Back information, alignment and structure

>d1brta_ c.69.1.12 (A:) Bromoperoxidase A2 {Streptomyces aureofaciens [TaxId: 1894]} Length = 277	Back information, alignment and structure

>d1m33a_ c.69.1.26 (A:) Biotin biosynthesis protein BioH {Escherichia coli [TaxId: 562]} Length = 256	Back information, alignment and structure

>d1xkla_ c.69.1.20 (A:) Salicylic acid-binding protein 2 (SABP2) {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Length = 258	Back information, alignment and structure

>d1azwa_ c.69.1.7 (A:) Proline iminopeptidase {Xanthomonas campestris, pv. citri [TaxId: 339]} Length = 313	Back information, alignment and structure

>d1ehya_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Agrobacterium radiobacter [TaxId: 358]} Length = 293	Back information, alignment and structure

>d1k8qa_ c.69.1.6 (A:) Gastric lipase {Dog (Canis familiaris) [TaxId: 9615]} Length = 377	Back information, alignment and structure

>d1hkha_ c.69.1.12 (A:) Gamma-lactamase {Aureobacterium sp. [TaxId: 51671]} Length = 279	Back information, alignment and structure

>d1va4a_ c.69.1.12 (A:) Arylesterase {Pseudomonas fluorescens [TaxId: 294]} Length = 271	Back information, alignment and structure

>d1a88a_ c.69.1.12 (A:) Chloroperoxidase L {Streptomyces lividans [TaxId: 1916]} Length = 275	Back information, alignment and structure

>d1wm1a_ c.69.1.7 (A:) Proline aminopeptidase {Serratia marcescens [TaxId: 615]} Length = 313	Back information, alignment and structure

>d1a8sa_ c.69.1.12 (A:) Chloroperoxidase F {Pseudomonas fluorescens [TaxId: 294]} Length = 273	Back information, alignment and structure

>d1mj5a_ c.69.1.8 (A:) Haloalkane dehalogenase {Sphingomonas paucimobilis, UT26, LinB [TaxId: 13689]} Length = 298	Back information, alignment and structure

>d3c70a1 c.69.1.20 (A:2-257) Hydroxynitrile lyase {Rubber tree (Hevea brasiliensis) [TaxId: 3981]} Length = 256	Back information, alignment and structure

>d1r3da_ c.69.1.35 (A:) Hypothetical protein VC1974 {Vibrio cholerae [TaxId: 666]} Length = 264	Back information, alignment and structure

>d1qlwa_ c.69.1.15 (A:) A novel bacterial esterase {Alcaligenes sp. [TaxId: 512]} Length = 318	Back information, alignment and structure

>d1imja_ c.69.1.23 (A:) Ccg1/TafII250-interacting factor B (Cib) {Human (Homo sapiens) [TaxId: 9606]} Length = 208	Back information, alignment and structure

>d1a8qa_ c.69.1.12 (A:) Bromoperoxidase A1 {Streptomyces aureofaciens [TaxId: 1894]} Length = 274	Back information, alignment and structure

>d2jbwa1 c.69.1.41 (A:8-367) 2,6-dihydropseudooxynicotine hydrolase {Arthrobacter nicotinovorans [TaxId: 29320]} Length = 360	Back information, alignment and structure

