Citrus Sinensis ID: 028875
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 202 | ||||||
| 255579281 | 183 | ARF GTPase activator, putative [Ricinus | 0.905 | 1.0 | 0.758 | 1e-77 | |
| 225456169 | 181 | PREDICTED: probable ADP-ribosylation fac | 0.831 | 0.928 | 0.797 | 1e-76 | |
| 147805778 | 165 | hypothetical protein VITISV_014376 [Viti | 0.816 | 1.0 | 0.793 | 4e-75 | |
| 357521665 | 182 | Pollen-specific C2 domain containing pro | 0.861 | 0.956 | 0.781 | 4e-74 | |
| 356512968 | 173 | PREDICTED: probable ADP-ribosylation fac | 0.826 | 0.965 | 0.796 | 8e-74 | |
| 187942405 | 188 | pollen-specific C2 domain containing pro | 0.920 | 0.989 | 0.723 | 9e-74 | |
| 30684739 | 177 | calcium-dependent lipid-binding domain-c | 0.876 | 1.0 | 0.768 | 1e-73 | |
| 187942403 | 187 | pollen-specific C2 domain containing pro | 0.920 | 0.994 | 0.721 | 1e-73 | |
| 356531150 | 176 | PREDICTED: ADP-ribosylation factor GTPas | 0.826 | 0.948 | 0.772 | 3e-73 | |
| 449439459 | 190 | PREDICTED: probable ADP-ribosylation fac | 0.821 | 0.873 | 0.789 | 4e-73 |
| >gi|255579281|ref|XP_002530486.1| ARF GTPase activator, putative [Ricinus communis] gi|223529983|gb|EEF31909.1| ARF GTPase activator, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 294 bits (752), Expect = 1e-77, Method: Compositional matrix adjust.
Identities = 141/186 (75%), Positives = 158/186 (84%), Gaps = 3/186 (1%)
Query: 17 MVDSPKQTAMGTGDGVRRTSLMETLLGLLRIRIKRGVNLAVRDVRSSDPYVVVKMGKQKL 76
M +SP G +SLME LLGLLRIR+KRGVNLAVRDVRSSDPY+VVKMGKQKL
Sbjct: 1 MAESPGSPESGKKTS---SSLMENLLGLLRIRVKRGVNLAVRDVRSSDPYIVVKMGKQKL 57
Query: 77 KTRVIKKDVNPEWNEDLTLSITDPNVPITLTVYDHDLFSKDDRMGDAEFDIKTYIEALKM 136
KTRVIKKDVNPEWNEDLTLS+ DP +P+ LTVYDHD FSKDD+MGDAEFDI+ YIEAL+M
Sbjct: 58 KTRVIKKDVNPEWNEDLTLSVIDPTLPVKLTVYDHDTFSKDDKMGDAEFDIRPYIEALRM 117
Query: 137 NLDSLPTGTIISRVMPSRHNCLSEQSCVVWKEGKVVQDLVLRLRNVECGELEIQLQWIDL 196
NL PTGTII R+ PSR NCLSE++C+ + +GKVVQDL LRLRNVECGE+EIQLQWIDL
Sbjct: 118 NLAGFPTGTIIKRIQPSRQNCLSEETCITYTDGKVVQDLCLRLRNVECGEVEIQLQWIDL 177
Query: 197 PGSKGL 202
PGSKGL
Sbjct: 178 PGSKGL 183
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|225456169|ref|XP_002282569.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating protein AGD11-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|147805778|emb|CAN69475.1| hypothetical protein VITISV_014376 [Vitis vinifera] gi|297734335|emb|CBI15582.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|357521665|ref|XP_003631121.1| Pollen-specific C2 domain containing protein [Medicago truncatula] gi|355525143|gb|AET05597.1| Pollen-specific C2 domain containing protein [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|356512968|ref|XP_003525186.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating protein AGD11-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|187942405|gb|ACD40011.1| pollen-specific C2 domain containing protein [Nicotiana sp. variant 'Rastroensis'] | Back alignment and taxonomy information |
|---|
| >gi|30684739|ref|NP_188425.2| calcium-dependent lipid-binding domain-containing protein [Arabidopsis thaliana] gi|297830434|ref|XP_002883099.1| C2 domain-containing protein [Arabidopsis lyrata subsp. lyrata] gi|9294500|dbj|BAB02719.1| GTPase activating protein-like [Arabidopsis thaliana] gi|62867625|gb|AAY17416.1| At3g17980 [Arabidopsis thaliana] gi|149944327|gb|ABR46206.1| At3g17980 [Arabidopsis thaliana] gi|297328939|gb|EFH59358.1| C2 domain-containing protein [Arabidopsis lyrata subsp. lyrata] gi|332642510|gb|AEE76031.1| calcium-dependent lipid-binding domain-containing protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|187942403|gb|ACD40010.1| pollen-specific C2 domain containing protein [Nicotiana alata] gi|187942407|gb|ACD40012.1| pollen-specific C2 domain containing protein [Nicotiana forgetiana] gi|187942409|gb|ACD40013.1| pollen-specific C2 domain containing protein [Nicotiana langsdorffii] gi|187942411|gb|ACD40014.1| pollen-specific C2 domain containing protein [Nicotiana mutabilis] gi|187942415|gb|ACD40016.1| pollen-specific C2 domain containing protein [Nicotiana longiflora] | Back alignment and taxonomy information |
|---|
| >gi|356531150|ref|XP_003534141.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein AGD12-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449439459|ref|XP_004137503.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating protein AGD11-like [Cucumis sativus] gi|449503111|ref|XP_004161839.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating protein AGD11-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 202 | ||||||
| TAIR|locus:2088505 | 177 | C2 "AT3G17980" [Arabidopsis th | 0.876 | 1.0 | 0.700 | 2e-63 | |
| TAIR|locus:2035042 | 168 | AT1G73580 "AT1G73580" [Arabido | 0.826 | 0.994 | 0.634 | 2.3e-55 | |
| TAIR|locus:2049602 | 180 | AT2G01540 "AT2G01540" [Arabido | 0.742 | 0.833 | 0.592 | 2.9e-48 | |
| TAIR|locus:2201497 | 174 | AT1G66360 "AT1G66360" [Arabido | 0.727 | 0.844 | 0.590 | 1.6e-47 | |
| TAIR|locus:2014020 | 165 | AT1G70810 "AT1G70810" [Arabido | 0.742 | 0.909 | 0.593 | 1.6e-47 | |
| TAIR|locus:2013905 | 185 | AT1G70790 "AT1G70790" [Arabido | 0.742 | 0.810 | 0.572 | 1e-45 | |
| TAIR|locus:2014015 | 174 | EHB1 "AT1G70800" [Arabidopsis | 0.742 | 0.862 | 0.54 | 2.2e-43 | |
| TAIR|locus:2201190 | 165 | AT1G23140 "AT1G23140" [Arabido | 0.727 | 0.890 | 0.530 | 5.3e-40 | |
| TAIR|locus:2077367 | 385 | AT3G07940 [Arabidopsis thalian | 0.707 | 0.371 | 0.479 | 4.9e-30 | |
| TAIR|locus:2115904 | 336 | AGD13 "ARF-GAP domain 13" [Ara | 0.707 | 0.425 | 0.437 | 2.4e-28 |
| TAIR|locus:2088505 C2 "AT3G17980" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 647 (232.8 bits), Expect = 2.0e-63, P = 2.0e-63
Identities = 124/177 (70%), Positives = 143/177 (80%)
Query: 26 MGTGDGVRRTSLMETXXXXXXXXXXXXVNLAVRDVRSSDPYVVVKMGKQKLKTRVIKKDV 85
M T R +SLM+ VNLAVRD+ SSDPYVVVKMGKQKLKTRVI KDV
Sbjct: 1 MTTACPARTSSLMDDLLGLLRIRIKRGVNLAVRDISSSDPYVVVKMGKQKLKTRVINKDV 60
Query: 86 NPEWNEDLTLSITDPNVPITLTVYDHDLFSKDDRMGDAEFDIKTYIEALKMNLDSLPTGT 145
NPEWNEDLTLS+TD N+ + LTVYDHD+FSKDD+MGDAEF+IK YIEAL+M LD LP+GT
Sbjct: 61 NPEWNEDLTLSVTDSNLTVLLTVYDHDMFSKDDKMGDAEFEIKPYIEALRMQLDGLPSGT 120
Query: 146 IISRVMPSRHNCLSEQSCVVWKEGKVVQDLVLRLRNVECGELEIQLQWIDLPGSKGL 202
I++ V PSR NCL+E+S V W +GK+VQDLVLRLR+VECGE+E QLQWIDLPGSKGL
Sbjct: 121 IVTTVKPSRRNCLAEESRVTWVDGKLVQDLVLRLRHVECGEVEAQLQWIDLPGSKGL 177
|
|
| TAIR|locus:2035042 AT1G73580 "AT1G73580" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2049602 AT2G01540 "AT2G01540" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2201497 AT1G66360 "AT1G66360" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2014020 AT1G70810 "AT1G70810" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2013905 AT1G70790 "AT1G70790" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2014015 EHB1 "AT1G70800" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2201190 AT1G23140 "AT1G23140" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2077367 AT3G07940 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2115904 AGD13 "ARF-GAP domain 13" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00017844001 | SubName- Full=Putative uncharacterized protein (Chromosome chr17 scaffold_16, whole genome shotgun sequence); (165 aa) | |||||||
(Vitis vinifera) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 202 | |||
| cd04038 | 145 | cd04038, C2_ArfGAP, C2 domain present in Arf GTPas | 1e-69 | |
| cd04042 | 121 | cd04042, C2A_MCTP_PRT, C2 domain first repeat foun | 3e-25 | |
| pfam00168 | 85 | pfam00168, C2, C2 domain | 4e-24 | |
| cd00030 | 102 | cd00030, C2, C2 domain | 5e-24 | |
| smart00239 | 101 | smart00239, C2, Protein kinase C conserved region | 2e-21 | |
| cd04024 | 128 | cd04024, C2A_Synaptotagmin-like, C2 domain first r | 1e-18 | |
| cd04041 | 111 | cd04041, C2A_fungal, C2 domain first repeat; funga | 3e-18 | |
| cd08391 | 121 | cd08391, C2A_C2C_Synaptotagmin_like, C2 domain fir | 3e-15 | |
| cd04036 | 119 | cd04036, C2_cPLA2, C2 domain present in cytosolic | 4e-13 | |
| COG5038 | 1227 | COG5038, COG5038, Ca2+-dependent lipid-binding pro | 2e-12 | |
| cd04026 | 131 | cd04026, C2_PKC_alpha_gamma, C2 domain in Protein | 2e-12 | |
| cd08377 | 119 | cd08377, C2C_MCTP_PRT, C2 domain third repeat foun | 3e-12 | |
| cd04033 | 133 | cd04033, C2_NEDD4_NEDD4L, C2 domain present in the | 3e-12 | |
| cd08688 | 110 | cd08688, C2_KIAA0528-like, C2 domain found in the | 5e-12 | |
| cd00276 | 134 | cd00276, C2B_Synaptotagmin, C2 domain second repea | 7e-12 | |
| cd04037 | 124 | cd04037, C2E_Ferlin, C2 domain fifth repeat in Fer | 9e-12 | |
| COG5038 | 1227 | COG5038, COG5038, Ca2+-dependent lipid-binding pro | 1e-11 | |
| cd04045 | 120 | cd04045, C2C_Tricalbin-like, C2 domain third repea | 1e-11 | |
| cd04039 | 108 | cd04039, C2_PSD, C2 domain present in Phosphatidyl | 1e-11 | |
| cd04025 | 123 | cd04025, C2B_RasA1_RasA4, C2 domain second repeat | 2e-11 | |
| cd04044 | 124 | cd04044, C2A_Tricalbin-like, C2 domain first repea | 3e-11 | |
| cd08379 | 126 | cd08379, C2D_MCTP_PRT_plant, C2 domain fourth repe | 4e-11 | |
| cd04040 | 115 | cd04040, C2D_Tricalbin-like, C2 domain fourth repe | 6e-11 | |
| cd08384 | 133 | cd08384, C2B_Rabphilin_Doc2, C2 domain second repe | 2e-10 | |
| cd08375 | 136 | cd08375, C2_Intersectin, C2 domain present in Inte | 2e-10 | |
| cd04009 | 133 | cd04009, C2B_Munc13-like, C2 domain second repeat | 3e-10 | |
| cd04043 | 126 | cd04043, C2_Munc13_fungal, C2 domain in Munc13 (ma | 4e-10 | |
| cd08376 | 116 | cd08376, C2B_MCTP_PRT, C2 domain second repeat fou | 4e-10 | |
| cd08385 | 124 | cd08385, C2A_Synaptotagmin-1-5-6-9-10, C2A domain | 5e-10 | |
| cd08386 | 125 | cd08386, C2A_Synaptotagmin-7, C2A domain first rep | 6e-10 | |
| cd04046 | 126 | cd04046, C2_Calpain, C2 domain present in Calpain | 1e-09 | |
| cd04049 | 124 | cd04049, C2_putative_Elicitor-responsive_gene, C2 | 2e-09 | |
| cd04018 | 151 | cd04018, C2C_Ferlin, C2 domain third repeat in Fer | 4e-09 | |
| cd04022 | 127 | cd04022, C2A_MCTP_PRT_plant, C2 domain first repea | 4e-09 | |
| cd04054 | 121 | cd04054, C2A_Rasal1_RasA4, C2 domain first repeat | 5e-09 | |
| cd04011 | 111 | cd04011, C2B_Ferlin, C2 domain second repeat in Fe | 7e-09 | |
| cd04020 | 162 | cd04020, C2B_SLP_1-2-3-4, C2 domain second repeat | 1e-08 | |
| cd08521 | 123 | cd08521, C2A_SLP, C2 domain first repeat present i | 1e-08 | |
| cd08681 | 118 | cd08681, C2_fungal_Inn1p-like, C2 domain found in | 1e-08 | |
| cd08675 | 137 | cd08675, C2B_RasGAP, C2 domain second repeat of Ra | 2e-08 | |
| cd08382 | 123 | cd08382, C2_Smurf-like, C2 domain present in Smad | 2e-08 | |
| cd04027 | 127 | cd04027, C2B_Munc13, C2 domain second repeat in Mu | 3e-08 | |
| cd08387 | 124 | cd08387, C2A_Synaptotagmin-8, C2A domain first rep | 5e-08 | |
| cd08393 | 125 | cd08393, C2A_SLP-1_2, C2 domain first repeat prese | 5e-07 | |
| cd04021 | 125 | cd04021, C2_E3_ubiquitin_ligase, C2 domain present | 6e-07 | |
| cd00275 | 128 | cd00275, C2_PLC_like, C2 domain present in Phospho | 1e-06 | |
| cd08402 | 136 | cd08402, C2B_Synaptotagmin-1, C2 domain second rep | 1e-06 | |
| cd04051 | 125 | cd04051, C2_SRC2_like, C2 domain present in Soybea | 2e-06 | |
| cd04032 | 127 | cd04032, C2_Perforin, C2 domain of Perforin | 3e-06 | |
| cd04015 | 158 | cd04015, C2_plant_PLD, C2 domain present in plant | 3e-06 | |
| cd04050 | 105 | cd04050, C2B_Synaptotagmin-like, C2 domain second | 3e-06 | |
| cd04035 | 123 | cd04035, C2A_Rabphilin_Doc2, C2 domain first repea | 5e-06 | |
| cd08388 | 128 | cd08388, C2A_Synaptotagmin-4-11, C2A domain first | 6e-06 | |
| cd08378 | 121 | cd08378, C2B_MCTP_PRT_plant, C2 domain second repe | 8e-06 | |
| cd04047 | 110 | cd04047, C2B_Copine, C2 domain second repeat in Co | 2e-05 | |
| cd08682 | 126 | cd08682, C2_Rab11-FIP_classI, C2 domain found in R | 2e-05 | |
| cd04031 | 125 | cd04031, C2A_RIM1alpha, C2 domain first repeat con | 2e-05 | |
| cd08405 | 136 | cd08405, C2B_Synaptotagmin-7, C2 domain second rep | 3e-05 | |
| PLN03008 | 868 | PLN03008, PLN03008, Phospholipase D delta | 3e-05 | |
| cd08390 | 123 | cd08390, C2A_Synaptotagmin-15-17, C2A domain first | 1e-04 | |
| cd04017 | 135 | cd04017, C2D_Ferlin, C2 domain fourth repeat in Fe | 1e-04 | |
| cd04019 | 150 | cd04019, C2C_MCTP_PRT_plant, C2 domain third repea | 2e-04 | |
| cd04048 | 120 | cd04048, C2A_Copine, C2 domain first repeat in Cop | 2e-04 | |
| cd04029 | 125 | cd04029, C2A_SLP-4_5, C2 domain first repeat prese | 2e-04 | |
| cd08380 | 156 | cd08380, C2_PI3K_like, C2 domain present in phosph | 2e-04 | |
| cd08410 | 135 | cd08410, C2B_Synaptotagmin-17, C2 domain second re | 2e-04 | |
| cd08403 | 134 | cd08403, C2B_Synaptotagmin-3-5-6-9-10, C2 domain s | 3e-04 | |
| COG5038 | 1227 | COG5038, COG5038, Ca2+-dependent lipid-binding pro | 4e-04 | |
| cd08404 | 136 | cd08404, C2B_Synaptotagmin-4, C2 domain second rep | 4e-04 | |
| cd08678 | 126 | cd08678, C2_C21orf25-like, C2 domain found in the | 4e-04 | |
| cd08373 | 127 | cd08373, C2A_Ferlin, C2 domain first repeat in Fer | 5e-04 | |
| cd08392 | 128 | cd08392, C2A_SLP-3, C2 domain first repeat present | 7e-04 | |
| cd04014 | 132 | cd04014, C2_PKC_epsilon, C2 domain in Protein Kina | 7e-04 | |
| cd08381 | 122 | cd08381, C2B_PI3K_class_II, C2 domain second repea | 9e-04 | |
| cd08401 | 121 | cd08401, C2A_RasA2_RasA3, C2 domain first repeat p | 0.002 |
| >gnl|CDD|176003 cd04038, C2_ArfGAP, C2 domain present in Arf GTPase Activating Proteins (GAP) | Back alignment and domain information |
