Citrus Sinensis ID: 028837
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 203 | ||||||
| 449463639 | 221 | PREDICTED: uncharacterized protein LOC10 | 0.970 | 0.891 | 0.426 | 2e-32 | |
| 449526059 | 222 | PREDICTED: uncharacterized protein LOC10 | 0.970 | 0.887 | 0.424 | 3e-32 | |
| 357472241 | 179 | DNA polymerase epsilon subunit [Medicago | 0.556 | 0.631 | 0.532 | 2e-28 | |
| 255583719 | 232 | DNA polymerase epsilon subunit, putative | 0.517 | 0.452 | 0.566 | 4e-28 | |
| 224104657 | 212 | predicted protein [Populus trichocarpa] | 0.591 | 0.566 | 0.515 | 8e-28 | |
| 225435283 | 425 | PREDICTED: uncharacterized protein LOC10 | 0.433 | 0.207 | 0.533 | 5e-23 | |
| 363807854 | 234 | uncharacterized protein LOC100793738 [Gl | 0.492 | 0.427 | 0.5 | 3e-22 | |
| 110737921 | 206 | hypothetical protein [Arabidopsis thalia | 0.536 | 0.529 | 0.495 | 4e-21 | |
| 18390837 | 206 | DNA polymerase epsilon subunit 4 [Arabid | 0.536 | 0.529 | 0.495 | 5e-21 | |
| 295913524 | 181 | transcription factor [Lycoris longituba] | 0.487 | 0.546 | 0.456 | 4e-20 |
| >gi|449463639|ref|XP_004149539.1| PREDICTED: uncharacterized protein LOC101211039 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
Score = 144 bits (363), Expect = 2e-32, Method: Compositional matrix adjust.
Identities = 95/223 (42%), Positives = 132/223 (59%), Gaps = 26/223 (11%)
Query: 1 MASSKKRKEEKAKLKNAETRKKAKPSPKKPKQSNKKTA------------------IQNG 42
MASSKK E AK K T +KPSPK +N + + NG
Sbjct: 1 MASSKKSSTE-AKSKEVGT---SKPSPKAKTHNNARNSDKDISKKKKKKKISISISTNNG 56
Query: 43 TVSESKDEVVVTPASSSINDSQQDSETEQEGRSQEQEATNEKKKKPNKNGKKIER--DDD 100
+V ++ V P +S+ D+ E + E S++ + KK K N ++ R ++
Sbjct: 57 SVKDNHALAVSAPGASASEDADAADEDKAETTSRKSNTSKSKKVKRNHAKEEDNRYAAEE 116
Query: 101 DEVSKVCNFPMGRIKRIFKTQSSDIGITGEAVFLVNKATDKFLEQFCEDAYECCAKDRKK 160
+ K+ FPM RIK+I + ++SD+ I EA+FLVNKA++ FL QFC+DAY CCA+DRKK
Sbjct: 117 EAEEKIYKFPMHRIKKIMRDENSDLRINQEALFLVNKASEMFLVQFCKDAYACCAQDRKK 176
Query: 161 SLAYKHL--VVSEQSKYDFLSDYVPEKIKAEDALAQRELAEGG 201
SLAYKHL VVS++ +YDFLSD+VPEK+K EDAL +R +AE G
Sbjct: 177 SLAYKHLSSVVSKRKRYDFLSDFVPEKLKFEDALKERSMAESG 219
|
Source: Cucumis sativus Species: Cucumis sativus Genus: Cucumis Family: Cucurbitaceae Order: Cucurbitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|449526059|ref|XP_004170032.1| PREDICTED: uncharacterized protein LOC101228076 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|357472241|ref|XP_003606405.1| DNA polymerase epsilon subunit [Medicago truncatula] gi|355507460|gb|AES88602.1| DNA polymerase epsilon subunit [Medicago truncatula] gi|388523247|gb|AFK49676.1| nuclear transcription factor Y subunit C7 [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|255583719|ref|XP_002532613.1| DNA polymerase epsilon subunit, putative [Ricinus communis] gi|223527669|gb|EEF29779.1| DNA polymerase epsilon subunit, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|224104657|ref|XP_002313518.1| predicted protein [Populus trichocarpa] gi|222849926|gb|EEE87473.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|225435283|ref|XP_002282257.1| PREDICTED: uncharacterized protein LOC100243337 [Vitis vinifera] gi|297746240|emb|CBI16296.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|363807854|ref|NP_001242442.1| uncharacterized protein LOC100793738 [Glycine max] gi|255635803|gb|ACU18250.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|110737921|dbj|BAF00898.1| hypothetical protein [Arabidopsis thaliana] gi|110738408|dbj|BAF01130.1| hypothetical protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|18390837|ref|NP_563803.1| DNA polymerase epsilon subunit 4 [Arabidopsis thaliana] gi|8778845|gb|AAF79844.1|AC026875_24 T6D22.7 [Arabidopsis thaliana] gi|21555461|gb|AAM63864.1| unknown [Arabidopsis thaliana] gi|94442463|gb|ABF19019.1| At1g07980 [Arabidopsis thaliana] gi|332190101|gb|AEE28222.1| DNA polymerase epsilon subunit 4 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|295913524|gb|ADG58010.1| transcription factor [Lycoris longituba] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 203 | ||||||
| TAIR|locus:2205170 | 206 | NF-YC10 ""nuclear factor Y, su | 0.724 | 0.713 | 0.375 | 1.1e-21 | |
| CGD|CAL0001456 | 237 | HFL1 [Candida albicans (taxid: | 0.487 | 0.417 | 0.267 | 2.7e-10 | |
| DICTYBASE|DDB_G0272740 | 158 | DDB_G0272740 "putative histone | 0.610 | 0.784 | 0.288 | 1.8e-09 | |
| ZFIN|ZDB-GENE-050227-18 | 114 | chrac1 "chromatin accessibilit | 0.507 | 0.903 | 0.327 | 1.6e-08 | |
| FB|FBgn0043001 | 140 | Chrac-16 "Chromatin accessibil | 0.379 | 0.55 | 0.365 | 4.8e-07 | |
| UNIPROTKB|Q0P5E8 | 130 | CHRAC1 "Chromatin accessibilit | 0.433 | 0.676 | 0.322 | 7.8e-07 | |
| UNIPROTKB|Q9NRG0 | 131 | CHRAC1 "Chromatin accessibilit | 0.477 | 0.740 | 0.31 | 1e-06 | |
| MGI|MGI:2135796 | 129 | Chrac1 "chromatin accessibilit | 0.433 | 0.682 | 0.322 | 2.6e-06 | |
| RGD|1309321 | 128 | Chrac1 "chromatin accessibilit | 0.433 | 0.687 | 0.322 | 2.6e-06 | |
| FB|FBgn0029905 | 601 | Nf-YC "Nuclear factor Y-box C" | 0.403 | 0.136 | 0.317 | 2.7e-06 |
| TAIR|locus:2205170 NF-YC10 ""nuclear factor Y, subunit C10"" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 253 (94.1 bits), Expect = 1.1e-21, P = 1.1e-21
Identities = 56/149 (37%), Positives = 83/149 (55%)
Query: 50 EVVVTPASSSINDSQQDSETEQEGRSQEQEATXXXXXXXXXXXXXIERDDDDEVSKVCNF 109
E+ + +S S+ ++ + E ++ + E DD F
Sbjct: 51 EISESSSSDSVEEAIRGDEAKKSNGVVSKRGNGKSVGIPTKTSKNREEDDGGAEDAKIKF 110
Query: 110 PMGRIKRIFKTQSSDIGITGEAVFLVNKATDKFLEQFCEDAYECCAKDRKKSLAYKHL-- 167
PM RI+RI ++ +S I +AVFLVNKAT+ F+E+F E+AY+ KD+KK + YKHL
Sbjct: 111 PMNRIRRIMRSDNSAPQIMQDAVFLVNKATEMFIERFSEEAYDSSVKDKKKFIHYKHLSS 170
Query: 168 VVSEQSKYDFLSDYVPEKIKAEDALAQRE 196
VVS +Y+FL+D VPEK+KAE AL + E
Sbjct: 171 VVSNDQRYEFLADSVPEKLKAEAALEEWE 199
|
|