>d1vlqa_ c.69.1.25 (A:) Acetyl xylan esterase TM0077 {Thermotoga maritima [TaxId: 2336]} Length = 322	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		204
d1m33a_		256	Biotin biosynthesis protein BioH {Escherichia coli	99.92
d1j1ia_		268	Meta cleavage compound hydrolase CarC {Janthinobac	99.9
d2rhwa1		283	2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas	99.9
d1ehya_		293	Bacterial epoxide hydrolase {Agrobacterium radioba	99.9
d1uk8a_		271	Meta-cleavage product hydrolase CumD {Pseudomonas	99.89
d1c4xa_		281	2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas	99.89
d1q0ra_		297	Aclacinomycin methylesterase RdmC {Streptomyces pu	99.89
d1mtza_		290	Tricorn interacting factor F1 {Archaeon Thermoplas	99.87
d1zd3a2		322	Mammalian epoxide hydrolase, C-terminal domain {Hu	99.87
d1bn7a_		291	Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1	99.87
d1b6ga_		310	Haloalkane dehalogenase {Xanthobacter autotrophicu	99.87
d1brta_		277	Bromoperoxidase A2 {Streptomyces aureofaciens [Tax	99.86
d1a8qa_		274	Bromoperoxidase A1 {Streptomyces aureofaciens [Tax	99.85
d3c70a1		256	Hydroxynitrile lyase {Rubber tree (Hevea brasilien	99.85
d1hkha_		279	Gamma-lactamase {Aureobacterium sp. [TaxId: 51671]	99.83
d1xkla_		258	Salicylic acid-binding protein 2 (SABP2) {Common t	99.83
d1a88a_		275	Chloroperoxidase L {Streptomyces lividans [TaxId:	99.82
d1mj5a_		298	Haloalkane dehalogenase {Sphingomonas paucimobilis	99.81
d1a8sa_		273	Chloroperoxidase F {Pseudomonas fluorescens [TaxId	99.8
d1va4a_		271	Arylesterase {Pseudomonas fluorescens [TaxId: 294]	99.8
d1k8qa_		377	Gastric lipase {Dog (Canis familiaris) [TaxId: 961	99.79
d1r3da_		264	Hypothetical protein VC1974 {Vibrio cholerae [TaxI	99.78
d1imja_		208	Ccg1/TafII250-interacting factor B (Cib) {Human (H	99.77
d1azwa_		313	Proline iminopeptidase {Xanthomonas campestris, pv	99.76
d2vata1		376	Acetyl-CoA:deacetylcephalosporin C acetyltransfera	99.75
d1tqha_		242	Carboxylesterase Est {Bacillus stearothermophilus	99.7
d1wm1a_		313	Proline aminopeptidase {Serratia marcescens [TaxId	99.66
d2pl5a1		362	Homoserine O-acetyltransferase {Leptospira interro	99.64
d2b61a1		357	Homoserine O-acetyltransferase {Haemophilus influe	99.63
d1jmkc_		230	Surfactin synthetase, SrfA {Bacillus subtilis [Tax	99.62
d1qo7a_		394	Bacterial epoxide hydrolase {Aspergillus niger [Ta	99.61
d1pjaa_		268	Palmitoyl protein thioesterase 2 {Human (Homo sapi	99.61
d2h7xa1		283	Picromycin polyketide synthase {Streptomyces venez	99.57
d2jbwa1		360	2,6-dihydropseudooxynicotine hydrolase {Arthrobact	99.57
d2fuka1		218	XC6422 protein {Xanthomonas campestris [TaxId: 339	99.49
d1xkta_		286	Fatty acid synthase {Human (Homo sapiens) [TaxId:	99.47
d1uxoa_		186	Hypothetical protein YdeN {Bacillus subtilis [TaxI	99.42
d1thta_		302	Myristoyl-ACP-specific thioesterase {Vibrio harvey	99.39
d2hu7a2		260	Acylamino-acid-releasing enzyme, C-terminal donain	99.25
d1l7aa_		318	Cephalosporin C deacetylase {Bacillus subtilis [Ta	99.24
d1ispa_		179	Lipase A {Bacillus subtilis [TaxId: 1423]}	99.24
d1fj2a_		229	Acyl protein thioesterase 1 {Human (Homo sapiens)	99.24
d1mo2a_		255	Erythromycin polyketide synthase {Saccharopolyspor	99.15
d1jfra_		260	Lipase {Streptomyces exfoliatus [TaxId: 1905]}	99.08
d1vlqa_		322	Acetyl xylan esterase TM0077 {Thermotoga maritima	99.05