|---|
Score = 208 bits (531), Expect = 1e-69
Identities = 86/145 (59%), Positives = 113/145 (77%), Gaps = 1/145 (0%)
Query: 42 LGLLRIRIKRGVNLAVRDVRSSDPYVVVKMGKQKLKTRVIKKDVNPEWNEDLTLSITDPN 101
LGLL++R+ RG NLAVRD SSDPYVV+ +G QK+KTRVIKK++NP WNE+LTLS+ +P
Sbjct: 1 LGLLKVRVVRGTNLAVRDFTSSDPYVVLTLGNQKVKTRVIKKNLNPVWNEELTLSVPNPM 60
Query: 102 VPITLTVYDHDLFSKDDRMGDAEFDIKTYIEALKM-NLDSLPTGTIISRVMPSRHNCLSE 160
P+ L V+D D FSKDD MG+AE D++ +EA K+ +L P GT I +V+PS NCL+
Sbjct: 61 APLKLEVFDKDTFSKDDSMGEAEIDLEPLVEAAKLDHLRDTPGGTQIKKVLPSVENCLAS 120
Query: 161 QSCVVWKEGKVVQDLVLRLRNVECG 185
+S + WK+GK+VQDLVL+LRNVE G
Sbjct: 121 ESHITWKDGKIVQDLVLKLRNVESG 145
|
ArfGAP is a GTPase activating protein which regulates the ADP ribosylation factor Arf, a member of the Ras superfamily of GTP-binding proteins. The GTP-bound form of Arf is involved in Golgi morphology and is involved in recruiting coat proteins. ArfGAP is responsible for the GDP-bound form of Arf which is necessary for uncoating the membrane and allowing the Golgi to fuse with an acceptor compartment. These proteins contain an N-terminal ArfGAP domain containing the characteristic zinc finger motif (Cys-x2-Cys-x(16,17)-x2-Cys) and C-terminal C2 domain. C2 domains were first identified in Protein Kinase C (PKC). C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins. Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such as protein kinase C, or membrane trafficking proteins which contain at least two C2 domains, such as synaptotagmin 1. However, there are a few exceptions to this including RIM isoforms and some splice variants of piccolo/aczonin and intersectin which only have a single C2 domain. C2 domains with a calcium binding region have negatively charged residues, primarily aspartates, that serve as ligands for calcium ions. Length = 145 |
| >gnl|CDD|176007 cd04042, C2A_MCTP_PRT, C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) | Back alignment and domain information |
|---|
| >gnl|CDD|215765 pfam00168, C2, C2 domain | Back alignment and domain information |
|---|
| >gnl|CDD|175973 cd00030, C2, C2 domain | Back alignment and domain information |
|---|
| >gnl|CDD|214577 smart00239, C2, Protein kinase C conserved region 2 (CalB) | Back alignment and domain information |
|---|
| >gnl|CDD|175990 cd04024, C2A_Synaptotagmin-like, C2 domain first repeat present in Synaptotagmin-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|176006 cd04041, C2A_fungal, C2 domain first repeat; fungal group | Back alignment and domain information |
|---|
| >gnl|CDD|176037 cd08391, C2A_C2C_Synaptotagmin_like, C2 domain first and third repeat in Synaptotagmin-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|176001 cd04036, C2_cPLA2, C2 domain present in cytosolic PhosphoLipase A2 (cPLA2) | Back alignment and domain information |
|---|
| >gnl|CDD|227371 COG5038, COG5038, Ca2+-dependent lipid-binding protein, contains C2 domain [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|175992 cd04026, C2_PKC_alpha_gamma, C2 domain in Protein Kinase C (PKC) alpha and gamma | Back alignment and domain information |
|---|
| >gnl|CDD|176023 cd08377, C2C_MCTP_PRT, C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) | Back alignment and domain information |
|---|
| >gnl|CDD|175999 cd04033, C2_NEDD4_NEDD4L, C2 domain present in the Human neural precursor cell-expressed, developmentally down-regulated 4 (NEDD4) and NEDD4-like (NEDD4L/NEDD42) | Back alignment and domain information |
|---|
| >gnl|CDD|176070 cd08688, C2_KIAA0528-like, C2 domain found in the Human KIAA0528 cDNA clone | Back alignment and domain information |
|---|
| >gnl|CDD|175975 cd00276, C2B_Synaptotagmin, C2 domain second repeat present in Synaptotagmin | Back alignment and domain information |
|---|
| >gnl|CDD|176002 cd04037, C2E_Ferlin, C2 domain fifth repeat in Ferlin | Back alignment and domain information |
|---|
| >gnl|CDD|227371 COG5038, COG5038, Ca2+-dependent lipid-binding protein, contains C2 domain [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|176010 cd04045, C2C_Tricalbin-like, C2 domain third repeat present in Tricalbin-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|176004 cd04039, C2_PSD, C2 domain present in Phosphatidylserine decarboxylase (PSD) | Back alignment and domain information |
|---|
| >gnl|CDD|175991 cd04025, C2B_RasA1_RasA4, C2 domain second repeat present in RasA1 and RasA4 | Back alignment and domain information |
|---|
| >gnl|CDD|176009 cd04044, C2A_Tricalbin-like, C2 domain first repeat present in Tricalbin-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|176025 cd08379, C2D_MCTP_PRT_plant, C2 domain fourth repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset | Back alignment and domain information |
|---|
| >gnl|CDD|176005 cd04040, C2D_Tricalbin-like, C2 domain fourth repeat present in Tricalbin-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|176030 cd08384, C2B_Rabphilin_Doc2, C2 domain second repeat present in Rabphilin and Double C2 domain | Back alignment and domain information |
|---|
| >gnl|CDD|176021 cd08375, C2_Intersectin, C2 domain present in Intersectin | Back alignment and domain information |
|---|
| >gnl|CDD|175976 cd04009, C2B_Munc13-like, C2 domain second repeat in Munc13 (mammalian uncoordinated)-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|176008 cd04043, C2_Munc13_fungal, C2 domain in Munc13 (mammalian uncoordinated) proteins; fungal group | Back alignment and domain information |
|---|
| >gnl|CDD|176022 cd08376, C2B_MCTP_PRT, C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) | Back alignment and domain information |
|---|
| >gnl|CDD|176031 cd08385, C2A_Synaptotagmin-1-5-6-9-10, C2A domain first repeat present in Synaptotagmins 1, 5, 6, 9, and 10 | Back alignment and domain information |
|---|
| >gnl|CDD|176032 cd08386, C2A_Synaptotagmin-7, C2A domain first repeat present in Synaptotagmin 7 | Back alignment and domain information |
|---|
| >gnl|CDD|176011 cd04046, C2_Calpain, C2 domain present in Calpain proteins | Back alignment and domain information |
|---|
| >gnl|CDD|176014 cd04049, C2_putative_Elicitor-responsive_gene, C2 domain present in the putative elicitor-responsive gene | Back alignment and domain information |
|---|
| >gnl|CDD|175985 cd04018, C2C_Ferlin, C2 domain third repeat in Ferlin | Back alignment and domain information |
|---|
| >gnl|CDD|175989 cd04022, C2A_MCTP_PRT_plant, C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset | Back alignment and domain information |
|---|
| >gnl|CDD|176018 cd04054, C2A_Rasal1_RasA4, C2 domain first repeat present in RasA1 and RasA4 | Back alignment and domain information |
|---|
| >gnl|CDD|175978 cd04011, C2B_Ferlin, C2 domain second repeat in Ferlin | Back alignment and domain information |
|---|
| >gnl|CDD|175987 cd04020, C2B_SLP_1-2-3-4, C2 domain second repeat present in Synaptotagmin-like proteins 1-4 | Back alignment and domain information |
|---|
| >gnl|CDD|176056 cd08521, C2A_SLP, C2 domain first repeat present in Synaptotagmin-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|176063 cd08681, C2_fungal_Inn1p-like, C2 domain found in fungal Ingression 1 (Inn1) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|176057 cd08675, C2B_RasGAP, C2 domain second repeat of Ras GTPase activating proteins (GAPs) | Back alignment and domain information |
|---|
| >gnl|CDD|176028 cd08382, C2_Smurf-like, C2 domain present in Smad ubiquitination-related factor (Smurf)-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|175993 cd04027, C2B_Munc13, C2 domain second repeat in Munc13 (mammalian uncoordinated) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|176033 cd08387, C2A_Synaptotagmin-8, C2A domain first repeat present in Synaptotagmin 8 | Back alignment and domain information |
|---|
| >gnl|CDD|176039 cd08393, C2A_SLP-1_2, C2 domain first repeat present in Synaptotagmin-like proteins 1 and 2 | Back alignment and domain information |
|---|
| >gnl|CDD|175988 cd04021, C2_E3_ubiquitin_ligase, C2 domain present in E3 ubiquitin ligase | Back alignment and domain information |
|---|
| >gnl|CDD|175974 cd00275, C2_PLC_like, C2 domain present in Phosphoinositide-specific phospholipases C (PLC) | Back alignment and domain information |
|---|
| >gnl|CDD|176047 cd08402, C2B_Synaptotagmin-1, C2 domain second repeat present in Synaptotagmin 1 | Back alignment and domain information |
|---|
| >gnl|CDD|176016 cd04051, C2_SRC2_like, C2 domain present in Soybean genes Regulated by Cold 2 (SRC2)-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|175998 cd04032, C2_Perforin, C2 domain of Perforin | Back alignment and domain information |
|---|
| >gnl|CDD|175982 cd04015, C2_plant_PLD, C2 domain present in plant phospholipase D (PLD) | Back alignment and domain information |
|---|
| >gnl|CDD|176015 cd04050, C2B_Synaptotagmin-like, C2 domain second repeat present in Synaptotagmin-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|176000 cd04035, C2A_Rabphilin_Doc2, C2 domain first repeat present in Rabphilin and Double C2 domain | Back alignment and domain information |
|---|
| >gnl|CDD|176034 cd08388, C2A_Synaptotagmin-4-11, C2A domain first repeat present in Synaptotagmins 4 and 11 | Back alignment and domain information |
|---|
| >gnl|CDD|176024 cd08378, C2B_MCTP_PRT_plant, C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset | Back alignment and domain information |
|---|
| >gnl|CDD|176012 cd04047, C2B_Copine, C2 domain second repeat in Copine | Back alignment and domain information |
|---|
| >gnl|CDD|176064 cd08682, C2_Rab11-FIP_classI, C2 domain found in Rab11-family interacting proteins (FIP) class I | Back alignment and domain information |
|---|
| >gnl|CDD|175997 cd04031, C2A_RIM1alpha, C2 domain first repeat contained in Rab3-interacting molecule (RIM) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|176050 cd08405, C2B_Synaptotagmin-7, C2 domain second repeat present in Synaptotagmin 7 | Back alignment and domain information |
|---|
| >gnl|CDD|178585 PLN03008, PLN03008, Phospholipase D delta | Back alignment and domain information |
|---|
| >gnl|CDD|176036 cd08390, C2A_Synaptotagmin-15-17, C2A domain first repeat present in Synaptotagmins 15 and 17 | Back alignment and domain information |
|---|
| >gnl|CDD|175984 cd04017, C2D_Ferlin, C2 domain fourth repeat in Ferlin | Back alignment and domain information |
|---|
| >gnl|CDD|175986 cd04019, C2C_MCTP_PRT_plant, C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset | Back alignment and domain information |
|---|
| >gnl|CDD|176013 cd04048, C2A_Copine, C2 domain first repeat in Copine | Back alignment and domain information |
|---|
| >gnl|CDD|175995 cd04029, C2A_SLP-4_5, C2 domain first repeat present in Synaptotagmin-like proteins 4 and 5 | Back alignment and domain information |
|---|
| >gnl|CDD|176026 cd08380, C2_PI3K_like, C2 domain present in phosphatidylinositol 3-kinases (PI3Ks) | Back alignment and domain information |
|---|
| >gnl|CDD|176055 cd08410, C2B_Synaptotagmin-17, C2 domain second repeat present in Synaptotagmin 17 | Back alignment and domain information |
|---|
| >gnl|CDD|176048 cd08403, C2B_Synaptotagmin-3-5-6-9-10, C2 domain second repeat present in Synaptotagmins 3, 5, 6, 9, and 10 | Back alignment and domain information |
|---|
| >gnl|CDD|227371 COG5038, COG5038, Ca2+-dependent lipid-binding protein, contains C2 domain [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|176049 cd08404, C2B_Synaptotagmin-4, C2 domain second repeat present in Synaptotagmin 4 | Back alignment and domain information |
|---|
| >gnl|CDD|176060 cd08678, C2_C21orf25-like, C2 domain found in the Human chromosome 21 open reading frame 25 (C21orf25) protein | Back alignment and domain information |
|---|
| >gnl|CDD|176019 cd08373, C2A_Ferlin, C2 domain first repeat in Ferlin | Back alignment and domain information |
|---|
| >gnl|CDD|176038 cd08392, C2A_SLP-3, C2 domain first repeat present in Synaptotagmin-like protein 3 | Back alignment and domain information |
|---|
| >gnl|CDD|175981 cd04014, C2_PKC_epsilon, C2 domain in Protein Kinase C (PKC) epsilon | Back alignment and domain information |
|---|
| >gnl|CDD|176027 cd08381, C2B_PI3K_class_II, C2 domain second repeat present in class II phosphatidylinositol 3-kinases (PI3Ks) | Back alignment and domain information |
|---|
| >gnl|CDD|176046 cd08401, C2A_RasA2_RasA3, C2 domain first repeat present in RasA2 and RasA3 | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 202 | |||
| KOG1030 | 168 | consensus Predicted Ca2+-dependent phospholipid-bi | 100.0 | |
| cd04038 | 145 | C2_ArfGAP C2 domain present in Arf GTPase Activati | 99.97 | |
| cd04016 | 121 | C2_Tollip C2 domain present in Toll-interacting pr | 99.93 | |
| cd08682 | 126 | C2_Rab11-FIP_classI C2 domain found in Rab11-famil | 99.91 | |
| cd08375 | 136 | C2_Intersectin C2 domain present in Intersectin. A | 99.91 | |
| cd08376 | 116 | C2B_MCTP_PRT C2 domain second repeat found in Mult | 99.9 | |
| cd04042 | 121 | C2A_MCTP_PRT C2 domain first repeat found in Multi | 99.9 | |
| cd08379 | 126 | C2D_MCTP_PRT_plant C2 domain fourth repeat found i | 99.9 | |
| cd08391 | 121 | C2A_C2C_Synaptotagmin_like C2 domain first and thi | 99.9 | |
| cd08681 | 118 | C2_fungal_Inn1p-like C2 domain found in fungal Ing | 99.9 | |
| cd04022 | 127 | C2A_MCTP_PRT_plant C2 domain first repeat found in | 99.89 | |