| CGD|CAL0001456 HFL1 [Candida albicans (taxid:5476)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0272740 DDB_G0272740 "putative histone-like transcription factor" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-050227-18 chrac1 "chromatin accessibility complex 1" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0043001 Chrac-16 "Chromatin accessibility complex 16kD protein" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q0P5E8 CHRAC1 "Chromatin accessibility complex 1" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9NRG0 CHRAC1 "Chromatin accessibility complex protein 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:2135796 Chrac1 "chromatin accessibility complex 1" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|1309321 Chrac1 "chromatin accessibility complex 1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0029905 Nf-YC "Nuclear factor Y-box C" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| estExt_fgenesh4_pg.C_LG_IX1426 | hypothetical protein (213 aa) | |||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 203 | |||
| pfam00808 | 65 | pfam00808, CBFD_NFYB_HMF, Histone-like transcripti | 4e-09 | |
| COG5208 | 286 | COG5208, HAP5, CCAAT-binding factor, subunit C [Tr | 6e-06 | |
| pfam00125 | 75 | pfam00125, Histone, Core histone H2A/H2B/H3/H4 | 6e-04 |
| >gnl|CDD|201453 pfam00808, CBFD_NFYB_HMF, Histone-like transcription factor (CBF/NF-Y) and archaeal histone | Back alignment and domain information |
|---|
Score = 50.7 bits (122), Expect = 4e-09
Identities = 17/59 (28%), Positives = 35/59 (59%)
Query: 109 FPMGRIKRIFKTQSSDIGITGEAVFLVNKATDKFLEQFCEDAYECCAKDRKKSLAYKHL 167
P+ R+KRI K+ I+ +A L+ + ++F+E +A E C K+++K++ +H+
Sbjct: 3 LPIARVKRIMKSDPDAGRISQDAKELIAECVEEFIEFIASEAAEICKKEKRKTINAEHI 61
|
This family includes archaebacterial histones and histone like transcription factors from eukaryotes. Length = 65 |
| >gnl|CDD|227533 COG5208, HAP5, CCAAT-binding factor, subunit C [Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|201020 pfam00125, Histone, Core histone H2A/H2B/H3/H4 | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 203 | |||
| KOG1657 | 236 | consensus CCAAT-binding factor, subunit C (HAP5) [ | 99.84 | |
| COG5208 | 286 | HAP5 CCAAT-binding factor, subunit C [Transcriptio | 99.8 | |
| PF00808 | 65 | CBFD_NFYB_HMF: Histone-like transcription factor ( | 99.77 | |
| KOG1659 | 224 | consensus Class 2 transcription repressor NC2, alp | 99.75 | |
| COG5247 | 113 | BUR6 Class 2 transcription repressor NC2, alpha su | 99.68 | |
| KOG1658 | 162 | consensus DNA polymerase epsilon, subunit C [Repli | 99.32 | |
| KOG0869 | 168 | consensus CCAAT-binding factor, subunit A (HAP3) [ | 98.99 | |
| cd00074 | 115 | H2A Histone 2A; H2A is a subunit of the nucleosome | 98.81 | |
| COG5262 | 132 | HTA1 Histone H2A [Chromatin structure and dynamics | 98.75 | |
| KOG0870 | 172 | consensus DNA polymerase epsilon, subunit D [Trans | 98.68 | |
| smart00414 | 106 | H2A Histone 2A. | 98.43 | |
| COG2036 | 91 | HHT1 Histones H3 and H4 [Chromatin structure and d | 98.37 | |
| PLN00154 | 136 | histone H2A; Provisional | 98.35 | |
| PTZ00017 | 134 | histone H2A; Provisional | 98.34 | |
| KOG1756 | 131 | consensus Histone 2A [Chromatin structure and dyna | 98.21 | |
| PLN00153 | 129 | histone H2A; Provisional | 98.11 | |
| PLN00157 | 132 | histone H2A; Provisional | 98.1 | |
| PF00125 | 75 | Histone: Core histone H2A/H2B/H3/H4 histone h2a si | 98.1 | |
| PLN00156 | 139 | histone H2AX; Provisional | 98.09 | |
| cd00076 | 85 | H4 Histone H4, one of the four histones, along wit | 97.97 | |
| smart00803 | 65 | TAF TATA box binding protein associated factor. TA | 97.96 | |
| PTZ00252 | 134 | histone H2A; Provisional | 97.94 | |
| PLN00035 | 103 | histone H4; Provisional | 97.85 | |
| smart00417 | 74 | H4 Histone H4. | 97.78 | |
| KOG0871 | 156 | consensus Class 2 transcription repressor NC2, bet | 97.72 | |
| PTZ00015 | 102 | histone H4; Provisional | 97.65 | |
| cd07981 | 72 | TAF12 TATA Binding Protein (TBP) Associated Factor | 97.52 | |
| KOG1658 | 162 | consensus DNA polymerase epsilon, subunit C [Repli | 97.31 | |
| smart00428 | 105 | H3 Histone H3. | 97.23 | |
| COG5150 | 148 | Class 2 transcription repressor NC2, beta subunit | 96.71 | |
| cd08048 | 85 | TAF11 TATA Binding Protein (TBP) Associated Factor | 96.69 | |
| PLN00121 | 136 | histone H3; Provisional | 96.51 | |
| PTZ00018 | 136 | histone H3; Provisional | 96.37 | |
| PF15511 | 414 | CENP-T: Centromere kinetochore component CENP-T; P | 96.27 | |
| PLN00160 | 97 | histone H3; Provisional | 95.96 | |
| PLN00161 | 135 | histone H3; Provisional | 95.91 | |
| cd07979 | 117 | TAF9 TATA Binding Protein (TBP) Associated Factor | 95.68 | |
| KOG1757 | 131 | consensus Histone 2A [Chromatin structure and dyna | 95.62 | |
| PF09415 | 72 | CENP-X: CENP-S associating Centromere protein X; I | 95.27 | |
| PF02269 | 93 | TFIID-18kDa: Transcription initiation factor IID, | 95.24 | |
| smart00576 | 77 | BTP Bromodomain transcription factors and PHD doma | 94.7 | |
| PF02969 | 66 | TAF: TATA box binding protein associated factor (T | 93.96 | |
| cd08050 | 343 | TAF6 TATA Binding Protein (TBP) Associated Factor | 93.78 | |
| PF03847 | 68 | TFIID_20kDa: Transcription initiation factor TFIID | 93.77 | |
| PF04719 | 90 | TAFII28: hTAFII28-like protein conserved region; I | 93.2 | |
| KOG1142 | 258 | consensus Transcription initiation factor TFIID, s | 92.27 | |
| cd07978 | 92 | TAF13 The TATA Binding Protein (TBP) Associated Fa | 92.12 | |
| PF15630 | 76 | CENP-S: Kinetochore component CENP-S; PDB: 4DRA_C | 91.39 | |
| KOG1745 | 137 | consensus Histones H3 and H4 [Chromatin structure | 90.93 | |
| smart00427 | 89 | H2B Histone H2B. | 90.53 | |
| PF05236 | 264 | TAF4: Transcription initiation factor TFIID compon | 90.5 | |
| PLN00155 | 58 | histone H2A; Provisional | 87.05 | |
| KOG3219 | 195 | consensus Transcription initiation factor TFIID, s | 86.44 | |
| PF15510 | 102 | CENP-W: Centromere kinetochore component W | 85.89 | |