d2bgra2		258	Dipeptidyl peptidase IV/CD26, C-terminal domain {P	99.03
d3b5ea1		209	Uncharacterized protein Mll8374 {Mesorhizobium lot	99.0
d2i3da1		218	Hypothetical protein Atu1826 {Agrobacterium tumefa	98.97
d1ufoa_		238	Hypothetical protein TT1662 {Thermus thermophilus	98.96
d2h1ia1		202	Carboxylesterase {Bacillus cereus [TaxId: 1396]}	98.92
d1dina_		233	Dienelactone hydrolase {Pseudomonas sp., B13 [TaxI	98.92
d1qlwa_		318	A novel bacterial esterase {Alcaligenes sp. [TaxId	98.85
d2r8ba1		203	Uncharacterized protein Atu2452 {Agrobacterium tum	98.84
d1xfda2		258	Dipeptidyl aminopeptidase-like protein 6, DPP6, C-	98.72
d1vkha_		263	Putative serine hydrolase Ydr428c {Baker's yeast (	98.65
d1auoa_		218	Carboxylesterase {Pseudomonas fluorescens [TaxId:	98.64
d1lnsa3		405	X-Prolyl dipeptidyl aminopeptidase PepX, middle do	98.52
d1qfma2		280	Prolyl oligopeptidase, C-terminal domain {Pig (Sus	98.45
d2d81a1		318	Polyhydroxybutyrate depolymerase {Penicillium funi	98.42
d1jjfa_		255	Feruloyl esterase domain of the cellulosomal xylan	98.33
d3c8da2		246	Enterochelin esterase, catalytic domain {Shigella	98.21
d1ju3a2		347	Bacterial cocaine esterase N-terminal domain {Rhod	98.16
d1tcaa_		317	Triacylglycerol lipase {Yeast (Candida antarctica)	98.15
d2pbla1		261	Uncharacterized protein TM1040_2492 {Silicibacter	98.0
d1cvla_		319	Lipase {Chromobacterium viscosum [TaxId: 42739]}	97.96
d1ex9a_		285	Lipase {Pseudomonas aeruginosa [TaxId: 287]}	97.89
d1jkma_		358	Carboxylesterase {Bacillus subtilis, brefeldin A e	97.79
d1lzla_		317	Heroin esterase {Rhodococcus sp. [TaxId: 1831]}	97.65
d1u4na_		308	Carboxylesterase {Alicyclobacillus acidocaldarius	97.64
g1wht.1		409	Serine carboxypeptidase II {Wheat (Triticum vulgar	97.6
d1mpxa2		381	Alpha-amino acid ester hydrolase {Xanthomonas citr	97.59
d1pv1a_		299	Hypothetical esterase YJL068C {Baker's yeast (Sacc	97.5
d1jjia_		311	Carboxylesterase {Archaeon Archaeoglobus fulgidus	97.48
d1ac5a_		483	Serine carboxypeptidase II {Baker's yeast (Sacchar	97.42
d1ivya_		452	Human 'protective protein', HPP {Human (Homo sapie	97.41
d1ei9a_		279	Palmitoyl protein thioesterase 1 {Cow (Bos taurus)	97.41
g1gxs.1		425	Hydroxynitrile lyase {Sorghum (Sorghum bicolor) [T	97.36
d1wpxa1		421	Serine carboxypeptidase II {Baker's yeast (Sacchar	97.26
d2gzsa1		265	Enterobactin and salmochelin hydrolase IroE {Esche	97.14
d1dqza_		280	Antigen 85c {Mycobacterium tuberculosis [TaxId: 17	97.05
d1sfra_		288	Antigen 85a {Mycobacterium tuberculosis [TaxId: 17	96.95
d1r88a_		267	Antigen pt51/mpb51 {Mycobacterium tuberculosis [Ta	96.91
d1wb4a1		273	Feruloyl esterase domain of the cellulosomal xylan	96.72
d1bu8a2		338	Pancreatic lipase, N-terminal domain {Rat (Rattus	96.25
d1rp1a2		337	Pancreatic lipase, N-terminal domain {Dog (Canis f	95.96
d1ku0a_		388	Lipase L1 {Bacillus stearothermophilus [TaxId: 142	95.78
d2b9va2		385	Alpha-amino acid ester hydrolase {Acetobacter past	92.3
d1uwca_		261	Feruloyl esterase A {Aspergillus niger [TaxId: 506	90.83
d1tiaa_		271	Triacylglycerol lipase {Penicillium camembertii [T	90.78
d1lgya_		265	Triacylglycerol lipase {Rhizopus niveus [TaxId: 48	90.22
d1tiba_		269	Triacylglycerol lipase {Thermomyces lanuginosus, f	89.75
d3tgla_		265	Triacylglycerol lipase {Rhizomucor miehei [TaxId:	88.98