| cd04024 | 128 | C2A_Synaptotagmin-like C2 domain first repeat pres | 99.89 | |
| cd08401 | 121 | C2A_RasA2_RasA3 C2 domain first repeat present in | 99.89 | |
| cd08678 | 126 | C2_C21orf25-like C2 domain found in the Human chro | 99.89 | |
| cd04036 | 119 | C2_cPLA2 C2 domain present in cytosolic PhosphoLip | 99.89 | |
| cd08377 | 119 | C2C_MCTP_PRT C2 domain third repeat found in Multi | 99.88 | |
| cd04019 | 150 | C2C_MCTP_PRT_plant C2 domain third repeat found in | 99.88 | |
| cd04044 | 124 | C2A_Tricalbin-like C2 domain first repeat present | 99.87 | |
| cd04054 | 121 | C2A_Rasal1_RasA4 C2 domain first repeat present in | 99.87 | |
| cd04033 | 133 | C2_NEDD4_NEDD4L C2 domain present in the Human neu | 99.87 | |
| cd04015 | 158 | C2_plant_PLD C2 domain present in plant phospholip | 99.87 | |
| cd08400 | 126 | C2_Ras_p21A1 C2 domain present in RAS p21 protein | 99.86 | |
| cd04014 | 132 | C2_PKC_epsilon C2 domain in Protein Kinase C (PKC) | 99.86 | |
| cd08378 | 121 | C2B_MCTP_PRT_plant C2 domain second repeat found i | 99.86 | |
| cd04025 | 123 | C2B_RasA1_RasA4 C2 domain second repeat present in | 99.86 | |
| cd08395 | 120 | C2C_Munc13 C2 domain third repeat in Munc13 (mamma | 99.86 | |
| cd08373 | 127 | C2A_Ferlin C2 domain first repeat in Ferlin. Ferli | 99.86 | |
| cd04046 | 126 | C2_Calpain C2 domain present in Calpain proteins. | 99.85 | |
| cd08677 | 118 | C2A_Synaptotagmin-13 C2 domain. Synaptotagmin is a | 99.85 | |
| cd04039 | 108 | C2_PSD C2 domain present in Phosphatidylserine dec | 99.85 | |
| cd04050 | 105 | C2B_Synaptotagmin-like C2 domain second repeat pre | 99.85 | |
| cd08381 | 122 | C2B_PI3K_class_II C2 domain second repeat present | 99.85 | |
| cd04027 | 127 | C2B_Munc13 C2 domain second repeat in Munc13 (mamm | 99.84 | |
| cd04028 | 146 | C2B_RIM1alpha C2 domain second repeat contained in | 99.84 | |
| cd04043 | 126 | C2_Munc13_fungal C2 domain in Munc13 (mammalian un | 99.84 | |
| cd04029 | 125 | C2A_SLP-4_5 C2 domain first repeat present in Syna | 99.84 | |
| cd04041 | 111 | C2A_fungal C2 domain first repeat; fungal group. C | 99.83 | |
| cd04017 | 135 | C2D_Ferlin C2 domain fourth repeat in Ferlin. Ferl | 99.83 | |
| cd08394 | 127 | C2A_Munc13 C2 domain first repeat in Munc13 (mamma | 99.83 | |
| cd08382 | 123 | C2_Smurf-like C2 domain present in Smad ubiquitina | 99.83 | |
| cd08387 | 124 | C2A_Synaptotagmin-8 C2A domain first repeat presen | 99.83 | |
| cd08393 | 125 | C2A_SLP-1_2 C2 domain first repeat present in Syna | 99.83 | |
| cd08688 | 110 | C2_KIAA0528-like C2 domain found in the Human KIAA | 99.82 | |
| cd04052 | 111 | C2B_Tricalbin-like C2 domain second repeat present | 99.82 | |
| cd08385 | 124 | C2A_Synaptotagmin-1-5-6-9-10 C2A domain first repe | 99.82 | |
| cd08392 | 128 | C2A_SLP-3 C2 domain first repeat present in Synapt | 99.82 | |
| cd04045 | 120 | C2C_Tricalbin-like C2 domain third repeat present | 99.82 | |
| cd08680 | 124 | C2_Kibra C2 domain found in Human protein Kibra. K | 99.81 | |
| cd04031 | 125 | C2A_RIM1alpha C2 domain first repeat contained in | 99.81 | |
| cd04010 | 148 | C2B_RasA3 C2 domain second repeat present in RAS p | 99.81 | |
| cd04030 | 127 | C2C_KIAA1228 C2 domain third repeat present in unc | 99.8 | |
| cd04049 | 124 | C2_putative_Elicitor-responsive_gene C2 domain pre | 99.8 | |
| cd08685 | 119 | C2_RGS-like C2 domain of the Regulator Of G-Protei | 99.8 | |
| cd04051 | 125 | C2_SRC2_like C2 domain present in Soybean genes Re | 99.8 | |
| cd04011 | 111 | C2B_Ferlin C2 domain second repeat in Ferlin. Ferl | 99.8 | |
| cd08388 | 128 | C2A_Synaptotagmin-4-11 C2A domain first repeat pre | 99.8 | |
| cd04032 | 127 | C2_Perforin C2 domain of Perforin. Perforin contai | 99.8 | |
| cd04018 | 151 | C2C_Ferlin C2 domain third repeat in Ferlin. Ferli | 99.79 | |
| cd04013 | 146 | C2_SynGAP_like C2 domain present in Ras GTPase act | 99.79 | |
| cd08389 | 124 | C2A_Synaptotagmin-14_16 C2A domain first repeat pr | 99.79 | |
| cd08386 | 125 | C2A_Synaptotagmin-7 C2A domain first repeat presen | 99.79 | |
| cd04009 | 133 | C2B_Munc13-like C2 domain second repeat in Munc13 | 99.78 | |
| cd08390 | 123 | C2A_Synaptotagmin-15-17 C2A domain first repeat pr | 99.78 | |
| cd04020 | 162 | C2B_SLP_1-2-3-4 C2 domain second repeat present in | 99.78 | |
| cd04021 | 125 | C2_E3_ubiquitin_ligase C2 domain present in E3 ubi | 99.78 | |
| cd08521 | 123 | C2A_SLP C2 domain first repeat present in Synaptot | 99.78 | |
| cd08406 | 136 | C2B_Synaptotagmin-12 C2 domain second repeat prese | 99.77 | |
| cd08676 | 153 | C2A_Munc13-like C2 domain first repeat in Munc13 ( | 99.77 | |
| cd08383 | 117 | C2A_RasGAP C2 domain (first repeat) of Ras GTPase | 99.77 | |
| cd04040 | 115 | C2D_Tricalbin-like C2 domain fourth repeat present | 99.77 | |
| cd08691 | 137 | C2_NEDL1-like C2 domain present in NEDL1 (NEDD4-li | 99.76 | |
| cd08407 | 138 | C2B_Synaptotagmin-13 C2 domain second repeat prese | 99.76 | |
| cd08690 | 155 | C2_Freud-1 C2 domain found in 5' repressor element | 99.76 | |
| cd04026 | 131 | C2_PKC_alpha_gamma C2 domain in Protein Kinase C ( | 99.76 | |
| KOG0696 | 683 | consensus Serine/threonine protein kinase [Signal | 99.76 | |
| cd08692 | 135 | C2B_Tac2-N C2 domain second repeat found in Tac2-N | 99.76 | |
| cd08675 | 137 | C2B_RasGAP C2 domain second repeat of Ras GTPase a | 99.76 | |
| PLN03008 | 868 | Phospholipase D delta | 99.76 | |
| PLN03200 | 2102 | cellulose synthase-interactive protein; Provisiona | 99.76 | |
| cd04037 | 124 | C2E_Ferlin C2 domain fifth repeat in Ferlin. Ferli | 99.75 | |
| cd08384 | 133 | C2B_Rabphilin_Doc2 C2 domain second repeat present | 99.75 | |
| cd08404 | 136 | C2B_Synaptotagmin-4 C2 domain second repeat presen | 99.75 | |
| cd08402 | 136 | C2B_Synaptotagmin-1 C2 domain second repeat presen | 99.74 | |
| cd08408 | 138 | C2B_Synaptotagmin-14_16 C2 domain second repeat pr | 99.74 | |
| cd00275 | 128 | C2_PLC_like C2 domain present in Phosphoinositide- | 99.73 | |
| cd08405 | 136 | C2B_Synaptotagmin-7 C2 domain second repeat presen | 99.73 | |
| cd08410 | 135 | C2B_Synaptotagmin-17 C2 domain second repeat prese | 99.73 | |
| cd08686 | 118 | C2_ABR C2 domain in the Active BCR (Breakpoint clu | 99.72 | |
| cd08403 | 134 | C2B_Synaptotagmin-3-5-6-9-10 C2 domain second repe | 99.71 | |
| cd00276 | 134 | C2B_Synaptotagmin C2 domain second repeat present | 99.7 | |
| cd04048 | 120 | C2A_Copine C2 domain first repeat in Copine. There | 99.7 | |
| KOG1028 | 421 | consensus Ca2+-dependent phospholipid-binding prot | 99.7 | |
| cd08409 | 137 | C2B_Synaptotagmin-15 C2 domain second repeat prese | 99.69 | |
| cd04035 | 123 | C2A_Rabphilin_Doc2 C2 domain first repeat present | 99.69 | |
| cd04047 | 110 | C2B_Copine C2 domain second repeat in Copine. Ther | 99.65 | |
| PF00168 | 85 | C2: C2 domain; InterPro: IPR000008 The C2 domain i | 99.62 | |
| KOG2059 | 800 | consensus Ras GTPase-activating protein [Signal tr | 99.62 | |
| KOG1011 | 1283 | consensus Neurotransmitter release regulator, UNC- | 99.61 | |
| COG5038 | 1227 | Ca2+-dependent lipid-binding protein, contains C2 | 99.51 | |
| smart00239 | 101 | C2 Protein kinase C conserved region 2 (CalB). Ca2 | 99.49 | |
| cd08374 | 133 | C2F_Ferlin C2 domain sixth repeat in Ferlin. Ferli | 99.46 | |
| PLN02270 | 808 | phospholipase D alpha | 99.45 | |
| cd00030 | 102 | C2 C2 domain. The C2 domain was first identified i | 99.45 | |
| PLN02223 | 537 | phosphoinositide phospholipase C | 99.44 | |
| KOG1028 | 421 | consensus Ca2+-dependent phospholipid-binding prot | 99.41 | |
| KOG1031 | 1169 | consensus Predicted Ca2+-dependent phospholipid-bi | 99.34 | |
| PLN02952 | 599 | phosphoinositide phospholipase C | 99.34 | |
| COG5038 | 1227 | Ca2+-dependent lipid-binding protein, contains C2 | 99.33 | |
| cd08689 | 109 | C2_fungal_Pkc1p C2 domain found in protein kinase | 99.33 | |
| PLN02230 | 598 | phosphoinositide phospholipase C 4 | 99.32 | |
| PLN02222 | 581 | phosphoinositide phospholipase C 2 | 99.3 | |
| KOG0169 | 746 | consensus Phosphoinositide-specific phospholipase | 99.29 | |
| KOG1264 | 1267 | consensus Phospholipase C [Lipid transport and met | 99.24 | |
| PLN02228 | 567 | Phosphoinositide phospholipase C | 99.23 | |
| KOG1328 | 1103 | consensus Synaptic vesicle protein BAIAP3, involve | 99.18 | |
| KOG1328 | 1103 | consensus Synaptic vesicle protein BAIAP3, involve | 99.08 | |
| PLN02352 | 758 | phospholipase D epsilon | 99.03 | |
| KOG1326 | 1105 | consensus Membrane-associated protein FER-1 and re | 98.7 | |
| KOG2059 | 800 | consensus Ras GTPase-activating protein [Signal tr | 98.63 | |
| KOG0905 | 1639 | consensus Phosphoinositide 3-kinase [Signal transd | 98.48 | |
| KOG1011 | 1283 | consensus Neurotransmitter release regulator, UNC- | 98.47 | |
| PLN02964 | 644 | phosphatidylserine decarboxylase | 98.38 | |
| KOG1013 | 362 | consensus Synaptic vesicle protein rabphilin-3A [I | 98.37 | |
| cd08683 | 143 | C2_C2cd3 C2 domain found in C2 calcium-dependent d | 98.2 | |
| KOG1013 | 362 | consensus Synaptic vesicle protein rabphilin-3A [I | 98.05 | |
| KOG2060 | 405 | consensus Rab3 effector RIM1 and related proteins, | 97.95 | |
| cd08684 | 103 | C2A_Tac2-N C2 domain first repeat found in Tac2-N | 97.67 | |
| KOG1265 | 1189 | consensus Phospholipase C [Lipid transport and met | 97.61 | |
| KOG3837 | 523 | consensus Uncharacterized conserved protein, conta | 97.59 | |
| KOG1326 | 1105 | consensus Membrane-associated protein FER-1 and re | 97.52 | |
| KOG1327 | 529 | consensus Copine [Signal transduction mechanisms] | 97.44 | |
| PF15627 | 156 | CEP76-C2: CEP76 C2 domain | 97.12 | |
| cd08398 | 158 | C2_PI3K_class_I_alpha C2 domain present in class I | 96.93 | |
| cd08693 | 173 | C2_PI3K_class_I_beta_delta C2 domain present in cl | 96.84 | |
| PF10358 | 143 | NT-C2: N-terminal C2 in EEIG1 and EHBP1 proteins; | 96.83 | |
| cd08380 | 156 | C2_PI3K_like C2 domain present in phosphatidylinos | 96.72 | |
| KOG1452 | 442 | consensus Predicted Rho GTPase-activating protein | 96.61 | |
| PF12416 | 340 | DUF3668: Cep120 protein; InterPro: IPR022136 This | 96.54 | |
| cd08397 | 159 | C2_PI3K_class_III C2 domain present in class III p | 96.51 | |
| cd08687 | 98 | C2_PKN-like C2 domain in Protein kinase C-like (PK | 96.32 | |
| cd08399 | 178 | C2_PI3K_class_I_gamma C2 domain present in class I | 96.29 | |
| cd04012 | 171 | C2A_PI3K_class_II C2 domain first repeat present i | 95.67 | |
| PF00792 | 142 | PI3K_C2: Phosphoinositide 3-kinase C2; InterPro: I | 95.08 | |
| PF15625 | 168 | CC2D2AN-C2: CC2D2A N-terminal C2 domain | 94.48 | |
| cd08695 | 189 | C2_Dock-B C2 domains found in Dedicator Of CytoKin | 93.91 | |
| KOG1327 | 529 | consensus Copine [Signal transduction mechanisms] | 92.97 | |
| PF14429 | 184 | DOCK-C2: C2 domain in Dock180 and Zizimin proteins | 92.75 | |
| smart00142 | 100 | PI3K_C2 Phosphoinositide 3-kinase, region postulat | 92.56 | |
| cd08694 | 196 | C2_Dock-A C2 domains found in Dedicator Of CytoKin | 92.54 | |
| PF11618 | 107 | DUF3250: Protein of unknown function (DUF3250); In | 92.44 | |
| PF07162 | 168 | B9-C2: Ciliary basal body-associated, B9 protein; | 92.14 | |
| KOG1329 | 887 | consensus Phospholipase D1 [Lipid transport and me | 89.5 | |
| KOG0694 | 694 | consensus Serine/threonine protein kinase [Signal | 88.71 | |
| cd08679 | 178 | C2_DOCK180_related C2 domains found in Dedicator O | 86.87 | |
| cd08696 | 179 | C2_Dock-C C2 domains found in Dedicator Of CytoKin | 86.42 | |
| cd08697 | 185 | C2_Dock-D C2 domains found in Dedicator Of CytoKin | 83.9 | |
| PTZ00447 | 508 | apical membrane antigen 1-like protein; Provisiona | 83.54 |
| >KOG1030 consensus Predicted Ca2+-dependent phospholipid-binding protein [General function prediction only] | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.1e-33 Score=206.80 Aligned_cols=162 Identities=61% Similarity=1.029 Sum_probs=155.1
Q ss_pred cceEEEEEEEEeecCCCCCC-CCCCcEEEEEECCeEEeceeecCCCCCeEeeeeEEEEeCCCCcEEEEEEecCCCCCCCc
Q 028875 41 LLGLLRIRIKRGVNLAVRDV-RSSDPYVVVKMGKQKLKTRVIKKDVNPEWNEDLTLSITDPNVPITLTVYDHDLFSKDDR 119 (202)
Q Consensus 41 ~~g~L~v~v~~a~~L~~~~~-~~~dpyv~v~~~~~~~~T~~~~~t~~P~w~e~f~f~v~~~~~~L~i~V~d~~~~~~d~~ 119 (202)
+.|.|+|+|++|.+|..+|+ +.+||||++.+++++.+|+++.++.||.|||.|+|.+.++...|+++|||+|.++.||+
T Consensus 4 ~vGLL~v~v~~g~~L~~rD~~~sSDPyVVl~lg~q~lkT~~v~~n~NPeWNe~ltf~v~d~~~~lkv~VyD~D~fs~dD~ 83 (168)
T KOG1030|consen 4 LVGLLRVRVKRGKNLAIRDFLGSSDPYVVLELGNQKLKTRVVYKNLNPEWNEELTFTVKDPNTPLKVTVYDKDTFSSDDF 83 (168)
T ss_pred cceEEEEEEEeecCeeeeccccCCCCeEEEEECCeeeeeeeecCCCCCcccceEEEEecCCCceEEEEEEeCCCCCcccc
Confidence 57999999999999999995 99999999999999999999999999999999999999999999999999999999999
Q ss_pred cEEEEEehHhHHHHhcCC--cccCCCceEEEEEeeCCCCccCCCceeEeeCCcEEEEEEEEecccceeeEEEEEEEEeCC
Q 028875 120 MGDAEFDIKTYIEALKMN--LDSLPTGTIISRVMPSRHNCLSEQSCVVWKEGKVVQDLVLRLRNVECGELEIQLQWIDLP 197 (202)
Q Consensus 120 lG~~~i~l~~l~~~~~~~--~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~l~~~~~G~i~l~l~~~~~~ 197 (202)
+|.++|+|..+....... ..+.+.|+.+..+.+...+|.++++.+.+..|++.++.++++++.++|+++++++|++.+
T Consensus 84 mG~A~I~l~p~~~~~~~~~l~~~~~~gt~~~~v~~s~dn~~~~es~i~~s~~~~~q~~~l~l~~ve~g~~e~~~~~~~~~ 163 (168)
T KOG1030|consen 84 MGEATIPLKPLLEAQKMDYLKLELLTGTAIGKVLLSRDNCLNEESAIIRSFGKIVQDYILRLQNVECGELEIQLEWIKLP 163 (168)
T ss_pred cceeeeccHHHHHHhhhhccccccCCCcEeeEEEeccccccccceEEEecCChhhhhhccchhhcCcceeeeeeeEecCc
Confidence 999999999999887766 358889999999999999999999999999999999999999999999999999999999