| PF03540 | 51 | TFIID_30kDa: Transcription initiation factor TFIID | 84.17 | |
| PF07524 | 77 | Bromo_TP: Bromodomain associated; InterPro: IPR006 | 83.48 | |
| PLN00158 | 116 | histone H2B; Provisional | 83.27 | |
| KOG1744 | 127 | consensus Histone H2B [Chromatin structure and dyn | 82.86 | |
| cd08045 | 212 | TAF4 TATA Binding Protein (TBP) Associated Factor | 82.59 | |
| PTZ00463 | 117 | histone H2B; Provisional | 81.96 |
| >KOG1657 consensus CCAAT-binding factor, subunit C (HAP5) [Transcription] | Back alignment and domain information |
|---|
Probab=99.84 E-value=5.9e-22 Score=173.00 Aligned_cols=93 Identities=29% Similarity=0.453 Sum_probs=88.3
Q ss_pred CccccccCCCCChHHHHHHHhcCCCccchhhHHHHHHHHHHHHHHHHHHHHHHHHHHhcCCCccccCce--EEeeCCccc
Q 028837 99 DDDEVSKVCNFPMGRIKRIFKTQSSDIGITGEAVFLVNKATDKFLEQFCEDAYECCAKDRKKSLAYKHL--VVSEQSKYD 176 (203)
Q Consensus 99 ~~~~~~~~~~LPlARVKrIMK~DpDv~~IS~EA~~lIaKAtELFIq~La~~A~~~A~~~kRKTL~y~DL--aV~~~~~fd 176 (203)
.+..++....|||+|||+|||.|++|.+|+.||++++++|||+||..|+..+|.++..++|++|++.|| +|...+.|+
T Consensus 65 e~~~d~~~~~lPlaRiKkimK~dedv~mI~~Eapvl~aka~E~Fi~elt~~sw~~Tee~~rrtl~~sdia~av~~s~~fd 144 (236)
T KOG1657|consen 65 EGQLDFKNHILPLARIKKIMKSDEDVSMITAEAPVLFAKACELFITELTLRSWVHTEENKRRTLQKSDIAAAVTQSETFD 144 (236)
T ss_pred ccccchhhccCcHhhccccccccccccccchhHHHHHHHHHHHHHHHHHHHhhhhhcccccccchHHHHHHHhccCCCcc
Confidence 456788999999999999999999999999999999999999999999999999999999999999999 999999999
Q ss_pred ccccccCCcccHHHH
Q 028837 177 FLSDYVPEKIKAEDA 191 (203)
Q Consensus 177 FL~DIVP~ki~l~d~ 191 (203)
||.||||+...++.+
T Consensus 145 FL~DivP~~~~~~~~ 159 (236)
T KOG1657|consen 145 FLRDIVPRKILAEKY 159 (236)
T ss_pred ceeccccchhccccc
Confidence 999999998877654
|
|
| >COG5208 HAP5 CCAAT-binding factor, subunit C [Transcription] | Back alignment and domain information |
|---|
| >PF00808 CBFD_NFYB_HMF: Histone-like transcription factor (CBF/NF-Y) and archaeal histone; InterPro: IPR003958 The CCAAT-binding factor (CBF) is a mammalian transcription factor that binds to a CCAAT motif in the promoters of a wide variety of genes, including type I collagen and albumin | Back alignment and domain information |
|---|
| >KOG1659 consensus Class 2 transcription repressor NC2, alpha subunit (DRAP1) [Transcription] | Back alignment and domain information |
|---|
| >COG5247 BUR6 Class 2 transcription repressor NC2, alpha subunit (DRAP1 homolog) [Transcription] | Back alignment and domain information |
|---|
| >KOG1658 consensus DNA polymerase epsilon, subunit C [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0869 consensus CCAAT-binding factor, subunit A (HAP3) [Transcription] | Back alignment and domain information |
|---|
| >cd00074 H2A Histone 2A; H2A is a subunit of the nucleosome | Back alignment and domain information |
|---|
| >COG5262 HTA1 Histone H2A [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG0870 consensus DNA polymerase epsilon, subunit D [Transcription] | Back alignment and domain information |
|---|
| >smart00414 H2A Histone 2A | Back alignment and domain information |
|---|
| >COG2036 HHT1 Histones H3 and H4 [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >PLN00154 histone H2A; Provisional | Back alignment and domain information |
|---|
| >PTZ00017 histone H2A; Provisional | Back alignment and domain information |
|---|
| >KOG1756 consensus Histone 2A [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >PLN00153 histone H2A; Provisional | Back alignment and domain information |
|---|
| >PLN00157 histone H2A; Provisional | Back alignment and domain information |
|---|
| >PF00125 Histone: Core histone H2A/H2B/H3/H4 histone h2a signature histone h2b signature histone h3 signature histone h4 signature; InterPro: IPR007125 The core histones together with some other DNA binding proteins appear to form a superfamily defined by a common fold and distant sequence similarities [, ] | Back alignment and domain information |
|---|
| >PLN00156 histone H2AX; Provisional | Back alignment and domain information |
|---|
| >cd00076 H4 Histone H4, one of the four histones, along with H2A, H2B and H3, which forms the eukaryotic nucleosome core; along with H3, it plays a central role in nucleosome formation; histones bind to DNA and wrap the genetic material into "beads on a string" in which DNA (the string) is wrapped around small blobs of histones (the beads) at regular intervals; play a role in the inheritance of specialized chromosome structures and the control of gene activity; defects in the establishment of proper chromosome structure by histones may activate or silence genes aberrantly and thus lead to disease; the sequence of histone H4 has remained almost invariant in more than 2 billion years of evolution | Back alignment and domain information |
|---|
| >smart00803 TAF TATA box binding protein associated factor | Back alignment and domain information |
|---|
| >PTZ00252 histone H2A; Provisional | Back alignment and domain information |
|---|
| >PLN00035 histone H4; Provisional | Back alignment and domain information |
|---|
| >smart00417 H4 Histone H4 | Back alignment and domain information |
|---|
| >KOG0871 consensus Class 2 transcription repressor NC2, beta subunit (Dr1) [Transcription] | Back alignment and domain information |
|---|
| >PTZ00015 histone H4; Provisional | Back alignment and domain information |
|---|
| >cd07981 TAF12 TATA Binding Protein (TBP) Associated Factor 12 (TAF12) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex | Back alignment and domain information |
|---|
| >KOG1658 consensus DNA polymerase epsilon, subunit C [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >smart00428 H3 Histone H3 | Back alignment and domain information |
|---|
| >COG5150 Class 2 transcription repressor NC2, beta subunit (Dr1) [Transcription] | Back alignment and domain information |