>d1m33a_ c.69.1.26 (A:) Biotin biosynthesis protein BioH {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: alpha/beta-Hydrolases
superfamily: alpha/beta-Hydrolases
family: Biotin biosynthesis protein BioH
domain: Biotin biosynthesis protein BioH
species: Escherichia coli [TaxId: 562]

Probab=99.92  E-value=3.5e-25  Score=142.67  Aligned_cols=176  Identities=18%  Similarity=0.141  Sum_probs=108.2

Q ss_pred             CCCCHHHHHHHHHHHHCCCHHCCEEEEECCCCHHCCCCCCCCCCCHHHHHHHHHHCCHHHHHHHHHCCCHHHHHHHHHHH
Q ss_conf             96560579999987206101200488105500100146778797234777888524424556986317989999999863
Q 028774            1 MVSEQTGLVGLQAAVMEPEICRGMILLNISLRMLHIKKQPWYGRPLIRSFQNLLRNTAAGKLFYKMVATSESVRNILCQC   80 (204)
Q Consensus         1 vGhS~Gg~ia~~~a~~~p~~v~~lvl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   80 (204)
                      +||||||.+++.+|.++|+++++++++++.+..................+.......           .......+....
T Consensus        77 ~GhS~Gg~ia~~~a~~~p~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-----------~~~~~~~~~~~~  145 (256)
T d1m33a_          77 LGWSLGGLVASQIALTHPERVRALVTVASSPCFSARDEWPGIKPDVLAGFQQQLSDD-----------QQRTVERFLALQ  145 (256)
T ss_dssp             EEETHHHHHHHHHHHHCGGGEEEEEEESCCSCCBCBTTBCSBCHHHHHHHHHHHHHH-----------HHHHHHHHHHTT
T ss_pred             EECCCCHHHHHHHHHHCCCCCCEEEEEECCCCCCCCHHHHHHHHHHHHHHHHHHHHH-----------HHHHHHHHHHHH
T ss_conf             200201579999999687424011465116654531145566789999887642245-----------678999986554


Q ss_pred             CCCCCCCCHHHH---HHHHCCCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCEEEEEECCCCCCCHHHHHHHHCCCCCC
Q ss_conf             189986629999---99845488874688999998642999977669999977589840889986604788862439985
Q 028774           81 YNDTSQVTEELV---EKILQPGLETGAADVFLEFICYSGGPLPEELLPQVKCPVLIAWGDKDPWEPIELGRAYGNFDSVE  157 (204)
Q Consensus        81 ~~~~~~~~~~~~---~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~P~lii~g~~D~~~~~~~~~~~~~~~~~~  157 (204)
                      ..... ......   ......... .....+..........+....+.++++|+++|+|++|.+++++..+.+.+.+|++
T Consensus       146 ~~~~~-~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~l~~i~~P~lii~G~~D~~~p~~~~~~l~~~~~~~  223 (256)
T d1m33a_         146 TMGTE-TARQDARALKKTVLALPM-PEVDVLNGGLEILKTVDLRQPLQNVSMPFLRLYGYLDGLVPRKVVPMLDKLWPHS  223 (256)
T ss_dssp             STTST-THHHHHHHHHHHHHTSCC-CCHHHHHHHHHHHHHCCCTTGGGGCCSCEEEEEETTCSSSCGGGCC-CTTTCTTC
T ss_pred             HCCCC-CHHHHHHHHHHHHHHCCH-HHHHHHHHHHHHHCCCCHHHHHHHCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCC
T ss_conf             21431-015678887776540110-1277887665541134267788754588221444567777999999999878998


Q ss_pred             CEEECCCCCCCCCCCCCCHHHHHHHHHHHCCC
Q ss_conf             48982899999887890115699999852028
Q 028774          158 DFIVLPNVGHCPQDEAPHLVNPLVESFVTRHA  189 (204)
Q Consensus       158 ~~~~i~~~gH~~~~e~p~~~~~~i~~fl~~~~  189 (204)
                      ++++++++||++++|+|++|++.|.+|+++..
T Consensus       224 ~~~~i~~~gH~~~~e~p~~~~~~l~~fl~~ig  255 (256)
T d1m33a_         224 ESYIFAKAAHAPFISHPAEFCHLLVALKQRVG  255 (256)
T ss_dssp             EEEEETTCCSCHHHHSHHHHHHHHHHHHTTSC
T ss_pred             EEEEECCCCCCHHHHCHHHHHHHHHHHHHHCC
T ss_conf             89998999980389799999999999999768