Q ss_pred CCCCC
Q 028875 198 GSKGL 202 (202)
Q Consensus 198 ~~~~~ 202 (202)
+.+|+
T Consensus 164 ~~~~~ 168 (168)
T KOG1030|consen 164 GSVGL 168 (168)
T ss_pred ccccC
Confidence 99875
|
|
| >cd04038 C2_ArfGAP C2 domain present in Arf GTPase Activating Proteins (GAP) | Back alignment and domain information |
|---|
| >cd04016 C2_Tollip C2 domain present in Toll-interacting protein (Tollip) | Back alignment and domain information |
|---|
| >cd08682 C2_Rab11-FIP_classI C2 domain found in Rab11-family interacting proteins (FIP) class I | Back alignment and domain information |
|---|
| >cd08375 C2_Intersectin C2 domain present in Intersectin | Back alignment and domain information |
|---|
| >cd08376 C2B_MCTP_PRT C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) | Back alignment and domain information |
|---|
| >cd04042 C2A_MCTP_PRT C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) | Back alignment and domain information |
|---|
| >cd08379 C2D_MCTP_PRT_plant C2 domain fourth repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset | Back alignment and domain information |
|---|
| >cd08391 C2A_C2C_Synaptotagmin_like C2 domain first and third repeat in Synaptotagmin-like proteins | Back alignment and domain information |
|---|
| >cd08681 C2_fungal_Inn1p-like C2 domain found in fungal Ingression 1 (Inn1) proteins | Back alignment and domain information |
|---|
| >cd04022 C2A_MCTP_PRT_plant C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset | Back alignment and domain information |
|---|
| >cd04024 C2A_Synaptotagmin-like C2 domain first repeat present in Synaptotagmin-like proteins | Back alignment and domain information |
|---|
| >cd08401 C2A_RasA2_RasA3 C2 domain first repeat present in RasA2 and RasA3 | Back alignment and domain information |
|---|
| >cd08678 C2_C21orf25-like C2 domain found in the Human chromosome 21 open reading frame 25 (C21orf25) protein | Back alignment and domain information |
|---|
| >cd04036 C2_cPLA2 C2 domain present in cytosolic PhosphoLipase A2 (cPLA2) | Back alignment and domain information |
|---|
| >cd08377 C2C_MCTP_PRT C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) | Back alignment and domain information |
|---|
| >cd04019 C2C_MCTP_PRT_plant C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset | Back alignment and domain information |
|---|
| >cd04044 C2A_Tricalbin-like C2 domain first repeat present in Tricalbin-like proteins | Back alignment and domain information |
|---|
| >cd04054 C2A_Rasal1_RasA4 C2 domain first repeat present in RasA1 and RasA4 | Back alignment and domain information |
|---|
| >cd04033 C2_NEDD4_NEDD4L C2 domain present in the Human neural precursor cell-expressed, developmentally down-regulated 4 (NEDD4) and NEDD4-like (NEDD4L/NEDD42) | Back alignment and domain information |
|---|
| >cd04015 C2_plant_PLD C2 domain present in plant phospholipase D (PLD) | Back alignment and domain information |
|---|
| >cd08400 C2_Ras_p21A1 C2 domain present in RAS p21 protein activator 1 (RasA1) | Back alignment and domain information |
|---|
| >cd04014 C2_PKC_epsilon C2 domain in Protein Kinase C (PKC) epsilon | Back alignment and domain information |
|---|
| >cd08378 C2B_MCTP_PRT_plant C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset | Back alignment and domain information |
|---|
| >cd04025 C2B_RasA1_RasA4 C2 domain second repeat present in RasA1 and RasA4 | Back alignment and domain information |
|---|
| >cd08395 C2C_Munc13 C2 domain third repeat in Munc13 (mammalian uncoordinated) proteins | Back alignment and domain information |
|---|
| >cd08373 C2A_Ferlin C2 domain first repeat in Ferlin | Back alignment and domain information |
|---|
| >cd04046 C2_Calpain C2 domain present in Calpain proteins | Back alignment and domain information |
|---|
| >cd08677 C2A_Synaptotagmin-13 C2 domain | Back alignment and domain information |
|---|
| >cd04039 C2_PSD C2 domain present in Phosphatidylserine decarboxylase (PSD) | Back alignment and domain information |
|---|
| >cd04050 C2B_Synaptotagmin-like C2 domain second repeat present in Synaptotagmin-like proteins | Back alignment and domain information |
|---|
| >cd08381 C2B_PI3K_class_II C2 domain second repeat present in class II phosphatidylinositol 3-kinases (PI3Ks) | Back alignment and domain information |
|---|
| >cd04027 C2B_Munc13 C2 domain second repeat in Munc13 (mammalian uncoordinated) proteins | Back alignment and domain information |
|---|
| >cd04028 C2B_RIM1alpha C2 domain second repeat contained in Rab3-interacting molecule (RIM) proteins | Back alignment and domain information |
|---|
| >cd04043 C2_Munc13_fungal C2 domain in Munc13 (mammalian uncoordinated) proteins; fungal group | Back alignment and domain information |
|---|
| >cd04029 C2A_SLP-4_5 C2 domain first repeat present in Synaptotagmin-like proteins 4 and 5 | Back alignment and domain information |
|---|
| >cd04041 C2A_fungal C2 domain first repeat; fungal group | Back alignment and domain information |
|---|
| >cd04017 C2D_Ferlin C2 domain fourth repeat in Ferlin | Back alignment and domain information |
|---|
| >cd08394 C2A_Munc13 C2 domain first repeat in Munc13 (mammalian uncoordinated) proteins | Back alignment and domain information |
|---|
| >cd08382 C2_Smurf-like C2 domain present in Smad ubiquitination-related factor (Smurf)-like proteins | Back alignment and domain information |
|---|
| >cd08387 C2A_Synaptotagmin-8 C2A domain first repeat present in Synaptotagmin 8 | Back alignment and domain information |
|---|
| >cd08393 C2A_SLP-1_2 C2 domain first repeat present in Synaptotagmin-like proteins 1 and 2 | Back alignment and domain information |
|---|
| >cd08688 C2_KIAA0528-like C2 domain found in the Human KIAA0528 cDNA clone | Back alignment and domain information |
|---|
| >cd04052 C2B_Tricalbin-like C2 domain second repeat present in Tricalbin-like proteins | Back alignment and domain information |
|---|
| >cd08385 C2A_Synaptotagmin-1-5-6-9-10 C2A domain first repeat present in Synaptotagmins 1, 5, 6, 9, and 10 | Back alignment and domain information |
|---|
| >cd08392 C2A_SLP-3 C2 domain first repeat present in Synaptotagmin-like protein 3 | Back alignment and domain information |
|---|
| >cd04045 C2C_Tricalbin-like C2 domain third repeat present in Tricalbin-like proteins | Back alignment and domain information |
|---|
| >cd08680 C2_Kibra C2 domain found in Human protein Kibra | Back alignment and domain information |
|---|
| >cd04031 C2A_RIM1alpha C2 domain first repeat contained in Rab3-interacting molecule (RIM) proteins | Back alignment and domain information |
|---|
| >cd04010 C2B_RasA3 C2 domain second repeat present in RAS p21 protein activator 3 (RasA3) | Back alignment and domain information |
|---|
| >cd04030 C2C_KIAA1228 C2 domain third repeat present in uncharacterized human KIAA1228-like proteins | Back alignment and domain information |
|---|
| >cd04049 C2_putative_Elicitor-responsive_gene C2 domain present in the putative elicitor-responsive gene | Back alignment and domain information |
|---|
| >cd08685 C2_RGS-like C2 domain of the Regulator Of G-Protein Signaling (RGS) family | Back alignment and domain information |
|---|
| >cd04051 C2_SRC2_like C2 domain present in Soybean genes Regulated by Cold 2 (SRC2)-like proteins | Back alignment and domain information |
|---|
| >cd04011 C2B_Ferlin C2 domain second repeat in Ferlin | Back alignment and domain information |
|---|
| >cd08388 C2A_Synaptotagmin-4-11 C2A domain first repeat present in Synaptotagmins 4 and 11 | Back alignment and domain information |
|---|
| >cd04032 C2_Perforin C2 domain of Perforin | Back alignment and domain information |
|---|
| >cd04018 C2C_Ferlin C2 domain third repeat in Ferlin | Back alignment and domain information |
|---|
| >cd04013 C2_SynGAP_like C2 domain present in Ras GTPase activating protein (GAP) family | Back alignment and domain information |
|---|
| >cd08389 C2A_Synaptotagmin-14_16 C2A domain first repeat present in Synaptotagmins 14 and 16 | Back alignment and domain information |
|---|
| >cd08386 C2A_Synaptotagmin-7 C2A domain first repeat present in Synaptotagmin 7 | Back alignment and domain information |
|---|
| >cd04009 C2B_Munc13-like C2 domain second repeat in Munc13 (mammalian uncoordinated)-like proteins | Back alignment and domain information |
|---|
| >cd08390 C2A_Synaptotagmin-15-17 C2A domain first repeat present in Synaptotagmins 15 and 17 | Back alignment and domain information |
|---|
| >cd04020 C2B_SLP_1-2-3-4 C2 domain second repeat present in Synaptotagmin-like proteins 1-4 | Back alignment and domain information |
|---|
| >cd04021 C2_E3_ubiquitin_ligase C2 domain present in E3 ubiquitin ligase | Back alignment and domain information |
|---|
| >cd08521 C2A_SLP C2 domain first repeat present in Synaptotagmin-like proteins | Back alignment and domain information |
|---|
| >cd08406 C2B_Synaptotagmin-12 C2 domain second repeat present in Synaptotagmin 12 | Back alignment and domain information |
|---|
| >cd08676 C2A_Munc13-like C2 domain first repeat in Munc13 (mammalian uncoordinated)-like proteins | Back alignment and domain information |
|---|
| >cd08383 C2A_RasGAP C2 domain (first repeat) of Ras GTPase activating proteins (GAPs) | Back alignment and domain information |
|---|
| >cd04040 C2D_Tricalbin-like C2 domain fourth repeat present in Tricalbin-like proteins | Back alignment and domain information |
|---|
| >cd08691 C2_NEDL1-like C2 domain present in NEDL1 (NEDD4-like ubiquitin protein ligase-1) | Back alignment and domain information |
|---|
| >cd08407 C2B_Synaptotagmin-13 C2 domain second repeat present in Synaptotagmin 13 | Back alignment and domain information |
|---|
| >cd08690 C2_Freud-1 C2 domain found in 5' repressor element under dual repression binding protein-1 (Freud-1) | Back alignment and domain information |
|---|
| >cd04026 C2_PKC_alpha_gamma C2 domain in Protein Kinase C (PKC) alpha and gamma | Back alignment and domain information |
|---|
| >KOG0696 consensus Serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd08692 C2B_Tac2-N C2 domain second repeat found in Tac2-N (Tandem C2 protein in Nucleus) | Back alignment and domain information |
|---|
| >cd08675 C2B_RasGAP C2 domain second repeat of Ras GTPase activating proteins (GAPs) | Back alignment and domain information |
|---|
| >PLN03008 Phospholipase D delta | Back alignment and domain information |
|---|
| >PLN03200 cellulose synthase-interactive protein; Provisional | Back alignment and domain information |
|---|
| >cd04037 C2E_Ferlin C2 domain fifth repeat in Ferlin | Back alignment and domain information |
|---|
| >cd08384 C2B_Rabphilin_Doc2 C2 domain second repeat present in Rabphilin and Double C2 domain | Back alignment and domain information |
|---|
| >cd08404 C2B_Synaptotagmin-4 C2 domain second repeat present in Synaptotagmin 4 | Back alignment and domain information |
|---|
| >cd08402 C2B_Synaptotagmin-1 C2 domain second repeat present in Synaptotagmin 1 | Back alignment and domain information |
|---|
| >cd08408 C2B_Synaptotagmin-14_16 C2 domain second repeat present in Synaptotagmins 14 and 16 | Back alignment and domain information |
|---|
| >cd00275 C2_PLC_like C2 domain present in Phosphoinositide-specific phospholipases C (PLC) | Back alignment and domain information |
|---|
| >cd08405 C2B_Synaptotagmin-7 C2 domain second repeat present in Synaptotagmin 7 | Back alignment and domain information |
|---|
| >cd08410 C2B_Synaptotagmin-17 C2 domain second repeat present in Synaptotagmin 17 | Back alignment and domain information |
|---|
| >cd08686 C2_ABR C2 domain in the Active BCR (Breakpoint cluster region) Related protein | Back alignment and domain information |
|---|
| >cd08403 C2B_Synaptotagmin-3-5-6-9-10 C2 domain second repeat present in Synaptotagmins 3, 5, 6, 9, and 10 | Back alignment and domain information |
|---|
| >cd00276 C2B_Synaptotagmin C2 domain second repeat present in Synaptotagmin | Back alignment and domain information |
|---|
| >cd04048 C2A_Copine C2 domain first repeat in Copine | Back alignment and domain information |
|---|
| >KOG1028 consensus Ca2+-dependent phospholipid-binding protein Synaptotagmin, required for synaptic vesicle and secretory granule exocytosis [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >cd08409 C2B_Synaptotagmin-15 C2 domain second repeat present in Synaptotagmin 15 | Back alignment and domain information |
|---|
| >cd04035 C2A_Rabphilin_Doc2 C2 domain first repeat present in Rabphilin and Double C2 domain | Back alignment and domain information |
|---|
| >cd04047 C2B_Copine C2 domain second repeat in Copine | Back alignment and domain information |
|---|
| >PF00168 C2: C2 domain; InterPro: IPR000008 The C2 domain is a Ca2+-dependent membrane-targeting module found in many cellular proteins involved in signal transduction or membrane trafficking | Back alignment and domain information |
|---|
| >KOG2059 consensus Ras GTPase-activating protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1011 consensus Neurotransmitter release regulator, UNC-13 [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >COG5038 Ca2+-dependent lipid-binding protein, contains C2 domain [General function prediction only] | Back alignment and domain information |
|---|
| >smart00239 C2 Protein kinase C conserved region 2 (CalB) | Back alignment and domain information |