|---|
| >cd08048 TAF11 TATA Binding Protein (TBP) Associated Factor 11 (TAF11) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex | Back alignment and domain information |
|---|
| >PLN00121 histone H3; Provisional | Back alignment and domain information |
|---|
| >PTZ00018 histone H3; Provisional | Back alignment and domain information |
|---|
| >PF15511 CENP-T: Centromere kinetochore component CENP-T; PDB: 3B0D_T 3B0C_T 3VH5_T 3VH6_T | Back alignment and domain information |
|---|
| >PLN00160 histone H3; Provisional | Back alignment and domain information |
|---|
| >PLN00161 histone H3; Provisional | Back alignment and domain information |
|---|
| >cd07979 TAF9 TATA Binding Protein (TBP) Associated Factor 9 (TAF9) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex | Back alignment and domain information |
|---|
| >KOG1757 consensus Histone 2A [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >PF09415 CENP-X: CENP-S associating Centromere protein X; InterPro: IPR018552 Centromere protein X (CENP-X) is a component of the CENP-S complex | Back alignment and domain information |
|---|
| >PF02269 TFIID-18kDa: Transcription initiation factor IID, 18kD subunit; InterPro: IPR003195 This family includes the Spt3 yeast transcription factors and the 18 kDa subunit from human transcription initiation factor IID (TFIID-18) | Back alignment and domain information |
|---|
| >smart00576 BTP Bromodomain transcription factors and PHD domain containing proteins | Back alignment and domain information |
|---|
| >PF02969 TAF: TATA box binding protein associated factor (TAF); InterPro: IPR004823 The TATA box binding protein associated factor (TAF) is part of the transcription initiation factor TFIID multimeric protein complex | Back alignment and domain information |
|---|
| >cd08050 TAF6 TATA Binding Protein (TBP) Associated Factor 6 (TAF6) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex | Back alignment and domain information |
|---|
| >PF03847 TFIID_20kDa: Transcription initiation factor TFIID subunit A; InterPro: IPR003228 Human transcription initiation factor TFIID is composed of the TATA-binding polypeptide (TBP) and at least 13 TBP-associated factors (TAFs) that collectively or individually are involved in activator-dependent transcription [] | Back alignment and domain information |
|---|
| >PF04719 TAFII28: hTAFII28-like protein conserved region; InterPro: IPR006809 The general transcription factor, TFIID, consists of the TATA-binding protein (TBP) associated with a series of TBP-associated factors (TAFs) that together participate in the assembly of the transcription preinitiation complex | Back alignment and domain information |
|---|
| >KOG1142 consensus Transcription initiation factor TFIID, subunit TAF12 (also component of histone acetyltransferase SAGA) [Transcription] | Back alignment and domain information |
|---|
| >cd07978 TAF13 The TATA Binding Protein (TBP) Associated Factor 13 (TAF13) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex | Back alignment and domain information |
|---|
| >PF15630 CENP-S: Kinetochore component CENP-S; PDB: 4DRA_C 4DRB_H 3V9R_C | Back alignment and domain information |
|---|
| >KOG1745 consensus Histones H3 and H4 [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >smart00427 H2B Histone H2B | Back alignment and domain information |
|---|
| >PF05236 TAF4: Transcription initiation factor TFIID component TAF4 family; InterPro: IPR007900 Accurate transcription initiation at protein-coding genes by RNA polymerase II requires the assembly of a multiprotein complex around the mRNA start site | Back alignment and domain information |
|---|
| >PLN00155 histone H2A; Provisional | Back alignment and domain information |
|---|
| >KOG3219 consensus Transcription initiation factor TFIID, subunit TAF11 [Transcription] | Back alignment and domain information |
|---|
| >PF15510 CENP-W: Centromere kinetochore component W | Back alignment and domain information |
|---|
| >PF03540 TFIID_30kDa: Transcription initiation factor TFIID 23-30kDa subunit; InterPro: IPR003923 Transcription initiation factor TFIID is a multimeric protein complex that plays a central role in mediating promoter responses to various activators and repressors | Back alignment and domain information |
|---|
| >PF07524 Bromo_TP: Bromodomain associated; InterPro: IPR006565 This bromodomain is found in eukaryotic transcription factors and PHD domain containing proteins (IPR001965 from INTERPRO) | Back alignment and domain information |
|---|
| >PLN00158 histone H2B; Provisional | Back alignment and domain information |
|---|
| >KOG1744 consensus Histone H2B [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >cd08045 TAF4 TATA Binding Protein (TBP) Associated Factor 4 (TAF4) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex | Back alignment and domain information |
|---|
| >PTZ00463 histone H2B; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 203 | ||||
| 2byk_A | 140 | Histone Fold Heterodimer Of The Chromatin Accessibi | 1e-06 |
| >pdb|2BYK|A Chain A, Histone Fold Heterodimer Of The Chromatin Accessibility Complex Length = 140 | Back alignment and structure |
|
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 203 | |||
| 1n1j_B | 97 | NF-YC; histone-like PAIR, DNA binding protein; 1.6 | 2e-16 | |
| 2byk_A | 140 | Chrac-16; nucleosome sliding, histone fold, DNA-bi | 6e-14 | |
| 1jfi_A | 98 | Transcription regulator NC2 alpha chain; histone, | 3e-11 |
| >1n1j_B NF-YC; histone-like PAIR, DNA binding protein; 1.67A {Homo sapiens} SCOP: a.22.1.3 Length = 97 | Back alignment and structure |
|---|
Score = 70.4 bits (172), Expect = 2e-16
Identities = 22/81 (27%), Positives = 40/81 (49%), Gaps = 2/81 (2%)
Query: 105 KVCNFPMGRIKRIFKTQSSDIGITGEAVFLVNKATDKFLEQFCEDAYECCAKDRKKSLAY 164
+V P+ RIK+I K I+ EA L KA F+ + A+ +++++L
