Citrus Sinensis ID: 028888

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200--
MGVEKLIASKMMLPGSNRRIHSVHRHSGMAVAGLAADGRQIVTRAKSEATNYESVYGEPIPVKELAQRVASYVHLCTLYWWLRPFGCGVILGGYDRDGPQLYMIEPSGISYRYFGAAIGKGRQAAKTEIEKLKLSEMTCRQGVIEVAKIIYGVHDEAKDKAFELEMSWVCDESNRQHQKVPDELLEEAKAAARAALEEMDAD
cccccccccccccccccccEEEEcccEEEEEccccccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHccccccccEEEEEEEEEccccEEEEEccccccccccEEEEccccHHHHHHHHHHccccccHHHHHHHHHHHHHHHHccccccccEEEEEEEEEccccEEEEccHHHHHHHHHHHHHHHHHHccc
ccEEEEcccccEccccccccEEEcccEEEEEEEcHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHccccccEccccEEEEEEEEEccEEEEEEEcccccEEEEcEEEEcccHHHHHHHHHHHccccccHHHHHHHHHHHHHHHccccccccccEEEEEEEcccccEEEEccHHHHHHHHHHHHHHHHHcccc
MGVEKLIASKmmlpgsnrrihsvhrhsgmavaglAADGRQIVTRAKSEatnyesvygepipvKELAQRVASYVHLCTLYWwlrpfgcgvilggydrdgpqlymiepsgisYRYFGAAIGKGRQAAKTEIEKLKLSEMTCRQGVIEVAKIIYGVHDEAKDKAFELEMSWVcdesnrqhqkvPDELLEEAKAAARAALEEMDAD
MGVEKLIASKMMLPGSNRRIHSVHRHSGMAVAGLAADGRQIVTRAKSeatnyesvygepipVKELAQRVASYVHLCTLYWWLRPFGCGVILGGYDRDGPQLYMIEPSGISYRYFGAAIGKGRQAAKTEIEKLklsemtcrqGVIEVAKIIYGVHDEAKDKAFELEMSWVCDESNRQHQKVPDELLEEAKAAARAALEEMDAD
MGVEKLIASKMMLPGSNRRIHSVHRHSGMAVAGLAADGRQIVTRAKSEATNYESVYGEPIPVKELAQRVASYVHLCTLYWWLRPFGCGVILGGYDRDGPQLYMIEPSGISYRYFGAAIGKGRQAAKTEIEKLKLSEMTCRQGVIEVAKIIYGVHDEAKDKAFELEMSWVCDESNRQHQKVPdelleeakaaaraaleemdad
****************************MAVAGLAADGRQIVTRAKSEATNYESVYGEPIPVKELAQRVASYVHLCTLYWWLRPFGCGVILGGYDRDGPQLYMIEPSGISYRYFGAAIGKGRQAAKTEIEKLKLSEMTCRQGVIEVAKIIYGVHDEAKDKAFELEMSWVC********************************
MGVEKLIASKMMLPGSNRRIHSVHRHSGMAVAGLAADGRQIVTRAKSEATNYESVYGEPIPVKELAQRVASYVHLCTLYWWLRPFGCGVILGGYDRDGPQLYMIEPSGISYRYFGAAIGKGRQAAKTEIEKLKLSEMTCRQGVIEVAKIIYGVHDEAKDKAFELEMSWVCDESNRQHQKVPDELLEEAKAA***********
MGVEKLIASKMMLPGSNRRIHSVHRHSGMAVAGLAADGRQIVTRAKSEATNYESVYGEPIPVKELAQRVASYVHLCTLYWWLRPFGCGVILGGYDRDGPQLYMIEPSGISYRYFGAAIGKGRQAAKTEIEKLKLSEMTCRQGVIEVAKIIYGVHDEAKDKAFELEMSWVCDESNRQHQKVPDELLEEAKAAA**********
MGVEKLIASKMMLPGSNRRIHSVHRHSGMAVAGLAADGRQIVTRAKSEATNYESVYGEPIPVKELAQRVASYVHLCTLYWWLRPFGCGVILGGYDRDGPQLYMIEPSGISYRYFGAAIGKGRQAAKTEIEKLKLSEMTCRQGVIEVAKIIYGVHDEAKDKAFELEMSWVCDESNRQHQKVPDELLEEAKAAARAALE*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGVEKLIASKMMLPGSNRRIHSVHRHSGMAVAGLAADGRQIVTRAKSEATNYESVYGEPIPVKELAQRVASYVHLCTLYWWLRPFGCGVILGGYDRDGPQLYMIEPSGISYRYFGAAIGKGRQAAKTEIEKLKLSEMTCRQGVIEVAKIIYGVHDEAKDKAFELEMSWVCDESNRQHQKVPDELLEEAKAAARAALEEMDAD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query202 2.2.26 [Sep-21-2011]
O23715249 Proteasome subunit alpha yes no 1.0 0.811 0.886 1e-106
O24362249 Proteasome subunit alpha N/A no 1.0 0.811 0.915 1e-105
Q9LSU0249 Proteasome subunit alpha yes no 1.0 0.811 0.871 1e-105
Q27563248 Proteasome subunit alpha yes no 0.990 0.806 0.575 2e-69
P90513252 Proteasome subunit alpha N/A no 0.970 0.777 0.617 2e-68
P25788255 Proteasome subunit alpha yes no 0.990 0.784 0.597 7e-63
Q58DU5255 Proteasome subunit alpha yes no 0.990 0.784 0.597 8e-63
P18422255 Proteasome subunit alpha yes no 0.990 0.784 0.592 4e-62
O70435255 Proteasome subunit alpha yes no 0.990 0.784 0.592 4e-62
O59770253 Probable proteasome subun yes no 0.955 0.762 0.481 1e-49
>sp|O23715|PSA3_ARATH Proteasome subunit alpha type-3 OS=Arabidopsis thaliana GN=PAG1 PE=1 SV=2 Back     alignment and function desciption
 Score =  382 bits (982), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 179/202 (88%), Positives = 194/202 (96%)