|---|
| >cd08374 C2F_Ferlin C2 domain sixth repeat in Ferlin | Back alignment and domain information |
|---|
| >PLN02270 phospholipase D alpha | Back alignment and domain information |
|---|
| >cd00030 C2 C2 domain | Back alignment and domain information |
|---|
| >PLN02223 phosphoinositide phospholipase C | Back alignment and domain information |
|---|
| >KOG1028 consensus Ca2+-dependent phospholipid-binding protein Synaptotagmin, required for synaptic vesicle and secretory granule exocytosis [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG1031 consensus Predicted Ca2+-dependent phospholipid-binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02952 phosphoinositide phospholipase C | Back alignment and domain information |
|---|
| >COG5038 Ca2+-dependent lipid-binding protein, contains C2 domain [General function prediction only] | Back alignment and domain information |
|---|
| >cd08689 C2_fungal_Pkc1p C2 domain found in protein kinase C (Pkc1p) in Saccharomyces cerevisiae | Back alignment and domain information |
|---|
| >PLN02230 phosphoinositide phospholipase C 4 | Back alignment and domain information |
|---|
| >PLN02222 phosphoinositide phospholipase C 2 | Back alignment and domain information |
|---|
| >KOG0169 consensus Phosphoinositide-specific phospholipase C [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1264 consensus Phospholipase C [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02228 Phosphoinositide phospholipase C | Back alignment and domain information |
|---|
| >KOG1328 consensus Synaptic vesicle protein BAIAP3, involved in vesicle priming/regulation [Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1328 consensus Synaptic vesicle protein BAIAP3, involved in vesicle priming/regulation [Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN02352 phospholipase D epsilon | Back alignment and domain information |
|---|
| >KOG1326 consensus Membrane-associated protein FER-1 and related ferlins, contain multiple C2 domains [Cell wall/membrane/envelope biogenesis] | Back alignment and domain information |
|---|
| >KOG2059 consensus Ras GTPase-activating protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0905 consensus Phosphoinositide 3-kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1011 consensus Neurotransmitter release regulator, UNC-13 [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PLN02964 phosphatidylserine decarboxylase | Back alignment and domain information |
|---|
| >KOG1013 consensus Synaptic vesicle protein rabphilin-3A [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >cd08683 C2_C2cd3 C2 domain found in C2 calcium-dependent domain containing 3 (C2cd3) proteins | Back alignment and domain information |
|---|
| >KOG1013 consensus Synaptic vesicle protein rabphilin-3A [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG2060 consensus Rab3 effector RIM1 and related proteins, contain PDZ and C2 domains [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >cd08684 C2A_Tac2-N C2 domain first repeat found in Tac2-N (Tandem C2 protein in Nucleus) | Back alignment and domain information |
|---|
| >KOG1265 consensus Phospholipase C [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG3837 consensus Uncharacterized conserved protein, contains DM14 and C2 domains [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1326 consensus Membrane-associated protein FER-1 and related ferlins, contain multiple C2 domains [Cell wall/membrane/envelope biogenesis] | Back alignment and domain information |
|---|
| >KOG1327 consensus Copine [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF15627 CEP76-C2: CEP76 C2 domain | Back alignment and domain information |
|---|
| >cd08398 C2_PI3K_class_I_alpha C2 domain present in class I alpha phosphatidylinositol 3-kinases (PI3Ks) | Back alignment and domain information |
|---|
| >cd08693 C2_PI3K_class_I_beta_delta C2 domain present in class I beta and delta phosphatidylinositol 3-kinases (PI3Ks) | Back alignment and domain information |
|---|
| >PF10358 NT-C2: N-terminal C2 in EEIG1 and EHBP1 proteins; InterPro: IPR019448 This entry represents the N-terminal 150 residues of a family of conserved proteins which are induced by oestrogen [] | Back alignment and domain information |
|---|
| >cd08380 C2_PI3K_like C2 domain present in phosphatidylinositol 3-kinases (PI3Ks) | Back alignment and domain information |
|---|
| >KOG1452 consensus Predicted Rho GTPase-activating protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF12416 DUF3668: Cep120 protein; InterPro: IPR022136 This domain family is found in eukaryotes, and is typically between 75 and 114 amino acids in length | Back alignment and domain information |
|---|
| >cd08397 C2_PI3K_class_III C2 domain present in class III phosphatidylinositol 3-kinases (PI3Ks) | Back alignment and domain information |
|---|
| >cd08687 C2_PKN-like C2 domain in Protein kinase C-like (PKN) proteins | Back alignment and domain information |
|---|
| >cd08399 C2_PI3K_class_I_gamma C2 domain present in class I gamma phosphatidylinositol 3-kinases (PI3Ks) | Back alignment and domain information |
|---|
| >cd04012 C2A_PI3K_class_II C2 domain first repeat present in class II phosphatidylinositol 3-kinases (PI3Ks) | Back alignment and domain information |
|---|
| >PF00792 PI3K_C2: Phosphoinositide 3-kinase C2; InterPro: IPR002420 Phosphatidylinositol 3-kinase (PI3-kinase) (2 | Back alignment and domain information |
|---|
| >PF15625 CC2D2AN-C2: CC2D2A N-terminal C2 domain | Back alignment and domain information |
|---|
| >cd08695 C2_Dock-B C2 domains found in Dedicator Of CytoKinesis (Dock) class B proteins | Back alignment and domain information |
|---|
| >KOG1327 consensus Copine [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF14429 DOCK-C2: C2 domain in Dock180 and Zizimin proteins; PDB: 3L4C_A | Back alignment and domain information |
|---|
| >smart00142 PI3K_C2 Phosphoinositide 3-kinase, region postulated to contain C2 domain | Back alignment and domain information |
|---|
| >cd08694 C2_Dock-A C2 domains found in Dedicator Of CytoKinesis (Dock) class A proteins | Back alignment and domain information |
|---|
| >PF11618 DUF3250: Protein of unknown function (DUF3250); InterPro: IPR021656 This family of proteins represents a protein with unknown function | Back alignment and domain information |
|---|
| >PF07162 B9-C2: Ciliary basal body-associated, B9 protein; InterPro: IPR010796 Proteins in this entry include the MSK1 protein (Q9NXB0 from SWISSPROT) and other known or predicted flagellar basal body proteome components [] or cilia-containing species | Back alignment and domain information |
|---|
| >KOG1329 consensus Phospholipase D1 [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0694 consensus Serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd08679 C2_DOCK180_related C2 domains found in Dedicator Of CytoKinesis 1 (DOCK 180) and related proteins | Back alignment and domain information |
|---|
| >cd08696 C2_Dock-C C2 domains found in Dedicator Of CytoKinesis (Dock) class C proteins | Back alignment and domain information |
|---|
| >cd08697 C2_Dock-D C2 domains found in Dedicator Of CytoKinesis (Dock) class C proteins | Back alignment and domain information |
|---|
| >PTZ00447 apical membrane antigen 1-like protein; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 202 | ||||
| 3jzy_A | 510 | Crystal Structure Of Human Intersectin 2 C2 Domain | 1e-07 | ||
| 3pfq_A | 674 | Crystal Structure And Allosteric Activation Of Prot | 6e-07 | ||
| 1a25_A | 149 | C2 Domain From Protein Kinase C (Beta) Length = 149 | 1e-06 | ||
| 2ep6_A | 133 | Solution Structure Of The Second C2 Domain From Hum | 3e-06 | ||
| 1dsy_A | 139 | C2 Domain From Protein Kinase C (Alpha) Complexed W | 9e-06 | ||
| 3gpe_A | 137 | Crystal Structure Analysis Of Pkc (Alpha)-C2 Domain | 1e-05 | ||
| 2cm6_A | 166 | Crystal Structure Of The C2b Domain Of Rabphilin3a | 1e-05 | ||
| 3rpb_A | 140 | The C2b-Domain Of Rabphilin: Structural Variations | 1e-05 | ||
| 2nsq_A | 155 | Crystal Structure Of The C2 Domain Of The Human E3 | 2e-05 | ||
| 2r83_A | 284 | Crystal Structure Analysis Of Human Synaptotagmin 1 | 2e-05 | ||
| 2cm5_A | 166 | Crystal Structure Of The C2b Domain Of Rabphilin Le | 3e-05 | ||
| 1rsy_A | 152 | Structure Of The First C2-domain Of Synaptotagmin I | 4e-05 | ||
| 3f04_A | 143 | Crystal Structure Of Synaptotagmin I C2a Domain Len | 4e-05 | ||
| 1byn_A | 128 | Solution Structure Of The Calcium-Bound First C2-Do | 4e-05 | ||
| 3f00_A | 143 | Crystal Structure Of Synaptotagmin I C2a Domain Wit | 4e-05 | ||
| 2uzp_A | 144 | Crystal Structure Of The C2 Domain Of Human Protein | 5e-05 | ||
| 4dnl_A | 140 | Crystal Structure Of A C2 Domain Of A Protein Kinas | 6e-05 | ||
| 3b7y_A | 153 | Crystal Structure Of The C2 Domain Of The E3 Ubiqui | 6e-05 | ||
| 3m7f_B | 176 | Crystal Structure Of The Nedd4 C2GRB10 SH2 COMPLEX | 6e-05 | ||
| 3kwt_A | 148 | Munc13-1 C2b-Domain, Calcium-Free Length = 148 | 1e-04 | ||
| 3hn8_A | 296 | Crystal Structure Of Synaptotagmin Length = 296 | 1e-04 | ||
| 1dqv_A | 296 | Crystal Structure Of Synaptotagmin Iii C2aC2B Lengt | 1e-04 | ||
| 2d8k_A | 141 | Solution Structure Of The First C2 Domain Of Synapt | 3e-04 | ||
| 1ugk_A | 138 | Solution Structure Of The First C2 Domain Of Synapt | 4e-04 | ||
| 1rh8_A | 142 | Three-Dimensional Structure Of The Calcium-Free Pic | 7e-04 |
| >pdb|3JZY|A Chain A, Crystal Structure Of Human Intersectin 2 C2 Domain Length = 510 | Back alignment and structure |
|
| >pdb|3PFQ|A Chain A, Crystal Structure And Allosteric Activation Of Protein Kinase C Beta Ii Length = 674 | Back alignment and structure |
| >pdb|1A25|A Chain A, C2 Domain From Protein Kinase C (Beta) Length = 149 | Back alignment and structure |
| >pdb|2EP6|A Chain A, Solution Structure Of The Second C2 Domain From Human Mctp2 Protein Length = 133 | Back alignment and structure |
| >pdb|1DSY|A Chain A, C2 Domain From Protein Kinase C (Alpha) Complexed With Ca2+ And Phosphatidylserine Length = 139 | Back alignment and structure |
| >pdb|3GPE|A Chain A, Crystal Structure Analysis Of Pkc (Alpha)-C2 Domain Complexed With Ca2+ And Ptdins(4,5)p2 Length = 137 | Back alignment and structure |
| >pdb|2CM6|A Chain A, Crystal Structure Of The C2b Domain Of Rabphilin3a Length = 166 | Back alignment and structure |
| >pdb|3RPB|A Chain A, The C2b-Domain Of Rabphilin: Structural Variations In A Janus-Faced Domain Length = 140 | Back alignment and structure |
| >pdb|2NSQ|A Chain A, Crystal Structure Of The C2 Domain Of The Human E3 Ubiquitin-Protein Ligase Nedd4-Like Protein Length = 155 | Back alignment and structure |
| >pdb|2R83|A Chain A, Crystal Structure Analysis Of Human Synaptotagmin 1 C2a-c2b Length = 284 | Back alignment and structure |
| >pdb|2CM5|A Chain A, Crystal Structure Of The C2b Domain Of Rabphilin Length = 166 | Back alignment and structure |
| >pdb|1RSY|A Chain A, Structure Of The First C2-domain Of Synaptotagmin I: A Novel Ca2+(slash)phospholipid Binding Fold Length = 152 | Back alignment and structure |
| >pdb|3F04|A Chain A, Crystal Structure Of Synaptotagmin I C2a Domain Length = 143 | Back alignment and structure |
| >pdb|1BYN|A Chain A, Solution Structure Of The Calcium-Bound First C2-Domain Of Synaptotagmin I Length = 128 | Back alignment and structure |
| >pdb|3F00|A Chain A, Crystal Structure Of Synaptotagmin I C2a Domain With Cu(Ii) Length = 143 | Back alignment and structure |
| >pdb|2UZP|A Chain A, Crystal Structure Of The C2 Domain Of Human Protein Kinase C Gamma. Length = 144 | Back alignment and structure |
| >pdb|4DNL|A Chain A, Crystal Structure Of A C2 Domain Of A Protein Kinase C Alpha (Prkca) From Homo Sapiens At 1.90 A Resolution Length = 140 | Back alignment and structure |
| >pdb|3B7Y|A Chain A, Crystal Structure Of The C2 Domain Of The E3 Ubiquitin- Protein Ligase Nedd4 Length = 153 | Back alignment and structure |
| >pdb|3M7F|B Chain B, Crystal Structure Of The Nedd4 C2GRB10 SH2 COMPLEX Length = 176 | Back alignment and structure |
| >pdb|3KWT|A Chain A, Munc13-1 C2b-Domain, Calcium-Free Length = 148 | Back alignment and structure |
| >pdb|3HN8|A Chain A, Crystal Structure Of Synaptotagmin Length = 296 | Back alignment and structure |
| >pdb|1DQV|A Chain A, Crystal Structure Of Synaptotagmin Iii C2aC2B Length = 296 | Back alignment and structure |
| >pdb|2D8K|A Chain A, Solution Structure Of The First C2 Domain Of Synaptotagmin Vii Length = 141 | Back alignment and structure |
| >pdb|1UGK|A Chain A, Solution Structure Of The First C2 Domain Of Synaptotagmin Iv From Human Fetal Brain (Kiaa1342) Length = 138 | Back alignment and structure |
| >pdb|1RH8|A Chain A, Three-Dimensional Structure Of The Calcium-Free Piccolo C2a- Domain Length = 142 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 202 | |||
| 2ep6_A | 133 | MCTP2 protein; beta sandwich, Ca2+ binding, membra | 3e-39 | |
| 1wfj_A | 136 | Putative elicitor-responsive gene; C2 domain, rike | 4e-34 | |
| 2dmh_A | 140 | Myoferlin; beta-sandwich, FER-1-like protein 3, mu | 6e-34 | |
| 2nq3_A | 173 | Itchy homolog E3 ubiquitin protein ligase; C2 doma | 9e-34 | |
| 3b7y_A | 153 | E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL- | 2e-31 | |
| 3m7f_B | 176 | E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB1 | 1e-30 | |