Sbjct: 16 RVQELPLARIKKIMKLDEDVKMISAEAPVLFAKAAQIFITELTLRAWIHTEDNKRRTLQR 75
Query: 165 KHL--VVSEQSKYDFLSDYVP 183
+ +++ ++DFL D VP
Sbjct: 76 NDIAMAITKFDQFDFLIDIVP 96
|
| >2byk_A Chrac-16; nucleosome sliding, histone fold, DNA-binding protein; 2.4A {Drosophila melanogaster} SCOP: a.22.1.3 PDB: 2bym_A Length = 140 | Back alignment and structure |
|---|
| >1jfi_A Transcription regulator NC2 alpha chain; histone, H2A/H2B, tata-DNA, transcription initiation, NC2, negative cofactor, structural genomics, PSI; 2.62A {Homo sapiens} SCOP: a.22.1.3 Length = 98 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 203 | |||
| 2byk_A | 140 | Chrac-16; nucleosome sliding, histone fold, DNA-bi | 99.95 | |
| 1n1j_B | 97 | NF-YC; histone-like PAIR, DNA binding protein; 1.6 | 99.93 | |
| 4g92_C | 119 | HAPE; transcription factor, nucleosome, minor groo | 99.93 | |
| 1jfi_A | 98 | Transcription regulator NC2 alpha chain; histone, | 99.92 | |
| 1n1j_A | 93 | NF-YB; histone-like PAIR, DNA binding protein; 1.6 | 99.79 | |
| 2byk_B | 128 | Chrac-14; nucleosome sliding, histone fold, DNA-bi | 99.78 | |
| 3b0c_W | 76 | CENP-W, centromere protein W; histone fold, DNA bi | 99.47 | |
| 1jfi_B | 179 | DR1 protein, transcription regulator NC2 beta chai | 99.43 | |
| 1b67_A | 68 | Protein (histone HMFA); DNA binding protein; 1.48A | 99.43 | |
| 1id3_C | 131 | Histone H2A.1; nucleosome core particle, chromatin | 99.06 | |
| 2nqb_C | 123 | Histone H2A; nucleosome, NCP, chromatin, structura | 99.05 | |
| 1tzy_A | 129 | Histone H2A-IV; histone-fold, tetramer-dimer-dimer | 99.04 | |
| 2f8n_G | 120 | Core histone macro-H2A.1; nucleosome, NCP, macroh2 | 99.01 | |
| 1f66_C | 128 | Histone H2A.Z; nucleosome, chromatin, histone vari | 98.98 | |
| 2f8n_K | 149 | Histone H2A type 1; nucleosome, NCP, macroh2A, his | 98.95 | |
| 1ku5_A | 70 | HPHA, archaeal histon; histone fold, DNA binding p | 98.88 | |
| 3b0c_T | 111 | CENP-T, centromere protein T; histone fold, DNA bi | 98.84 | |
| 1f1e_A | 154 | Histone fold protein; archaeal histone protein, DN | 98.74 | |
| 2jss_A | 192 | Chimera of histone H2B.1 and histone H2A.Z; histon | 98.7 | |
| 1f1e_A | 154 | Histone fold protein; archaeal histone protein, DN | 98.66 | |
| 1tzy_D | 103 | Histone H4-VI; histone-fold, tetramer-dimer-dimer, | 98.58 | |
| 2yfw_B | 103 | Histone H4, H4; cell cycle, kinetochore, centromer | 98.55 | |
| 2hue_C | 84 | Histone H4; mini beta sheet, elongated beta sandwh | 98.52 | |
| 1id3_B | 102 | Histone H4; nucleosome core particle, chromatin, p | 98.52 | |
| 2hue_B | 77 | Histone H3; mini beta sheet, elongated beta sandwh | 97.57 | |
| 1taf_B | 70 | TFIID TBP associated factor 62; transcription init | 97.51 | |
| 2yfv_A | 100 | Histone H3-like centromeric protein CSE4; cell cyc | 97.13 | |
| 1tzy_C | 136 | Histone H3; histone-fold, tetramer-dimer-dimer, DN | 97.08 | |
| 3v9r_A | 90 | MHF1, uncharacterized protein YOL086W-A; histone f | 96.77 | |
| 3nqj_A | 82 | Histone H3-like centromeric protein A; alpha helix | 96.67 | |
| 3b0b_B | 107 | CENP-S, centromere protein S; histone fold, DNA bi | 96.6 | |
| 4dra_A | 113 | Centromere protein S; DNA binding complex, DNA dam | 96.59 | |
| 1taf_A | 68 | TFIID TBP associated factor 42; transcription init | 96.42 | |
| 4dra_E | 84 | Centromere protein X; DNA binding complex, DNA dam | 96.34 | |
| 3r45_A | 156 | Histone H3-like centromeric protein A; histone fol | 96.31 | |
| 3nqu_A | 140 | Histone H3-like centromeric protein A; alpha helix | 96.27 | |
| 3vh5_A | 140 | CENP-S; histone fold, chromosome segregation, DNA | 96.25 | |
| 3b0b_C | 81 | CENP-X, centromere protein X; histone fold, DNA bi | 96.14 | |
| 2ly8_A | 121 | Budding yeast chaperone SCM3; centromere protein, | 96.13 | |
| 2l5a_A | 235 | Histone H3-like centromeric protein CSE4, protein | 95.88 | |
| 2l5a_A | 235 | Histone H3-like centromeric protein CSE4, protein | 94.49 | |
| 1bh9_B | 89 | TAFII28; histone fold, tata binding protein, trans | 94.34 | |
| 3ksy_A | 1049 | SOS-1, SON of sevenless homolog 1; RAS, RAS activa | 94.33 | |
| 2nqb_D | 123 | Histone H2B; nucleosome, NCP, chromatin, structura | 93.15 | |
| 1tzy_B | 126 | Histone H2B; histone-fold, tetramer-dimer-dimer, D | 92.88 | |
| 1h3o_B | 76 | Transcription initiation factor TFIID 20/15 kDa su | 92.41 | |
| 2jss_A | 192 | Chimera of histone H2B.1 and histone H2A.Z; histon | 91.71 | |
| 2ly8_A | 121 | Budding yeast chaperone SCM3; centromere protein, | 86.76 | |
| 3v9r_B | 88 | MHF2, uncharacterized protein YDL160C-A; histone f | 86.7 |
| >2byk_A Chrac-16; nucleosome sliding, histone fold, DNA-binding protein; 2.4A {Drosophila melanogaster} SCOP: a.22.1.3 PDB: 2bym_A | Back alignment and structure |
|---|
Probab=99.95 E-value=4.3e-29 Score=201.60 Aligned_cols=98 Identities=28% Similarity=0.455 Sum_probs=68.6
Q ss_pred ccccCCCCChHHHHHHHhcCCCccchhhHHHHHHHHHHHHHHHHHHHHHHHHH-HhcCCCccccCce--EEeeCCccccc
Q 028837 102 EVSKVCNFPMGRIKRIFKTQSSDIGITGEAVFLVNKATDKFLEQFCEDAYECC-AKDRKKSLAYKHL--VVSEQSKYDFL 178 (203)
Q Consensus 102 ~~~~~~~LPlARVKrIMK~DpDv~~IS~EA~~lIaKAtELFIq~La~~A~~~A-~~~kRKTL~y~DL--aV~~~~~fdFL 178 (203)
.....+.||++||+||||.||++++||++|+++|++|||+||++|+..||.+| +..+|+||+|+|| ||...+.|+||
T Consensus 13 ~~~~~~~LPlaRIKrIMK~dpdv~~Is~eA~vliakA~ElFI~~Lt~~A~~~a~~~~kRKtI~~~Dl~~AV~~~e~~dFL 92 (140)
T 2byk_A 13 PPTAETFLPLSRVRTIMKSSMDTGLITNEVLFLMTKCTELFVRHLAGAAYTEEFGQRPGEALKYEHLSQVVNKNKNLEFL 92 (140)
T ss_dssp ----------------CCSSSSCSCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHTTCCSCEECHHHHHHHHHTCSTTGGG
T ss_pred CcccCCCCCHHHHHHHHhcCcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCCcccCHHHHHHHHhcCchhhhH
Confidence 44577899999999999999999999999999999999999999999999999 9999999999999 99999999999
Q ss_pred ccccCCcccHHHHHHHHHHhc
Q 028837 179 SDYVPEKIKAEDALAQRELAE 199 (203)
Q Consensus 179 ~DIVP~ki~l~d~l~~rk~~~ 199 (203)
.||||.++++++|++.++...