PyMOL of d1m33a_

>d1j1ia_ c.69.1.10 (A:) Meta cleavage compound hydrolase CarC {Janthinobacterium sp. J3 [TaxId: 213804]}	Back information, alignment and structure

>d2rhwa1 c.69.1.10 (A:4-286) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Burkholderia xenovorans [TaxId: 36873]}	Back information, alignment and structure

>d1ehya_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Agrobacterium radiobacter [TaxId: 358]}	Back information, alignment and structure

>d1uk8a_ c.69.1.10 (A:) Meta-cleavage product hydrolase CumD {Pseudomonas fluorescens [TaxId: 294]}	Back information, alignment and structure

>d1c4xa_ c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Rhodococcus sp., strain rha1 [TaxId: 1831]}	Back information, alignment and structure

>d1q0ra_ c.69.1.28 (A:) Aclacinomycin methylesterase RdmC {Streptomyces purpurascens [TaxId: 1924]}	Back information, alignment and structure

>d1mtza_ c.69.1.7 (A:) Tricorn interacting factor F1 {Archaeon Thermoplasma acidophilum [TaxId: 2303]}	Back information, alignment and structure

>d1zd3a2 c.69.1.11 (A:225-547) Mammalian epoxide hydrolase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1bn7a_ c.69.1.8 (A:) Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1831]}	Back information, alignment and structure

>d1b6ga_ c.69.1.8 (A:) Haloalkane dehalogenase {Xanthobacter autotrophicus [TaxId: 280]}	Back information, alignment and structure

>d1brta_ c.69.1.12 (A:) Bromoperoxidase A2 {Streptomyces aureofaciens [TaxId: 1894]}	Back information, alignment and structure

>d1a8qa_ c.69.1.12 (A:) Bromoperoxidase A1 {Streptomyces aureofaciens [TaxId: 1894]}	Back information, alignment and structure

>d3c70a1 c.69.1.20 (A:2-257) Hydroxynitrile lyase {Rubber tree (Hevea brasiliensis) [TaxId: 3981]}	Back information, alignment and structure

>d1hkha_ c.69.1.12 (A:) Gamma-lactamase {Aureobacterium sp. [TaxId: 51671]}	Back information, alignment and structure

>d1xkla_ c.69.1.20 (A:) Salicylic acid-binding protein 2 (SABP2) {Common tobacco (Nicotiana tabacum) [TaxId: 4097]}	Back information, alignment and structure

>d1a88a_ c.69.1.12 (A:) Chloroperoxidase L {Streptomyces lividans [TaxId: 1916]}	Back information, alignment and structure

>d1mj5a_ c.69.1.8 (A:) Haloalkane dehalogenase {Sphingomonas paucimobilis, UT26, LinB [TaxId: 13689]}	Back information, alignment and structure

>d1a8sa_ c.69.1.12 (A:) Chloroperoxidase F {Pseudomonas fluorescens [TaxId: 294]}	Back information, alignment and structure

>d1va4a_ c.69.1.12 (A:) Arylesterase {Pseudomonas fluorescens [TaxId: 294]}	Back information, alignment and structure

>d1k8qa_ c.69.1.6 (A:) Gastric lipase {Dog (Canis familiaris) [TaxId: 9615]}	Back information, alignment and structure

>d1r3da_ c.69.1.35 (A:) Hypothetical protein VC1974 {Vibrio cholerae [TaxId: 666]}	Back information, alignment and structure

>d1imja_ c.69.1.23 (A:) Ccg1/TafII250-interacting factor B (Cib) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1azwa_ c.69.1.7 (A:) Proline iminopeptidase {Xanthomonas campestris, pv. citri [TaxId: 339]}	Back information, alignment and structure

>d2vata1 c.69.1.40 (A:7-382) Acetyl-CoA:deacetylcephalosporin C acetyltransferase CefG {Acremonium chrysogenum [TaxId: 5044]}	Back information, alignment and structure

>d1tqha_ c.69.1.29 (A:) Carboxylesterase Est {Bacillus stearothermophilus [TaxId: 1422]}	Back information, alignment and structure

>d1wm1a_ c.69.1.7 (A:) Proline aminopeptidase {Serratia marcescens [TaxId: 615]}	Back information, alignment and structure