| 1gmi_A | 136 | Protein kinase C, epsilon type; PKC, C2 domain, X- | 2e-27 | |
| 3kwu_A | 148 | MUNC13-1; calcium binding protein, phospholipid bi | 4e-27 | |
| 3nsj_A | 540 | Perforin-1; pore forming protein, immune system; H | 9e-27 | |
| 1rlw_A | 126 | Phospholipase A2, CALB domain; hydrolase, C2 domai | 2e-23 | |
| 1a25_A | 149 | CALB, protein kinase C (beta); calcium++/phospholi | 2e-23 | |
| 3rdl_A | 137 | Protein kinase C alpha type; protein kinase PKC, t | 8e-23 | |
| 2fk9_A | 157 | Protein kinase C, ETA type; ATP-binding, metal-bin | 1e-22 | |
| 3pyc_A | 132 | E3 ubiquitin-protein ligase smurf1; phospholipid b | 1e-22 | |
| 3f04_A | 143 | Synaptotagmin-1; C2A, calcium, cell junction, cyto | 2e-20 | |
| 1rsy_A | 152 | Synaptotagmin I; calcium/phospholipid binding prot | 4e-20 | |
| 2d8k_A | 141 | Synaptotagmin VII; exocytosis, calcium binding, ly | 8e-20 | |
| 1ugk_A | 138 | Synaptotagmin IV, KIAA1342; beta sandwich, structu | 2e-19 | |
| 2r83_A | 284 | Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cel | 3e-19 | |
| 2r83_A | 284 | Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cel | 1e-16 | |
| 1dqv_A | 296 | Synaptotagmin III; beta sandwich, calcium ION, C2 | 4e-19 | |
| 1dqv_A | 296 | Synaptotagmin III; beta sandwich, calcium ION, C2 | 2e-16 | |
| 1rh8_A | 142 | Piccolo protein; beta-sandwich, metal binding prot | 6e-19 | |
| 2chd_A | 142 | Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium | 7e-19 | |
| 1wfm_A | 138 | Synaptotagmin XIII; C2 domain, exocytosis, neurotr | 1e-18 | |
| 3fdw_A | 148 | Synaptotagmin-like protein 4; structural genomics, | 2e-18 | |
| 1cjy_A | 749 | CPLA2, protein (cytosolic phospholipase A2); lipid | 8e-18 | |
| 2dmg_A | 142 | KIAA1228 protein; beta-sandwich, structural genomi | 8e-18 | |
| 2b3r_A | 134 | Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA | 9e-18 | |
| 3n5a_A | 138 | Synaptotagmin-7; calcium/phospholipid binding prot | 1e-17 | |
| 3fbk_A | 153 | RGS3, RGP3, regulator of G-protein signaling 3; al | 4e-17 | |
| 1w15_A | 153 | Synaptotagmin IV; metal binding protein, endocytos | 5e-17 | |
| 2enp_A | 147 | B/K protein; C2 type 1,beta sandwich, structural g | 2e-16 | |
| 1tjx_A | 159 | Similar to synaptotagmini/P65; C2B domain, calcium | 2e-16 | |
| 2q3x_A | 171 | Regulating synaptic membrane exocytosis protein 1; | 3e-16 | |
| 2cm5_A | 166 | Rabphilin-3A; protein transport, zinc-finger, Ca2+ | 4e-16 | |
| 2cjt_A | 131 | UNC-13 homolog A, MUNC13-1; phorbol-ester binding, | 4e-16 | |
| 1v27_A | 141 | Regulating synaptic membrane exocytosis protein 2; | 8e-16 | |
| 2bwq_A | 129 | Regulating synaptic membrane exocytosis protein 2; | 9e-16 | |
| 2z0u_A | 155 | WW domain-containing protein 1; C2 domain, alterna | 4e-15 | |
| 2cjs_A | 167 | UNC-13 homolog A, MUNC13-1; neurotransmitter trans | 3e-12 | |
| 3jzy_A | 510 | Intersectin 2; C2 domain, structural genomics cons | 1e-09 | |
| 3l9b_A | 144 | Otoferlin; C2-domain, beta-sheets, cell membrane, | 2e-06 | |
| 1djx_A | 624 | PLC-D1, phosphoinositide-specific phospholipase C, | 2e-05 | |
| 2enj_A | 138 | NPKC-theta, protein kinase C theta type; beta-sand | 1e-04 |
| >2ep6_A MCTP2 protein; beta sandwich, Ca2+ binding, membrane binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.7.1.1 Length = 133 | Back alignment and structure |
|---|
Score = 130 bits (328), Expect = 3e-39
Identities = 30/124 (24%), Positives = 60/124 (48%), Gaps = 8/124 (6%)
Query: 31 GVRRTSLMETLLGLLRIRIKRGVNLAVRDVR-SSDPYVVVKMGKQKLKTRVIKKDVNPEW 89
G +S +G+L++++ + +L D SDP+ ++++G +L+T + K++NPEW
Sbjct: 1 GSSGSSGDVKDVGILQVKVLKAADLLAADFSGKSDPFCLLELGNDRLQTHTVYKNLNPEW 60
Query: 90 NEDLTLSITDPNVPITLTVYDHDLFSKDDRMGDAEFDIKTYIEA-------LKMNLDSLP 142
N+ T I D + + +TV+D D D +G + + + +L+
Sbjct: 61 NKVFTFPIKDIHDVLEVTVFDEDGDKPPDFLGKVAIPLLSIRDGQPNCYVLKNKDLEQAF 120
Query: 143 TGTI 146
G I
Sbjct: 121 KGVI 124
|
| >1wfj_A Putative elicitor-responsive gene; C2 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, plant protein; NMR {Arabidopsis thaliana} SCOP: b.7.1.2 Length = 136 | Back alignment and structure |
|---|
| >2dmh_A Myoferlin; beta-sandwich, FER-1-like protein 3, muscular dystrophy, cardiomyopathy, membrane fusion, dystrophin, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 140 | Back alignment and structure |
|---|
| >2nq3_A Itchy homolog E3 ubiquitin protein ligase; C2 domain, UBL conjugation pathway, structural genomics consortium, SGC; 1.80A {Homo sapiens} SCOP: b.7.1.1 Length = 173 | Back alignment and structure |
|---|
| >3b7y_A E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL-conjugation pathway, structural genomics consortium, SGC, cytoplasm; 1.80A {Homo sapiens} PDB: 2nsq_A Length = 153 | Back alignment and structure |
|---|
| >3m7f_B E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB10, SH2 domain, phosphoprotein, conjugation pathway, signaling protein-ligase complex; 2.00A {Mus musculus} Length = 176 | Back alignment and structure |
|---|
| >1gmi_A Protein kinase C, epsilon type; PKC, C2 domain, X-RAY, phospholipids, PKC epsilon.; 1.7A {Rattus rattus} SCOP: b.7.1.1 Length = 136 | Back alignment and structure |
|---|
| >3kwu_A MUNC13-1; calcium binding protein, phospholipid binding protein, metal binding protein; HET: GOL; 1.37A {Rattus norvegicus} PDB: 3kwt_A* Length = 148 | Back alignment and structure |
|---|
| >3nsj_A Perforin-1; pore forming protein, immune system; HET: NAG; 2.75A {Mus musculus} Length = 540 | Back alignment and structure |
|---|
| >1rlw_A Phospholipase A2, CALB domain; hydrolase, C2 domain; 2.40A {Homo sapiens} SCOP: b.7.1.1 Length = 126 | Back alignment and structure |
|---|
| >1a25_A CALB, protein kinase C (beta); calcium++/phospholipid binding protein, calcium-binding protein; HET: PSE; 2.70A {Rattus norvegicus} SCOP: b.7.1.2 Length = 149 | Back alignment and structure |
|---|
| >2fk9_A Protein kinase C, ETA type; ATP-binding, metal-binding, nucleotide-binding, diacylglycerol binding, serine/threonine-protein kinase, transferase; 1.75A {Homo sapiens} Length = 157 | Back alignment and structure |
|---|
| >3pyc_A E3 ubiquitin-protein ligase smurf1; phospholipid binding, membrane associate, lipid binding PROT; 1.96A {Homo sapiens} PDB: 2jqz_A Length = 132 | Back alignment and structure |
|---|
| >3f04_A Synaptotagmin-1; C2A, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal- binding, palmitate, phosphoprotein; 1.35A {Homo sapiens} PDB: 3f01_A 3f05_A 3f00_A 1byn_A 2k45_A 2k4a_A 2k8m_A 2ki6_A* Length = 143 | Back alignment and structure |
|---|
| >1rsy_A Synaptotagmin I; calcium/phospholipid binding protein; 1.90A {Rattus norvegicus} SCOP: b.7.1.2 Length = 152 | Back alignment and structure |
|---|
| >2d8k_A Synaptotagmin VII; exocytosis, calcium binding, lysosome, C2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 141 | Back alignment and structure |
|---|
| >1ugk_A Synaptotagmin IV, KIAA1342; beta sandwich, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.7.1.2 Length = 138 | Back alignment and structure |
|---|
| >2r83_A Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal-binding palmitate; 2.70A {Homo sapiens} SCOP: b.7.1.2 Length = 284 | Back alignment and structure |
|---|
| >2r83_A Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal-binding palmitate; 2.70A {Homo sapiens} SCOP: b.7.1.2 Length = 284 | Back alignment and structure |
|---|
| >1dqv_A Synaptotagmin III; beta sandwich, calcium ION, C2 domain, endocytosis/exocytosis complex; 3.20A {Rattus rattus} SCOP: b.7.1.2 b.7.1.2 PDB: 3hn8_A Length = 296 | Back alignment and structure |
|---|
| >1dqv_A Synaptotagmin III; beta sandwich, calcium ION, C2 domain, endocytosis/exocytosis complex; 3.20A {Rattus rattus} SCOP: b.7.1.2 b.7.1.2 PDB: 3hn8_A Length = 296 | Back alignment and structure |
|---|
| >1rh8_A Piccolo protein; beta-sandwich, metal binding protein; NMR {Rattus norvegicus} SCOP: b.7.1.2 Length = 142 | Back alignment and structure |
|---|
| >2chd_A Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium binding, synaptic EXOC metal-binding, protein transport, synapse, transport, zinc-; 1.92A {Rattus norvegicus} PDB: 2k3h_A Length = 142 | Back alignment and structure |
|---|
| >1wfm_A Synaptotagmin XIII; C2 domain, exocytosis, neurotransmitter release, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.7.1.2 Length = 138 | Back alignment and structure |
|---|
| >3fdw_A Synaptotagmin-like protein 4; structural genomics, phospholipid binding, alternative splicing, cell membrane, cytoplasmic vesicle, membrane; 2.20A {Homo sapiens} Length = 148 | Back alignment and structure |
|---|
| >1cjy_A CPLA2, protein (cytosolic phospholipase A2); lipid-binding, hydrolase; HET: MES; 2.50A {Homo sapiens} SCOP: b.7.1.1 c.19.1.2 PDB: 1bci_A Length = 749 | Back alignment and structure |
|---|
| >2dmg_A KIAA1228 protein; beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 142 | Back alignment and structure |
|---|
| >2b3r_A Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA containing alpha polypeptide; C2 domain, lipid binding, PI3-kinase, transferase; 2.30A {Mus musculus} Length = 134 | Back alignment and structure |
|---|
| >3n5a_A Synaptotagmin-7; calcium/phospholipid binding protein, protein transport; 1.44A {Mus musculus} Length = 138 | Back alignment and structure |
|---|
| >3fbk_A RGS3, RGP3, regulator of G-protein signaling 3; all beta-sheet fold, structural genomics, PSI-2, protein structure initiative; 2.00A {Homo sapiens} Length = 153 | Back alignment and structure |
|---|
| >1w15_A Synaptotagmin IV; metal binding protein, endocytosis/exocytosis neurotransmitter release, transmembrane; 1.93A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1w16_A Length = 153 | Back alignment and structure |
|---|
| >2enp_A B/K protein; C2 type 1,beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 147 | Back alignment and structure |
|---|
| >1tjx_A Similar to synaptotagmini/P65; C2B domain, calcium binding, endocytosis-EX complex; HET: GOL; 1.04A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1tjm_A* 1uov_A 1uow_A 1k5w_A 2lha_A* Length = 159 | Back alignment and structure |
|---|
| >2q3x_A Regulating synaptic membrane exocytosis protein 1; C2 domain dimer, neurotransmitter release, transport protein; HET: MSE; 1.73A {Rattus norvegicus} Length = 171 | Back alignment and structure |
|---|
| >2cm5_A Rabphilin-3A; protein transport, zinc-finger, Ca2+ binding, metal-binding, synaptic exocytosis, C2A-C2B linker fragment, C2B, zinc, synapse; 1.28A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 2cm6_A 3rpb_A Length = 166 | Back alignment and structure |
|---|
| >2cjt_A UNC-13 homolog A, MUNC13-1; phorbol-ester binding, neurotransmitter release, RIM, MUNC13 domains, exocytosis, metal-binding; 1.44A {Rattus norvegicus} SCOP: b.7.1.1 Length = 131 | Back alignment and structure |
|---|
| >1v27_A Regulating synaptic membrane exocytosis protein 2; RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.7.1.2 Length = 141 | Back alignment and structure |
|---|
| >2bwq_A Regulating synaptic membrane exocytosis protein 2; C2 domain, neurotransmitter release, transport protein; 1.41A {Rattus norvegicus} SCOP: b.7.1.2 Length = 129 | Back alignment and structure |
|---|
| >2z0u_A WW domain-containing protein 1; C2 domain, alternative splicing, coiled coil, cytoplasm, phosphorylation, polymorphism, lipid binding protein; 2.20A {Homo sapiens} Length = 155 | Back alignment and structure |
|---|
| >2cjs_A UNC-13 homolog A, MUNC13-1; neurotransmitter transport, zinc finger, synapto phorbol-ester binding; 1.78A {Rattus norvegicus} SCOP: b.7.1.1 Length = 167 | Back alignment and structure |
|---|
| >3jzy_A Intersectin 2; C2 domain, structural genomics consortium (SGC), endocytosis; 1.56A {Homo sapiens} PDB: 3qbv_B* 1ki1_B Length = 510 | Back alignment and structure |
|---|
| >3l9b_A Otoferlin; C2-domain, beta-sheets, cell membrane, synaptic V hearing, membrane, synapse, transmembrane, membrane protein; 1.95A {Rattus norvegicus} Length = 144 | Back alignment and structure |
|---|
| >1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A Length = 624 | Back alignment and structure |
|---|
| >2enj_A NPKC-theta, protein kinase C theta type; beta-sandwich, phosphotyrosine binding, TCR, T-cell, diacylglycerol, phorbol ester, structural genomics; NMR {Homo sapiens} Length = 138 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 202 | |||
| 1wfj_A | 136 | Putative elicitor-responsive gene; C2 domain, rike | 99.94 | |
| 2fk9_A | 157 | Protein kinase C, ETA type; ATP-binding, metal-bin | 99.93 | |
| 2dmh_A | 140 | Myoferlin; beta-sandwich, FER-1-like protein 3, mu | 99.92 | |
| 1gmi_A | 136 | Protein kinase C, epsilon type; PKC, C2 domain, X- | 99.91 | |
| 2ep6_A | 133 | MCTP2 protein; beta sandwich, Ca2+ binding, membra | 99.91 | |
| 3kwu_A | 148 | MUNC13-1; calcium binding protein, phospholipid bi | 99.91 | |
| 1rlw_A | 126 | Phospholipase A2, CALB domain; hydrolase, C2 domai | 99.9 | |
| 2nq3_A | 173 | Itchy homolog E3 ubiquitin protein ligase; C2 doma | 99.9 | |
| 3m7f_B | 176 | E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB1 | 99.89 | |
| 3b7y_A | 153 | E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL- | 99.89 | |
| 3pyc_A | 132 | E3 ubiquitin-protein ligase smurf1; phospholipid b | 99.88 | |
| 1a25_A | 149 | CALB, protein kinase C (beta); calcium++/phospholi | 99.86 | |
| 2b3r_A | 134 | Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA | 99.86 | |