T Consensus 93 ~divP~ki~l~~~~~~~~~~~ 113 (140)
T 2byk_A 93 LQIVPQKIRVHQFQEMLRLNR 113 (140)
T ss_dssp TTTSCSCC-------------
T ss_pred hccccchhhHHHHHHHHHhcc
Confidence 999999999999999887654
|
| >1n1j_B NF-YC; histone-like PAIR, DNA binding protein; 1.67A {Homo sapiens} SCOP: a.22.1.3 | Back alignment and structure |
|---|
| >4g92_C HAPE; transcription factor, nucleosome, minor groove binding, CCAA complex, histone fold motif, specific binding to the ccaat- nucleus; HET: DNA; 1.80A {Aspergillus nidulans} PDB: 4g91_C* | Back alignment and structure |
|---|
| >1jfi_A Transcription regulator NC2 alpha chain; histone, H2A/H2B, tata-DNA, transcription initiation, NC2, negative cofactor, structural genomics, PSI; 2.62A {Homo sapiens} SCOP: a.22.1.3 | Back alignment and structure |
|---|
| >1n1j_A NF-YB; histone-like PAIR, DNA binding protein; 1.67A {Homo sapiens} SCOP: a.22.1.3 | Back alignment and structure |
|---|
| >2byk_B Chrac-14; nucleosome sliding, histone fold, DNA-binding protein; 2.4A {Drosophila melanogaster} SCOP: a.22.1.3 PDB: 2bym_B | Back alignment and structure |
|---|
| >3b0c_W CENP-W, centromere protein W; histone fold, DNA binding, DNA binding protein; HET: CIT; 2.20A {Gallus gallus} PDB: 3b0d_W* 3vh5_W 3vh6_W | Back alignment and structure |
|---|
| >1jfi_B DR1 protein, transcription regulator NC2 beta chain; histone, H2A/H2B, tata-DNA, transcription initiation, NC2, negative cofactor, structural genomics, PSI; 2.62A {Homo sapiens} SCOP: a.22.1.3 | Back alignment and structure |
|---|
| >1b67_A Protein (histone HMFA); DNA binding protein; 1.48A {Methanothermus fervidus} SCOP: a.22.1.2 PDB: 1hta_A 1a7w_A 1b6w_A 1bfm_A | Back alignment and structure |
|---|
| >1id3_C Histone H2A.1; nucleosome core particle, chromatin, protein/DNA interaction, nucleoprotein, supercoiled DNA; 3.10A {Saccharomyces cerevisiae} SCOP: a.22.1.1 | Back alignment and structure |
|---|
| >2nqb_C Histone H2A; nucleosome, NCP, chromatin, structural protein/DNA complex; 2.30A {Drosophila melanogaster} PDB: 2pyo_C* | Back alignment and structure |
|---|
| >1tzy_A Histone H2A-IV; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1eqz_A 1hq3_A 2aro_A 2hio_A 3c9k_A 3azg_C 3a6n_C 3an2_C 3av1_C 3av2_C 3ayw_C 3aze_C 3azf_C 3afa_C 3azh_C 3azi_C 3azj_C 3azk_C 3azl_C 3azm_C ... | Back alignment and structure |
|---|
| >2f8n_G Core histone macro-H2A.1; nucleosome, NCP, macroh2A, histone variant, chromatin, X- RAY structure, crystallography, structural protein/DNA complex; 2.90A {Homo sapiens} SCOP: a.22.1.1 PDB: 1u35_C | Back alignment and structure |
|---|
| >1f66_C Histone H2A.Z; nucleosome, chromatin, histone variant, protein DNA interaction, nucleoprotein, supercoiled DNA, complex (nucleosome core/DNA); 2.60A {Homo sapiens} SCOP: a.22.1.1 | Back alignment and structure |
|---|
| >2f8n_K Histone H2A type 1; nucleosome, NCP, macroh2A, histone variant, chromatin, X- RAY structure, crystallography, structural protein/DNA complex; 2.90A {Mus musculus} SCOP: a.22.1.1 | Back alignment and structure |
|---|
| >1ku5_A HPHA, archaeal histon; histone fold, DNA binding protein; 2.30A {Pyrococcus horikoshii} SCOP: a.22.1.2 | Back alignment and structure |
|---|
| >3b0c_T CENP-T, centromere protein T; histone fold, DNA binding, DNA binding protein; HET: CIT; 2.20A {Gallus gallus} PDB: 3b0d_T* 3vh5_T 3vh6_T | Back alignment and structure |
|---|
| >1f1e_A Histone fold protein; archaeal histone protein, DNA binding protein; HET: MSE; 1.37A {Methanopyrus kandleri} SCOP: a.22.1.2 | Back alignment and structure |
|---|
| >2jss_A Chimera of histone H2B.1 and histone H2A.Z; histone/chaperone complex, intrinsically unfolded protein, chaperone/structural protein complex; NMR {Saccharomyces cerevisiae} SCOP: a.22.1.1 a.22.1.1 | Back alignment and structure |
|---|
| >1f1e_A Histone fold protein; archaeal histone protein, DNA binding protein; HET: MSE; 1.37A {Methanopyrus kandleri} SCOP: a.22.1.2 | Back alignment and structure |
|---|
| >1tzy_D Histone H4-VI; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1f66_B 1eqz_D 1hq3_D 1u35_B 2aro_D 2cv5_B* 2f8n_B 3nqu_B 3r45_B 3azg_B 3a6n_B 3an2_B 3av1_B 3av2_B 3ayw_B 3aze_B 3azf_B 3afa_B 3azh_B 3azk_B ... | Back alignment and structure |
|---|
| >2yfw_B Histone H4, H4; cell cycle, kinetochore, centromere, histone chaperone, BUDD; 2.60A {Kluyveromyces lactis nrrl y-1140} | Back alignment and structure |
|---|
| >2hue_C Histone H4; mini beta sheet, elongated beta sandwhich, DNA binding prote; 1.70A {Xenopus laevis} SCOP: a.22.1.1 PDB: 3nqj_B 1aoi_B 3kwq_B* 1hio_D 2yfv_B | Back alignment and structure |
|---|
| >1id3_B Histone H4; nucleosome core particle, chromatin, protein/DNA interaction, nucleoprotein, supercoiled DNA; 3.10A {Saccharomyces cerevisiae} SCOP: a.22.1.1 | Back alignment and structure |
|---|
| >2hue_B Histone H3; mini beta sheet, elongated beta sandwhich, DNA binding prote; 1.70A {Xenopus laevis} | Back alignment and structure |
|---|
| >1taf_B TFIID TBP associated factor 62; transcription initiation, histone fold, complex (TWO transcr factors); 2.00A {Drosophila melanogaster} SCOP: a.22.1.3 | Back alignment and structure |
|---|
| >2yfv_A Histone H3-like centromeric protein CSE4; cell cycle, kinetochore, centromere, histone chaperone, BUDD; 2.32A {Kluyveromyces lactis nrrl y-1140} PDB: 2yfw_A | Back alignment and structure |
|---|
| >1tzy_C Histone H3; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1eqz_C 1hq3_C 2aro_C 2f8n_A 2hio_C 3av1_A 3lel_A 3afa_A 3azi_A 3azj_A 3azk_A 3azl_A 3azm_A 3azn_A 2cv5_A* 1u35_A* 2nqb_A 2io5_B 2pyo_A* 3c9k_C ... | Back alignment and structure |
|---|