>d2pl5a1 c.69.1.40 (A:5-366) Homoserine O-acetyltransferase {Leptospira interrogans [TaxId: 173]}	Back information, alignment and structure

>d2b61a1 c.69.1.40 (A:2-358) Homoserine O-acetyltransferase {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d1jmkc_ c.69.1.22 (C:) Surfactin synthetase, SrfA {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1qo7a_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Aspergillus niger [TaxId: 5061]}	Back information, alignment and structure

>d1pjaa_ c.69.1.13 (A:) Palmitoyl protein thioesterase 2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2h7xa1 c.69.1.22 (A:9-291) Picromycin polyketide synthase {Streptomyces venezuelae [TaxId: 54571]}	Back information, alignment and structure

>d2jbwa1 c.69.1.41 (A:8-367) 2,6-dihydropseudooxynicotine hydrolase {Arthrobacter nicotinovorans [TaxId: 29320]}	Back information, alignment and structure

>d2fuka1 c.69.1.36 (A:3-220) XC6422 protein {Xanthomonas campestris [TaxId: 339]}	Back information, alignment and structure

>d1xkta_ c.69.1.22 (A:) Fatty acid synthase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1uxoa_ c.69.1.31 (A:) Hypothetical protein YdeN {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1thta_ c.69.1.13 (A:) Myristoyl-ACP-specific thioesterase {Vibrio harveyi [TaxId: 669]}	Back information, alignment and structure

>d2hu7a2 c.69.1.33 (A:322-581) Acylamino-acid-releasing enzyme, C-terminal donain {Aeropyrum pernix [TaxId: 56636]}	Back information, alignment and structure

>d1l7aa_ c.69.1.25 (A:) Cephalosporin C deacetylase {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1ispa_ c.69.1.18 (A:) Lipase A {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1fj2a_ c.69.1.14 (A:) Acyl protein thioesterase 1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1mo2a_ c.69.1.22 (A:) Erythromycin polyketide synthase {Saccharopolyspora erythraea [TaxId: 1836]}	Back information, alignment and structure

>d1jfra_ c.69.1.16 (A:) Lipase {Streptomyces exfoliatus [TaxId: 1905]}	Back information, alignment and structure

>d1vlqa_ c.69.1.25 (A:) Acetyl xylan esterase TM0077 {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d2bgra2 c.69.1.24 (A:509-766) Dipeptidyl peptidase IV/CD26, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d3b5ea1 c.69.1.14 (A:7-215) Uncharacterized protein Mll8374 {Mesorhizobium loti [TaxId: 381]}	Back information, alignment and structure

>d2i3da1 c.69.1.36 (A:2-219) Hypothetical protein Atu1826 {Agrobacterium tumefaciens [TaxId: 358]}	Back information, alignment and structure

>d1ufoa_ c.69.1.27 (A:) Hypothetical protein TT1662 {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d2h1ia1 c.69.1.14 (A:1-202) Carboxylesterase {Bacillus cereus [TaxId: 1396]}	Back information, alignment and structure

>d1dina_ c.69.1.9 (A:) Dienelactone hydrolase {Pseudomonas sp., B13 [TaxId: 306]}	Back information, alignment and structure

>d1qlwa_ c.69.1.15 (A:) A novel bacterial esterase {Alcaligenes sp. [TaxId: 512]}	Back information, alignment and structure

>d2r8ba1 c.69.1.14 (A:44-246) Uncharacterized protein Atu2452 {Agrobacterium tumefaciens [TaxId: 358]}	Back information, alignment and structure

>d1xfda2 c.69.1.24 (A:592-849) Dipeptidyl aminopeptidase-like protein 6, DPP6, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1vkha_ c.69.1.32 (A:) Putative serine hydrolase Ydr428c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1auoa_ c.69.1.14 (A:) Carboxylesterase {Pseudomonas fluorescens [TaxId: 294]}	Back information, alignment and structure

>d1lnsa3 c.69.1.21 (A:146-550) X-Prolyl dipeptidyl aminopeptidase PepX, middle domain {Lactococcus lactis [TaxId: 1358]}	Back information, alignment and structure

>d1qfma2 c.69.1.4 (A:431-710) Prolyl oligopeptidase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d2d81a1 c.69.1.37 (A:21-338) Polyhydroxybutyrate depolymerase {Penicillium funiculosum [TaxId: 28572]}	Back information, alignment and structure