| 3rdl_A | 137 | Protein kinase C alpha type; protein kinase PKC, t | 99.86 | |
| 3fbk_A | 153 | RGS3, RGP3, regulator of G-protein signaling 3; al | 99.85 | |
| 1rsy_A | 152 | Synaptotagmin I; calcium/phospholipid binding prot | 99.84 | |
| 2d8k_A | 141 | Synaptotagmin VII; exocytosis, calcium binding, ly | 99.84 | |
| 3f04_A | 143 | Synaptotagmin-1; C2A, calcium, cell junction, cyto | 99.84 | |
| 3fdw_A | 148 | Synaptotagmin-like protein 4; structural genomics, | 99.84 | |
| 2z0u_A | 155 | WW domain-containing protein 1; C2 domain, alterna | 99.84 | |
| 1v27_A | 141 | Regulating synaptic membrane exocytosis protein 2; | 99.83 | |
| 2bwq_A | 129 | Regulating synaptic membrane exocytosis protein 2; | 99.83 | |
| 1ugk_A | 138 | Synaptotagmin IV, KIAA1342; beta sandwich, structu | 99.83 | |
| 2chd_A | 142 | Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium | 99.83 | |
| 3jzy_A | 510 | Intersectin 2; C2 domain, structural genomics cons | 99.83 | |
| 2q3x_A | 171 | Regulating synaptic membrane exocytosis protein 1; | 99.82 | |
| 1tjx_A | 159 | Similar to synaptotagmini/P65; C2B domain, calcium | 99.82 | |
| 2cm5_A | 166 | Rabphilin-3A; protein transport, zinc-finger, Ca2+ | 99.82 | |
| 2r83_A | 284 | Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cel | 99.82 | |
| 1rh8_A | 142 | Piccolo protein; beta-sandwich, metal binding prot | 99.81 | |
| 3n5a_A | 138 | Synaptotagmin-7; calcium/phospholipid binding prot | 99.81 | |
| 1wfm_A | 138 | Synaptotagmin XIII; C2 domain, exocytosis, neurotr | 99.81 | |
| 1w15_A | 153 | Synaptotagmin IV; metal binding protein, endocytos | 99.8 | |
| 2enp_A | 147 | B/K protein; C2 type 1,beta sandwich, structural g | 99.8 | |
| 2dmg_A | 142 | KIAA1228 protein; beta-sandwich, structural genomi | 99.79 | |
| 3nsj_A | 540 | Perforin-1; pore forming protein, immune system; H | 99.77 | |
| 1dqv_A | 296 | Synaptotagmin III; beta sandwich, calcium ION, C2 | 99.77 | |
| 3l9b_A | 144 | Otoferlin; C2-domain, beta-sheets, cell membrane, | 99.75 | |
| 2cjt_A | 131 | UNC-13 homolog A, MUNC13-1; phorbol-ester binding, | 99.75 | |
| 2cjs_A | 167 | UNC-13 homolog A, MUNC13-1; neurotransmitter trans | 99.72 | |
| 2r83_A | 284 | Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cel | 99.7 | |
| 1djx_A | 624 | PLC-D1, phosphoinositide-specific phospholipase C, | 99.7 | |
| 1cjy_A | 749 | CPLA2, protein (cytosolic phospholipase A2); lipid | 99.67 | |
| 3bxj_A | 483 | RAS GTPase-activating protein syngap; GTPase activ | 99.64 | |
| 1dqv_A | 296 | Synaptotagmin III; beta sandwich, calcium ION, C2 | 99.61 | |
| 3pfq_A | 674 | PKC-B, PKC-beta, protein kinase C beta type; phosp | 99.55 | |
| 3qr0_A | 816 | Phospholipase C-beta (PLC-beta); PH domain, EF han | 99.43 | |
| 3ohm_B | 885 | 1-phosphatidylinositol-4,5-bisphosphate phosphodi | 99.42 | |
| 1yrk_A | 126 | NPKC-delta, protein kinase C, delta type; C2 domai | 99.41 | |
| 2zkm_X | 799 | 1-phosphatidylinositol-4,5-bisphosphate phosphodie | 99.38 | |
| 2enj_A | 138 | NPKC-theta, protein kinase C theta type; beta-sand | 99.36 | |
| 2yrb_A | 156 | Protein fantom; beta sandwich, NPPSFA, national pr | 94.37 | |
| 2wxf_A | 940 | Phosphatidylinositol-4,5-bisphosphate 3-kinase Ca | 94.02 | |
| 3hhm_A | 1091 | Phosphatidylinositol-4,5-bisphosphate 3-kinase cat | 93.46 | |
| 3l4c_A | 220 | Dedicator of cytokinesis protein 1; DOCK180, DOCK1 | 92.81 | |
| 1e7u_A | 961 | Phosphatidylinositol 3-kinase catalytic subunit; p | 90.25 | |
| 2y3a_A | 1092 | Phosphatidylinositol-4,5-bisphosphate 3-kinase Ca | 83.1 |
| >1wfj_A Putative elicitor-responsive gene; C2 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, plant protein; NMR {Arabidopsis thaliana} SCOP: b.7.1.2 | Back alignment and structure |
|---|
Probab=99.94 E-value=4.2e-25 Score=159.68 Aligned_cols=127 Identities=21% Similarity=0.374 Sum_probs=112.2
Q ss_pred cccceEEEEEEEEeecCCCCC-CCCCCcEEEEEECCeEEeceeec-CCCCCeEeeeeEEEEeCCCCcEEEEEEecCCCCC
Q 028875 39 ETLLGLLRIRIKRGVNLAVRD-VRSSDPYVVVKMGKQKLKTRVIK-KDVNPEWNEDLTLSITDPNVPITLTVYDHDLFSK 116 (202)
Q Consensus 39 ~~~~g~L~v~v~~a~~L~~~~-~~~~dpyv~v~~~~~~~~T~~~~-~t~~P~w~e~f~f~v~~~~~~L~i~V~d~~~~~~ 116 (202)
....|.|.|+|++|++|+..+ .+.+||||++++++.+++|++++ ++.||.|||+|.|.+......|.|+|||++.+++
T Consensus 6 ~~~~~~L~v~v~~a~~L~~~d~~g~~dpyv~v~~~~~~~kT~~~~~~~~nP~Wne~f~f~v~~~~~~l~~~V~d~~~~~~ 85 (136)
T 1wfj_A 6 SGPHGTLEVVLVSAKGLEDADFLNNMDPYVQLTCRTQDQKSNVAEGMGTTPEWNETFIFTVSEGTTELKAKIFDKDVGTE 85 (136)
T ss_dssp CCCEEEEEEEEEEEEECSSCCSSCSSCCCEEEESSSCEEECCCCTTCCSSCEEEEEEEEEEESSCCEEEEEECCSSSCTT
T ss_pred CCCcEEEEEEEEeccCCCCcccCCCcCceEEEEECCccceeEeccCCCCCCccCcEEEEEECCCCCEEEEEEEECCCCCC
Confidence 346799999999999999998 78999999999999899999998 8999999999999999866779999999999989
Q ss_pred CCccEEEEEehHhHHHHhcCCcccCCCceEEEEEeeCCCCccCCCceeEeeCCcEEEEEEEEec--ccceeeEEEEEEEE
Q 028875 117 DDRMGDAEFDIKTYIEALKMNLDSLPTGTIISRVMPSRHNCLSEQSCVVWKEGKVVQDLVLRLR--NVECGELEIQLQWI 194 (202)
Q Consensus 117 d~~lG~~~i~l~~l~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~l~--~~~~G~i~l~l~~~ 194 (202)
|++||++.++|.++..... ..+.|++|. ....|+|+|.++|.
T Consensus 86 d~~lG~~~i~l~~l~~~~~------------------------------------~~~~w~~L~~~~~~~G~i~l~l~~~ 129 (136)
T 1wfj_A 86 DDAVGEATIPLEPVFVEGS------------------------------------IPPTAYNVVKDEEYKGEIWVALSFK 129 (136)
T ss_dssp TCCSEEEEEESHHHHHHSE------------------------------------EEEEEEEEEETTEEEEEEEEEEEEE
T ss_pred CceEEEEEEEHHHhccCCC------------------------------------CCcEEEEeecCCccCEEEEEEEEEE
Confidence 9999999999999965421 347788885 34589999999999
Q ss_pred eCCCCCC
Q 028875 195 DLPGSKG 201 (202)
Q Consensus 195 ~~~~~~~ 201 (202)
+...+.|
T Consensus 130 p~~~~~g 136 (136)
T 1wfj_A 130 PSGPSSG 136 (136)
T ss_dssp ECCSCCC
T ss_pred eCCCCCC
Confidence 9988776
|
| >2fk9_A Protein kinase C, ETA type; ATP-binding, metal-binding, nucleotide-binding, diacylglycerol binding, serine/threonine-protein kinase, transferase; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >2dmh_A Myoferlin; beta-sandwich, FER-1-like protein 3, muscular dystrophy, cardiomyopathy, membrane fusion, dystrophin, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1gmi_A Protein kinase C, epsilon type; PKC, C2 domain, X-RAY, phospholipids, PKC epsilon.; 1.7A {Rattus rattus} SCOP: b.7.1.1 | Back alignment and structure |
|---|
| >2ep6_A MCTP2 protein; beta sandwich, Ca2+ binding, membrane binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.7.1.1 | Back alignment and structure |
|---|
| >3kwu_A MUNC13-1; calcium binding protein, phospholipid binding protein, metal binding protein; HET: GOL; 1.37A {Rattus norvegicus} SCOP: b.7.1.0 PDB: 3kwt_A* | Back alignment and structure |
|---|
| >1rlw_A Phospholipase A2, CALB domain; hydrolase, C2 domain; 2.40A {Homo sapiens} SCOP: b.7.1.1 | Back alignment and structure |
|---|
| >2nq3_A Itchy homolog E3 ubiquitin protein ligase; C2 domain, UBL conjugation pathway, structural genomics consortium, SGC; 1.80A {Homo sapiens} SCOP: b.7.1.1 | Back alignment and structure |
|---|
| >3m7f_B E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB10, SH2 domain, phosphoprotein, conjugation pathway, signaling protein-ligase complex; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >3b7y_A E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL-conjugation pathway, structural genomics consortium, SGC, cytoplasm; 1.80A {Homo sapiens} PDB: 2nsq_A | Back alignment and structure |
|---|
| >3pyc_A E3 ubiquitin-protein ligase smurf1; phospholipid binding, membrane associate, lipid binding PROT; 1.96A {Homo sapiens} PDB: 2jqz_A | Back alignment and structure |
|---|
| >1a25_A CALB, protein kinase C (beta); calcium++/phospholipid binding protein, calcium-binding protein; HET: PSE; 2.70A {Rattus norvegicus} SCOP: b.7.1.2 | Back alignment and structure |
|---|
| >2b3r_A Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA containing alpha polypeptide; C2 domain, lipid binding, PI3-kinase, transferase; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >3fbk_A RGS3, RGP3, regulator of G-protein signaling 3; all beta-sheet fold, structural genomics, PSI-2, protein structure initiative; 2.00A {Homo sapiens} SCOP: b.7.1.0 | Back alignment and structure |
|---|
| >1rsy_A Synaptotagmin I; calcium/phospholipid binding protein; 1.90A {Rattus norvegicus} SCOP: b.7.1.2 | Back alignment and structure |
|---|
| >2d8k_A Synaptotagmin VII; exocytosis, calcium binding, lysosome, C2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3f04_A Synaptotagmin-1; C2A, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal- binding, palmitate, phosphoprotein; 1.35A {Homo sapiens} SCOP: b.7.1.2 PDB: 3f01_A 3f05_A 3f00_A 1byn_A 2k45_A 2k4a_A 2k8m_A 2ki6_A* | Back alignment and structure |
|---|
| >3fdw_A Synaptotagmin-like protein 4; structural genomics, phospholipid binding, alternative splicing, cell membrane, cytoplasmic vesicle, membrane; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2z0u_A WW domain-containing protein 1; C2 domain, alternative splicing, coiled coil, cytoplasm, phosphorylation, polymorphism, lipid binding protein; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1v27_A Regulating synaptic membrane exocytosis protein 2; RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.7.1.2 | Back alignment and structure |
|---|
| >2bwq_A Regulating synaptic membrane exocytosis protein 2; C2 domain, neurotransmitter release, transport protein; 1.41A {Rattus norvegicus} SCOP: b.7.1.2 | Back alignment and structure |
|---|
| >1ugk_A Synaptotagmin IV, KIAA1342; beta sandwich, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.7.1.2 | Back alignment and structure |
|---|
| >2chd_A Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium binding, synaptic EXOC metal-binding, protein transport, synapse, transport, zinc-; 1.92A {Rattus norvegicus} PDB: 2k3h_A | Back alignment and structure |
|---|
| >3jzy_A Intersectin 2; C2 domain, structural genomics consortium (SGC), endocytosis; 1.56A {Homo sapiens} PDB: 3qbv_B* 1ki1_B | Back alignment and structure |
|---|
| >2q3x_A Regulating synaptic membrane exocytosis protein 1; C2 domain dimer, neurotransmitter release, transport protein; HET: MSE; 1.73A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1tjx_A Similar to synaptotagmini/P65; C2B domain, calcium binding, endocytosis-EX complex; HET: GOL; 1.04A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1tjm_A* 1uov_A 1uow_A 1k5w_A 2lha_A* | Back alignment and structure |
|---|
| >2cm5_A Rabphilin-3A; protein transport, zinc-finger, Ca2+ binding, metal-binding, synaptic exocytosis, C2A-C2B linker fragment, C2B, zinc, synapse; 1.28A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 2cm6_A 3rpb_A | Back alignment and structure |
|---|
| >2r83_A Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal-binding palmitate; 2.70A {Homo sapiens} SCOP: b.7.1.2 | Back alignment and structure |
|---|
| >1rh8_A Piccolo protein; beta-sandwich, metal binding protein; NMR {Rattus norvegicus} SCOP: b.7.1.2 | Back alignment and structure |
|---|
| >3n5a_A Synaptotagmin-7; calcium/phospholipid binding protein, protein transport; 1.44A {Mus musculus} | Back alignment and structure |
|---|
| >1wfm_A Synaptotagmin XIII; C2 domain, exocytosis, neurotransmitter release, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.7.1.2 | Back alignment and structure |
|---|
| >1w15_A Synaptotagmin IV; metal binding protein, endocytosis/exocytosis neurotransmitter release, transmembrane; 1.93A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1w16_A | Back alignment and structure |
|---|
| >2enp_A B/K protein; C2 type 1,beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dmg_A KIAA1228 protein; beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3nsj_A Perforin-1; pore forming protein, immune system; HET: NAG; 2.75A {Mus musculus} | Back alignment and structure |
|---|
| >1dqv_A Synaptotagmin III; beta sandwich, calcium ION, C2 domain, endocytosis/exocytosis complex; 3.20A {Rattus rattus} SCOP: b.7.1.2 b.7.1.2 PDB: 3hn8_A | Back alignment and structure |
|---|
| >3l9b_A Otoferlin; C2-domain, beta-sheets, cell membrane, synaptic V hearing, membrane, synapse, transmembrane, membrane protein; 1.95A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2cjt_A UNC-13 homolog A, MUNC13-1; phorbol-ester binding, neurotransmitter release, RIM, MUNC13 domains, exocytosis, metal-binding; 1.44A {Rattus norvegicus} SCOP: b.7.1.1 | Back alignment and structure |
|---|
| >2cjs_A UNC-13 homolog A, MUNC13-1; neurotransmitter transport, zinc finger, synapto phorbol-ester binding; 1.78A {Rattus norvegicus} SCOP: b.7.1.1 | Back alignment and structure |
|---|
| >2r83_A Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal-binding palmitate; 2.70A {Homo sapiens} SCOP: b.7.1.2 | Back alignment and structure |
|---|
| >1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A | Back alignment and structure |
|---|
| >1cjy_A CPLA2, protein (cytosolic phospholipase A2); lipid-binding, hydrolase; HET: MES; 2.50A {Homo sapiens} SCOP: b.7.1.1 c.19.1.2 PDB: 1bci_A | Back alignment and structure |
|---|
| >3bxj_A RAS GTPase-activating protein syngap; GTPase activation, membrane, phosphoprotein, SH3-binding, signaling protein; 3.00A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1dqv_A Synaptotagmin III; beta sandwich, calcium ION, C2 domain, endocytosis/exocytosis complex; 3.20A {Rattus rattus} SCOP: b.7.1.2 b.7.1.2 PDB: 3hn8_A | Back alignment and structure |
|---|