| >3v9r_A MHF1, uncharacterized protein YOL086W-A; histone fold, fanconi anemia, DNA repair, DNA BI protein; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3nqj_A Histone H3-like centromeric protein A; alpha helix, histone fold, centromere, DNA binding protein; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3b0b_B CENP-S, centromere protein S; histone fold, DNA binding, DNA, nucleus, DNA binding protein; 2.15A {Gallus gallus} | Back alignment and structure |
|---|
| >4dra_A Centromere protein S; DNA binding complex, DNA damage repair, histone-fold, DNA BI protein; 2.41A {Homo sapiens} PDB: 4drb_A | Back alignment and structure |
|---|
| >1taf_A TFIID TBP associated factor 42; transcription initiation, histone fold, complex (TWO transcr factors); 2.00A {Drosophila melanogaster} SCOP: a.22.1.3 | Back alignment and structure |
|---|
| >4dra_E Centromere protein X; DNA binding complex, DNA damage repair, histone-fold, DNA BI protein; 2.41A {Homo sapiens} PDB: 4drb_J | Back alignment and structure |
|---|
| >3r45_A Histone H3-like centromeric protein A; histone fold, centromere, CENP-A, histone chaperone, hjurp; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3nqu_A Histone H3-like centromeric protein A; alpha helix, histone fold, centromere, DNA binding protein; 2.50A {Homo sapiens} PDB: 3an2_A | Back alignment and structure |
|---|
| >3vh5_A CENP-S; histone fold, chromosome segregation, DNA binding, nucleus, binding protein; 2.40A {Gallus gallus} PDB: 3vh6_A | Back alignment and structure |
|---|
| >3b0b_C CENP-X, centromere protein X; histone fold, DNA binding, DNA, nucleus, DNA binding protein; 2.15A {Gallus gallus} PDB: 3vh5_D 3vh6_D | Back alignment and structure |
|---|
| >2ly8_A Budding yeast chaperone SCM3; centromere protein, CENH3 variants, partially unfolded; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2l5a_A Histone H3-like centromeric protein CSE4, protein histone H4; A single chain of CSE4+SCM3+H4, fusion protein; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2l5a_A Histone H3-like centromeric protein CSE4, protein histone H4; A single chain of CSE4+SCM3+H4, fusion protein; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1bh9_B TAFII28; histone fold, tata binding protein, transcription regulation complex; HET: PMB; 2.60A {Homo sapiens} SCOP: a.22.1.3 PDB: 1bh8_B* | Back alignment and structure |
|---|
| >3ksy_A SOS-1, SON of sevenless homolog 1; RAS, RAS activator, disease mutation, guanine-nucleotide releasing factor, signaling protein; 3.18A {Homo sapiens} PDB: 1xd4_A 1xdv_A 1q9c_A | Back alignment and structure |
|---|
| >2nqb_D Histone H2B; nucleosome, NCP, chromatin, structural protein/DNA complex; 2.30A {Drosophila melanogaster} PDB: 2pyo_D* | Back alignment and structure |
|---|
| >1tzy_B Histone H2B; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1eqz_B 1hq3_B 2aro_B 2hio_B 3c9k_B 3azg_D 3a6n_D 3an2_D 3av1_D 3av2_D 3ayw_D 3aze_D 3azf_D 3afa_D 3azh_D 3azi_D 3azj_D 3azk_D 3azl_D 3azm_D ... | Back alignment and structure |
|---|
| >1h3o_B Transcription initiation factor TFIID 20/15 kDa subunits; transcription/TBP-associated factors, TBP-associated factors; 2.3A {Homo sapiens} SCOP: a.22.1.3 | Back alignment and structure |
|---|
| >2jss_A Chimera of histone H2B.1 and histone H2A.Z; histone/chaperone complex, intrinsically unfolded protein, chaperone/structural protein complex; NMR {Saccharomyces cerevisiae} SCOP: a.22.1.1 a.22.1.1 | Back alignment and structure |
|---|
| >2ly8_A Budding yeast chaperone SCM3; centromere protein, CENH3 variants, partially unfolded; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3v9r_B MHF2, uncharacterized protein YDL160C-A; histone fold, fanconi anemia, DNA repair, DNA BI protein; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 203 | ||||
| d1n1jb_ | 78 | a.22.1.3 (B:) Nuclear transcription factor Y subun | 1e-14 | |
| d2byka1 | 72 | a.22.1.3 (A:29-100) Chrac-16 {Fruit fly (Drosophil | 2e-11 | |
| d1jfia_ | 66 | a.22.1.3 (A:) Negative cofactor 2, NC2, alpha chai | 1e-09 | |
| d1n1ja_ | 87 | a.22.1.3 (A:) Nuclear transcription factor Y subun | 2e-08 | |
| d1ku5a_ | 66 | a.22.1.2 (A:) Archaeal histone {Archaeon (Pyrococc | 3e-08 | |
| d2bykb1 | 89 | a.22.1.3 (B:11-99) Chrac-14 {Fruit fly (Drosophila | 3e-07 | |
| d1jfib_ | 135 | a.22.1.3 (B:) Negative cofactor 2, NC2, beta chain | 1e-06 | |
| d1f1ea_ | 151 | a.22.1.2 (A:) Archaeal histone {Archaeon Methanopy | 4e-05 |
| >d1n1jb_ a.22.1.3 (B:) Nuclear transcription factor Y subunit gamma (Nf-Yc2) {Human (Homo sapiens) [TaxId: 9606]} Length = 78 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Histone-fold superfamily: Histone-fold family: TBP-associated factors, TAFs domain: Nuclear transcription factor Y subunit gamma (Nf-Yc2) species: Human (Homo sapiens) [TaxId: 9606]
Score = 64.1 bits (156), Expect = 1e-14
Identities = 21/76 (27%), Positives = 38/76 (50%), Gaps = 2/76 (2%)
Query: 110 PMGRIKRIFKTQSSDIGITGEAVFLVNKATDKFLEQFCEDAYECCAKDRKKSLAYKHL-- 167
P+ RIK+I K I+ EA L KA F+ + A+ +++++L +
Sbjct: 2 PLARIKKIMKLDEDVKMISAEAPVLFAKAAQIFITELTLRAWIHTEDNKRRTLQRNDIAM 61
Query: 168 VVSEQSKYDFLSDYVP 183
+++ ++DFL D VP
Sbjct: 62 AITKFDQFDFLIDIVP 77
|
| >d2byka1 a.22.1.3 (A:29-100) Chrac-16 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 72 | Back information, alignment and structure |
|---|
| >d1jfia_ a.22.1.3 (A:) Negative cofactor 2, NC2, alpha chain {Human (Homo sapiens) [TaxId: 9606]} Length = 66 | Back information, alignment and structure |
|---|
| >d1n1ja_ a.22.1.3 (A:) Nuclear transcription factor Y subunit beta (Nf-Yb3) {Human (Homo sapiens) [TaxId: 9606]} Length = 87 | Back information, alignment and structure |