>d1jjfa_ c.69.1.2 (A:) Feruloyl esterase domain of the cellulosomal xylanase z {Clostridium thermocellum [TaxId: 1515]}	Back information, alignment and structure

>d3c8da2 c.69.1.2 (A:151-396) Enterochelin esterase, catalytic domain {Shigella flexneri 2a str. 2457T [TaxId: 198215]}	Back information, alignment and structure

>d1ju3a2 c.69.1.21 (A:5-351) Bacterial cocaine esterase N-terminal domain {Rhodococcus sp. mb1 [TaxId: 51612]}	Back information, alignment and structure

>d1tcaa_ c.69.1.17 (A:) Triacylglycerol lipase {Yeast (Candida antarctica), form b [TaxId: 34362]}	Back information, alignment and structure

>d2pbla1 c.69.1.2 (A:1-261) Uncharacterized protein TM1040_2492 {Silicibacter sp. tm1040 [TaxId: 292414]}	Back information, alignment and structure

>d1cvla_ c.69.1.18 (A:) Lipase {Chromobacterium viscosum [TaxId: 42739]}	Back information, alignment and structure

>d1ex9a_ c.69.1.18 (A:) Lipase {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d1jkma_ c.69.1.2 (A:) Carboxylesterase {Bacillus subtilis, brefeldin A esterase [TaxId: 1423]}	Back information, alignment and structure

>d1lzla_ c.69.1.2 (A:) Heroin esterase {Rhodococcus sp. [TaxId: 1831]}	Back information, alignment and structure

>d1u4na_ c.69.1.2 (A:) Carboxylesterase {Alicyclobacillus acidocaldarius [TaxId: 405212]}	Back information, alignment and structure

>d1mpxa2 c.69.1.21 (A:24-404) Alpha-amino acid ester hydrolase {Xanthomonas citri [TaxId: 346]}	Back information, alignment and structure

>d1pv1a_ c.69.1.34 (A:) Hypothetical esterase YJL068C {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1jjia_ c.69.1.2 (A:) Carboxylesterase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d1ac5a_ c.69.1.5 (A:) Serine carboxypeptidase II {Baker's yeast (Saccharomyces cerevisiae), kex1(delta)p [TaxId: 4932]}	Back information, alignment and structure

>d1ivya_ c.69.1.5 (A:) Human 'protective protein', HPP {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ei9a_ c.69.1.13 (A:) Palmitoyl protein thioesterase 1 {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1wpxa1 c.69.1.5 (A:1-421) Serine carboxypeptidase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2gzsa1 c.69.1.38 (A:41-305) Enterobactin and salmochelin hydrolase IroE {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1dqza_ c.69.1.3 (A:) Antigen 85c {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1sfra_ c.69.1.3 (A:) Antigen 85a {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1r88a_ c.69.1.3 (A:) Antigen pt51/mpb51 {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1wb4a1 c.69.1.2 (A:803-1075) Feruloyl esterase domain of the cellulosomal xylanase y {Clostridium thermocellum [TaxId: 1515]}	Back information, alignment and structure

>d1bu8a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1rp1a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Dog (Canis familiaris) [TaxId: 9615]}	Back information, alignment and structure

>d1ku0a_ c.69.1.18 (A:) Lipase L1 {Bacillus stearothermophilus [TaxId: 1422]}	Back information, alignment and structure

>d2b9va2 c.69.1.21 (A:50-434) Alpha-amino acid ester hydrolase {Acetobacter pasteurianus [TaxId: 438]}	Back information, alignment and structure

>d1uwca_ c.69.1.17 (A:) Feruloyl esterase A {Aspergillus niger [TaxId: 5061]}	Back information, alignment and structure

>d1tiaa_ c.69.1.17 (A:) Triacylglycerol lipase {Penicillium camembertii [TaxId: 5075]}	Back information, alignment and structure

>d1lgya_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizopus niveus [TaxId: 4844]}	Back information, alignment and structure

>d1tiba_ c.69.1.17 (A:) Triacylglycerol lipase {Thermomyces lanuginosus, formerly Humicola lanuginosa [TaxId: 5541]}	Back information, alignment and structure

>d3tgla_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizomucor miehei [TaxId: 4839]}	Back information, alignment and structure