| >3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A | Back alignment and structure |
|---|
| >3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A | Back alignment and structure |
|---|
| >3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1yrk_A NPKC-delta, protein kinase C, delta type; C2 domain, protein binding; HET: PTR; 1.70A {Homo sapiens} PDB: 1bdy_A | Back alignment and structure |
|---|
| >2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B | Back alignment and structure |
|---|
| >2enj_A NPKC-theta, protein kinase C theta type; beta-sandwich, phosphotyrosine binding, TCR, T-cell, diacylglycerol, phorbol ester, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yrb_A Protein fantom; beta sandwich, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.7.1.1 | Back alignment and structure |
|---|
| >2wxf_A Phosphatidylinositol-4,5-bisphosphate 3-kinase Ca subunit delta isoform; transferase, phosphoprotein, isoform-specific inhibitors; HET: 039; 1.90A {Mus musculus} PDB: 2wxg_A* 2wxh_A* 2wxi_A* 2wxj_A* 2wxk_A* 2wxl_A* 2wxm_A* 2wxn_A* 2wxo_A* 2wxp_A* 2wxq_A* 2wxr_A 2x38_A* | Back alignment and structure |
|---|
| >3hhm_A Phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha isoform; PI3KCA, PI3K, PIK3R1, phosphatidilynositol 3,4,5- triphosphate, wortmannin, H1047R, ATP-binding, disease mutation, kinase; HET: KWT; 2.80A {Homo sapiens} PDB: 3hiz_A 2rd0_A 4a55_A* 2enq_A | Back alignment and structure |
|---|
| >3l4c_A Dedicator of cytokinesis protein 1; DOCK180, DOCK1, phosphoinositide specificity, guanine exchan factor, RHO GTPase, cytoskeleton, cell migration; 2.37A {Homo sapiens} | Back alignment and structure |
|---|
| >2y3a_A Phosphatidylinositol-4,5-bisphosphate 3-kinase Ca subunit beta isoform; transferase, phosphoinositide 3-kinase, RTK; HET: GD9; 3.30A {Mus musculus} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 202 | ||||
| d2cjta1 | 128 | b.7.1.1 (A:1-128) Unc-13 homolog A {Rat (Rattus no | 5e-18 | |
| d1wfja_ | 136 | b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cr | 1e-16 | |
| d1a25a_ | 132 | b.7.1.2 (A:) C2 domain from protein kinase c (beta | 1e-15 | |
| d2ep6a1 | 126 | b.7.1.1 (A:92-217) Multiple C2 and transmembrane d | 2e-14 | |
| d2bwqa1 | 125 | b.7.1.2 (A:729-853) Regulating synaptic membrane e | 2e-14 | |
| d1ugka_ | 138 | b.7.1.2 (A:) Synaptotagmin IV {Human (Homo sapiens | 7e-14 | |
| d1rsya_ | 143 | b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicu | 1e-13 | |
| d1w15a_ | 138 | b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegi | 2e-13 | |
| d2cm5a1 | 137 | b.7.1.2 (A:541-677) C2b-domain of rabphilin {Rat ( | 5e-13 | |
| d1qasa2 | 131 | b.7.1.1 (A:626-756) PI-specific phospholipase C is | 7e-13 | |
| d2nq3a1 | 133 | b.7.1.1 (A:13-145) E3 ubiquitin-protein ligase Itc | 7e-12 | |
| d1rh8a_ | 142 | b.7.1.2 (A:) Piccolo {Rat (Rattus norvegicus) [Tax | 6e-11 | |
| d1uowa_ | 157 | b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicu | 2e-10 | |
| d1gmia_ | 136 | b.7.1.1 (A:) Domain from protein kinase C epsilon | 2e-10 | |
| d1rlwa_ | 126 | b.7.1.1 (A:) Domain from cytosolic phospholipase A | 4e-10 | |
| d1dqva2 | 145 | b.7.1.2 (A:425-569) Synaptotagmin III {Rat (Rattus | 4e-10 | |
| d1dqva1 | 130 | b.7.1.2 (A:295-424) Synaptotagmin III {Rat (Rattus | 4e-09 | |
| d1wfma_ | 138 | b.7.1.2 (A:) Synaptotagmin XIII {Human (Homo sapie | 1e-07 | |
| d1bdya_ | 123 | b.7.1.1 (A:) Domain from protein kinase C delta {R | 1e-06 | |
| d2zkmx2 | 122 | b.7.1.1 (X:678-799) Phospholipase C-beta-2 {Human | 1e-05 |
| >d2cjta1 b.7.1.1 (A:1-128) Unc-13 homolog A {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 128 | Back information, alignment and structure |
|---|
class: All beta proteins fold: C2 domain-like superfamily: C2 domain (Calcium/lipid-binding domain, CaLB) family: PLC-like (P variant) domain: Unc-13 homolog A species: Rat (Rattus norvegicus) [TaxId: 10116]
Score = 74.4 bits (182), Expect = 5e-18
Identities = 24/128 (18%), Positives = 51/128 (39%), Gaps = 13/128 (10%)
Query: 42 LGLLRIRIKRGVNLAVRDVRSSDPYVVVKMGKQKLKTRVIKKDVNPEWNEDLTLSITDPN 101
+ LL + +K+ ++ + YV +K+ K T ++ P W +D I +
Sbjct: 1 MSLLCVGVKKAKFDGAQE--KFNTYVTLKVQNVKSTTIAVRGS-QPSWEQDFMFEINRLD 57
Query: 102 VPITLTVYDHDLFSKDDRMGDAEFDIKTYIEALKM------NLDS---LPTGTIISRVMP 152
+ +T+ V++ D +G ++T ++ + LDS + I P
Sbjct: 58 LGLTVEVWNKG-LIWDTMVGTVWIPLRTIRQSNEEGPGEWLTLDSQAIMADSEICGTKDP 116
Query: 153 SRHNCLSE 160
+ H L +
Sbjct: 117 TFHRILLD 124
|
| >d1wfja_ b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 136 | Back information, alignment and structure |
|---|
| >d1a25a_ b.7.1.2 (A:) C2 domain from protein kinase c (beta) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 132 | Back information, alignment and structure |
|---|
| >d2ep6a1 b.7.1.1 (A:92-217) Multiple C2 and transmembrane domain-containing protein 2, MCTP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 126 | Back information, alignment and structure |
|---|
| >d2bwqa1 b.7.1.2 (A:729-853) Regulating synaptic membrane exocytosis protein, rim2 {Human (Homo sapiens) [TaxId: 9606]} Length = 125 | Back information, alignment and structure |
|---|
| >d1ugka_ b.7.1.2 (A:) Synaptotagmin IV {Human (Homo sapiens) [TaxId: 9606]} Length = 138 | Back information, alignment and structure |
|---|
| >d1rsya_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 143 | Back information, alignment and structure |
|---|
| >d1w15a_ b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 138 | Back information, alignment and structure |
|---|
| >d2cm5a1 b.7.1.2 (A:541-677) C2b-domain of rabphilin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 137 | Back information, alignment and structure |
|---|
| >d1qasa2 b.7.1.1 (A:626-756) PI-specific phospholipase C isozyme D1 (PLC-D1), C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 131 | Back information, alignment and structure |
|---|
| >d2nq3a1 b.7.1.1 (A:13-145) E3 ubiquitin-protein ligase Itchy {Human (Homo sapiens) [TaxId: 9606]} Length = 133 | Back information, alignment and structure |
|---|
| >d1rh8a_ b.7.1.2 (A:) Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 142 | Back information, alignment and structure |
|---|
| >d1uowa_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 157 | Back information, alignment and structure |
|---|
| >d1gmia_ b.7.1.1 (A:) Domain from protein kinase C epsilon {Rat (Rattus rattus) [TaxId: 10117]} Length = 136 | Back information, alignment and structure |
|---|
| >d1rlwa_ b.7.1.1 (A:) Domain from cytosolic phospholipase A2 {Human (Homo sapiens) [TaxId: 9606]} Length = 126 | Back information, alignment and structure |
|---|
| >d1dqva2 b.7.1.2 (A:425-569) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 145 | Back information, alignment and structure |
|---|
| >d1dqva1 b.7.1.2 (A:295-424) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 130 | Back information, alignment and structure |
|---|
| >d1wfma_ b.7.1.2 (A:) Synaptotagmin XIII {Human (Homo sapiens) [TaxId: 9606]} Length = 138 | Back information, alignment and structure |
|---|
| >d1bdya_ b.7.1.1 (A:) Domain from protein kinase C delta {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 123 | Back information, alignment and structure |
|---|
| >d2zkmx2 b.7.1.1 (X:678-799) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 122 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 202 | |||
| d1wfja_ | 136 | C2 domain protein At1g63220 {Thale cress (Arabidop | 99.94 | |
| d2ep6a1 | 126 | Multiple C2 and transmembrane domain-containing pr | 99.93 | |
| d1rlwa_ | 126 | Domain from cytosolic phospholipase A2 {Human (Hom | 99.91 | |
| d1gmia_ | 136 | Domain from protein kinase C epsilon {Rat (Rattus | 99.91 | |
| d2nq3a1 | 133 | E3 ubiquitin-protein ligase Itchy {Human (Homo sap | 99.9 | |
| d1a25a_ | 132 | C2 domain from protein kinase c (beta) {Rat (Rattu | 99.87 | |
| d2cjta1 | 128 | Unc-13 homolog A {Rat (Rattus norvegicus) [TaxId: | 99.85 | |
| d1qasa2 | 131 | PI-specific phospholipase C isozyme D1 (PLC-D1), C | 99.84 | |
| d1rsya_ | 143 | Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10 | 99.83 | |
| d1rh8a_ | 142 | Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]} | 99.8 | |
| d1dqva1 | 130 | Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: | 99.8 | |
| d2bwqa1 | 125 | Regulating synaptic membrane exocytosis protein, r | 99.79 | |
| d2cm5a1 | 137 | C2b-domain of rabphilin {Rat (Rattus norvegicus) [ | 99.79 | |
| d1ugka_ | 138 | Synaptotagmin IV {Human (Homo sapiens) [TaxId: 960 | 99.77 | |
| d1uowa_ | 157 | Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10 | 99.77 | |
| d1bdya_ | 123 | Domain from protein kinase C delta {Rat (Rattus no | 99.76 | |
| d1wfma_ | 138 | Synaptotagmin XIII {Human (Homo sapiens) [TaxId: 9 | 99.75 | |
| d1w15a_ | 138 | Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: | 99.75 | |
| d1dqva2 | 145 | Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: | 99.68 | |
| d2zkmx2 | 122 | Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI | 99.59 | |
| d1e7ua2 | 174 | Phoshoinositide 3-kinase (PI3K) {Pig (Sus scrofa) | 95.76 | |
| d2yrba1 | 142 | Fantom {Human (Homo sapiens) [TaxId: 9606]} | 91.8 |
| >d1wfja_ b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: C2 domain-like superfamily: C2 domain (Calcium/lipid-binding domain, CaLB) family: Synaptotagmin-like (S variant) domain: C2 domain protein At1g63220 species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]
Probab=99.94 E-value=9e-26 Score=161.78 Aligned_cols=128 Identities=21% Similarity=0.368 Sum_probs=110.1
Q ss_pred ccccceEEEEEEEEeecCCCCC-CCCCCcEEEEEECCeEEeceeecC-CCCCeEeeeeEEEEeCCCCcEEEEEEecCCCC
Q 028875 38 METLLGLLRIRIKRGVNLAVRD-VRSSDPYVVVKMGKQKLKTRVIKK-DVNPEWNEDLTLSITDPNVPITLTVYDHDLFS 115 (202)
Q Consensus 38 ~~~~~g~L~v~v~~a~~L~~~~-~~~~dpyv~v~~~~~~~~T~~~~~-t~~P~w~e~f~f~v~~~~~~L~i~V~d~~~~~ 115 (202)
...+.|.|.|+|++|++|+..+ .+.+||||+++++...++|+++++ +.||.|||+|.|.+.+....|.|+|||++.++
T Consensus 5 ~~~p~G~L~V~v~~a~~L~~~d~~g~~Dpyv~v~~~~~~~~t~~~~~~~~nP~Wne~f~f~v~~~~~~L~v~V~d~d~~~ 84 (136)
T d1wfja_ 5 SSGPHGTLEVVLVSAKGLEDADFLNNMDPYVQLTCRTQDQKSNVAEGMGTTPEWNETFIFTVSEGTTELKAKIFDKDVGT 84 (136)
T ss_dssp CCCCEEEEEEEEEEEEECSSCCSSCSSCCCEEEESSSCEEECCCCTTCCSSCEEEEEEEEEEESSCCEEEEEECCSSSCT
T ss_pred CCCCcEEEEEEEEEeeCCCCCCCCCCCCccEEEEEeeeeEEEEEEecCCCcEEEeeEEEEEEcCccceEEEEEEEecCCC
Confidence 3456799999999999999998 789999999999999999998875 79999999999999987777999999999998
Q ss_pred CCCccEEEEEehHhHHHHhcCCcccCCCceEEEEEeeCCCCccCCCceeEeeCCcEEEEEEEEecc--cceeeEEEEEEE
Q 028875 116 KDDRMGDAEFDIKTYIEALKMNLDSLPTGTIISRVMPSRHNCLSEQSCVVWKEGKVVQDLVLRLRN--VECGELEIQLQW 193 (202)
Q Consensus 116 ~d~~lG~~~i~l~~l~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~l~~--~~~G~i~l~l~~ 193 (202)
+|++||++.|+|.++..... ....|+.+.. ...|+|+|.++|
T Consensus 85 ~d~~iG~~~i~L~~l~~~~~------------------------------------~~~~~~~l~~~~~~~G~i~l~l~~ 128 (136)
T d1wfja_ 85 EDDAVGEATIPLEPVFVEGS------------------------------------IPPTAYNVVKDEEYKGEIWVALSF 128 (136)
T ss_dssp TTCCSEEEEEESHHHHHHSE------------------------------------EEEEEEEEEETTEEEEEEEEEEEE
T ss_pred CCCEEEEEEEEhHHhcccCC------------------------------------cCcEEEEecCCCccCEEEEEEEEE
Confidence 99999999999999876421 3356777643 347999999999
Q ss_pred EeCCCCCC
Q 028875 194 IDLPGSKG 201 (202)
Q Consensus 194 ~~~~~~~~ 201 (202)
.|...+.|
T Consensus 129 ~p~~p~~g 136 (136)
T d1wfja_ 129 KPSGPSSG 136 (136)
T ss_dssp EECCSCCC
T ss_pred EeCCCCCC
Confidence 99776655
|
| >d2ep6a1 b.7.1.1 (A:92-217) Multiple C2 and transmembrane domain-containing protein 2, MCTP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rlwa_ b.7.1.1 (A:) Domain from cytosolic phospholipase A2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gmia_ b.7.1.1 (A:) Domain from protein kinase C epsilon {Rat (Rattus rattus) [TaxId: 10117]} | Back information, alignment and structure |
|---|
| >d2nq3a1 b.7.1.1 (A:13-145) E3 ubiquitin-protein ligase Itchy {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a25a_ b.7.1.2 (A:) C2 domain from protein kinase c (beta) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2cjta1 b.7.1.1 (A:1-128) Unc-13 homolog A {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1qasa2 b.7.1.1 (A:626-756) PI-specific phospholipase C isozyme D1 (PLC-D1), C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1rsya_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1rh8a_ b.7.1.2 (A:) Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1dqva1 b.7.1.2 (A:295-424) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2bwqa1 b.7.1.2 (A:729-853) Regulating synaptic membrane exocytosis protein, rim2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cm5a1 b.7.1.2 (A:541-677) C2b-domain of rabphilin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ugka_ b.7.1.2 (A:) Synaptotagmin IV {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uowa_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1bdya_ b.7.1.1 (A:) Domain from protein kinase C delta {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1wfma_ b.7.1.2 (A:) Synaptotagmin XIII {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w15a_ b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1dqva2 b.7.1.2 (A:425-569) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2zkmx2 b.7.1.1 (X:678-799) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2yrba1 b.7.1.1 (A:596-737) Fantom {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|