|---|
| >d1ku5a_ a.22.1.2 (A:) Archaeal histone {Archaeon (Pyrococcus horikoshii) [TaxId: 53953]} Length = 66 | Back information, alignment and structure |
|---|
| >d2bykb1 a.22.1.3 (B:11-99) Chrac-14 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 89 | Back information, alignment and structure |
|---|
| >d1jfib_ a.22.1.3 (B:) Negative cofactor 2, NC2, beta chain {Human (Homo sapiens) [TaxId: 9606]} Length = 135 | Back information, alignment and structure |
|---|
| >d1f1ea_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanopyrus kandleri [TaxId: 2320]} Length = 151 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 203 | |||
| d1n1jb_ | 78 | Nuclear transcription factor Y subunit gamma (Nf-Y | 99.94 | |
| d2byka1 | 72 | Chrac-16 {Fruit fly (Drosophila melanogaster) [Tax | 99.89 | |
| d1jfia_ | 66 | Negative cofactor 2, NC2, alpha chain {Human (Homo | 99.84 | |
| d1n1ja_ | 87 | Nuclear transcription factor Y subunit beta (Nf-Yb | 99.82 | |
| d1jfib_ | 135 | Negative cofactor 2, NC2, beta chain {Human (Homo | 99.81 | |
| d2bykb1 | 89 | Chrac-14 {Fruit fly (Drosophila melanogaster) [Tax | 99.76 | |
| d1ku5a_ | 66 | Archaeal histone {Archaeon (Pyrococcus horikoshii) | 99.65 | |
| d1htaa_ | 68 | Archaeal histone {Archaeon Methanothermus fervidus | 99.51 | |
| d1f1ea_ | 151 | Archaeal histone {Archaeon Methanopyrus kandleri [ | 99.29 | |
| d1f1ea_ | 151 | Archaeal histone {Archaeon Methanopyrus kandleri [ | 98.3 | |
| d1q9ca_ | 172 | Histone domain of Son of sevenless protein {Human | 98.21 | |
| d1u35c1 | 106 | macro-H2A.1, histone domain {Human (Homo sapiens) | 98.12 | |
| d1f66c_ | 103 | Histone H2A {Human (Homo sapiens), variant H2A.Z [ | 98.06 | |
| d1tzya_ | 106 | Histone H2A {Chicken (Gallus gallus), erythrocytes | 97.99 | |
| d2huec1 | 82 | Histone H4 {African clawed frog (Xenopus laevis) [ | 97.83 | |
| d1tzyc_ | 95 | Histone H3 {Chicken (Gallus gallus), erythrocytes | 96.76 | |
| d1bh9b_ | 89 | TAF(II)28 {Human (Homo sapiens) [TaxId: 9606]} | 93.71 | |
| d1tafb_ | 70 | TAF(II)62 {Fruit fly (Drosophila melanogaster) [Ta | 91.57 | |
| d1tzyb_ | 92 | Histone H2B {Chicken (Gallus gallus), erythrocytes | 89.71 | |
| d1h3ob_ | 74 | TAF(II)-20, (TAF(II)-15, hTAF12), histone fold dom | 89.0 |
| >d1n1jb_ a.22.1.3 (B:) Nuclear transcription factor Y subunit gamma (Nf-Yc2) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Histone-fold superfamily: Histone-fold family: TBP-associated factors, TAFs domain: Nuclear transcription factor Y subunit gamma (Nf-Yc2) species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.94 E-value=5.9e-28 Score=173.76 Aligned_cols=76 Identities=28% Similarity=0.514 Sum_probs=75.0
Q ss_pred CChHHHHHHHhcCCCccchhhHHHHHHHHHHHHHHHHHHHHHHHHHHhcCCCccccCce--EEeeCCcccccccccCC
Q 028837 109 FPMGRIKRIFKTQSSDIGITGEAVFLVNKATDKFLEQFCEDAYECCAKDRKKSLAYKHL--VVSEQSKYDFLSDYVPE 184 (203)
Q Consensus 109 LPlARVKrIMK~DpDv~~IS~EA~~lIaKAtELFIq~La~~A~~~A~~~kRKTL~y~DL--aV~~~~~fdFL~DIVP~ 184 (203)
||++||+||||+||+++.||+||+++|++|||+||++|+..|+.+|.+++|+||+|+|| ||.+.+.|+||.|+||+
T Consensus 1 LP~srVkrImK~~~~~~~is~ea~~~i~~a~E~Fi~~l~~~A~~~a~~~~rkti~~~dl~~av~~~~~~~FL~d~vPk 78 (78)
T d1n1jb_ 1 LPLARIKKIMKLDEDVKMISAEAPVLFAKAAQIFITELTLRAWIHTEDNKRRTLQRNDIAMAITKFDQFDFLIDIVPR 78 (78)
T ss_dssp CCHHHHHHHHTTSTTCCCBCTHHHHHHHHHHHHHHHHHHHHHHHHHHHTTCSEECHHHHHHHHTTCGGGGGGTTTSCC
T ss_pred CCHHHHHHHHhcCCcccccchHHHHHHHHHHHHHHHHHHHHHHHHHHHcCCCcCCHHHHHHHHhcCChhHHHHHhCCC
Confidence 89999999999999999999999999999999999999999999999999999999999 99999999999999995
|
| >d2byka1 a.22.1.3 (A:29-100) Chrac-16 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1jfia_ a.22.1.3 (A:) Negative cofactor 2, NC2, alpha chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1n1ja_ a.22.1.3 (A:) Nuclear transcription factor Y subunit beta (Nf-Yb3) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jfib_ a.22.1.3 (B:) Negative cofactor 2, NC2, beta chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bykb1 a.22.1.3 (B:11-99) Chrac-14 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1ku5a_ a.22.1.2 (A:) Archaeal histone {Archaeon (Pyrococcus horikoshii) [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1htaa_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanothermus fervidus, histone A [TaxId: 2180]} | Back information, alignment and structure |
|---|
| >d1f1ea_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanopyrus kandleri [TaxId: 2320]} | Back information, alignment and structure |
|---|
| >d1f1ea_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanopyrus kandleri [TaxId: 2320]} | Back information, alignment and structure |
|---|
| >d1q9ca_ a.22.1.3 (A:) Histone domain of Son of sevenless protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u35c1 a.22.1.1 (C:814-919) macro-H2A.1, histone domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f66c_ a.22.1.1 (C:) Histone H2A {Human (Homo sapiens), variant H2A.Z [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tzya_ a.22.1.1 (A:) Histone H2A {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d2huec1 a.22.1.1 (C:20-101) Histone H4 {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1tzyc_ a.22.1.1 (C:) Histone H3 {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1bh9b_ a.22.1.3 (B:) TAF(II)28 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tafb_ a.22.1.3 (B:) TAF(II)62 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1tzyb_ a.22.1.1 (B:) Histone H2B {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1h3ob_ a.22.1.3 (B:) TAF(II)-20, (TAF(II)-15, hTAF12), histone fold domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|