Query: 1   MGVEKLIASKMMLPGSNRRIHSVHRHSGMAVAGLAADGRQIVTRAKSEATNYESVYGEPI 60
           MGVEKLIASKMMLPGSNRRIHSVHRH+GMAVAGLAADGRQIV RAKSEA +YESVYG+ +
Sbjct: 48  MGVEKLIASKMMLPGSNRRIHSVHRHAGMAVAGLAADGRQIVARAKSEARSYESVYGDAV 107

Query: 61  PVKELAQRVASYVHLCTLYWWLRPFGCGVILGGYDRDGPQLYMIEPSGISYRYFGAAIGK 120
           PVKEL++RVASYVHLCTLYWWLRPFGCGVILGGYDRDGPQLYMIEPSGISYRYFGAAIGK
Sbjct: 108 PVKELSERVASYVHLCTLYWWLRPFGCGVILGGYDRDGPQLYMIEPSGISYRYFGAAIGK 167

Query: 121 GRQAAKTEIEKLKLSEMTCRQGVIEVAKIIYGVHDEAKDKAFELEMSWVCDESNRQHQKV 180
           G+QAAKTEIEKL LSEMTC++GVIEVAKIIY +HDEAKDKAFELEMSW+C+ES R+HQKV
Sbjct: 168 GKQAAKTEIEKLNLSEMTCKEGVIEVAKIIYKLHDEAKDKAFELEMSWICEESKREHQKV 227

Query: 181 PDELLEEAKAAARAALEEMDAD 202
           PD+LLEEAK AA+ ALEEMDAD
Sbjct: 228 PDDLLEEAKTAAKTALEEMDAD 249
The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity.
Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 4EC: .EC: 2EC: 5EC: .EC: 1
>sp|O24362|PSA3_SPIOL Proteasome subunit alpha type-3 OS=Spinacia oleracea GN=PAG1 PE=2 SV=1 Back     alignment and function description
>sp|Q9LSU0|PSA3_ORYSJ Proteasome subunit alpha type-3 OS=Oryza sativa subsp. japonica GN=PAG1 PE=2 SV=1 Back     alignment and function description
>sp|Q27563|PSA3_DICDI Proteasome subunit alpha type-3 OS=Dictyostelium discoideum GN=psmA3 PE=2 SV=2 Back     alignment and function description
>sp|P90513|PSA3_ACACA Proteasome subunit alpha type-3 (Fragment) OS=Acanthamoeba castellanii PE=2 SV=1 Back     alignment and function description
>sp|P25788|PSA3_HUMAN Proteasome subunit alpha type-3 OS=Homo sapiens GN=PSMA3 PE=1 SV=2 Back     alignment and function description
>sp|Q58DU5|PSA3_BOVIN Proteasome subunit alpha type-3 OS=Bos taurus GN=PSMA3 PE=1 SV=3 Back     alignment and function description
>sp|P18422|PSA3_RAT Proteasome subunit alpha type-3 OS=Rattus norvegicus GN=Psma3 PE=1 SV=3 Back     alignment and function description
>sp|O70435|PSA3_MOUSE Proteasome subunit alpha type-3 OS=Mus musculus GN=Psma3 PE=1 SV=3 Back     alignment and function description
>sp|O59770|PSA7_SCHPO Probable proteasome subunit alpha type-7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pre10 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query202
224058900249 predicted protein [Populus trichocarpa] 1.0 0.811 0.930 1e-109
224106660249 predicted protein [Populus trichocarpa] 1.0 0.811 0.930 1e-108
217072000249 unknown [Medicago truncatula] 1.0 0.811 0.905 1e-106
388503392249 unknown [Medicago truncatula] 1.0 0.811 0.900 1e-105
297825981249 hypothetical protein ARALYDRAFT_481580 [ 1.0 0.811 0.886 1e-104
15225839249 proteasome subunit alpha type-3 [Arabido 1.0 0.811 0.886 1e-104
2511592249 multicatalytic endopeptidase complex, pr 1.0 0.811 0.886 1e-104
3914431249 RecName: Full=Proteasome subunit alpha t 1.0 0.811 0.915 1e-103
115440617249 Os01g0811100 [Oryza sativa Japonica Grou 1.0 0.811 0.871 1e-103
224031643249 unknown [Zea mays] gi|414880044|tpg|DAA5 1.0 0.811 0.856 1e-102
>gi|224058900|ref|XP_002299648.1| predicted protein [Populus trichocarpa] gi|118488197|gb|ABK95918.1| unknown [Populus trichocarpa] gi|222846906|gb|EEE84453.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  398 bits (1023), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 188/202 (93%), Positives = 197/202 (97%)

Query: 1   MGVEKLIASKMMLPGSNRRIHSVHRHSGMAVAGLAADGRQIVTRAKSEATNYESVYGEPI 60
           MGVEKLIASKMMLPGSNRRIH+VHRHSGMAVAGLAADGRQIV RAKSEATNY+SVYGEP+
Sbjct: 48  MGVEKLIASKMMLPGSNRRIHAVHRHSGMAVAGLAADGRQIVARAKSEATNYQSVYGEPV 107

Query: 61  PVKELAQRVASYVHLCTLYWWLRPFGCGVILGGYDRDGPQLYMIEPSGISYRYFGAAIGK 120
           P+KELA RVASYVHLCTLYWWLRPFGCGVILGGYDRDGPQLYM+EPSGISYRYFGAAIGK
Sbjct: 108 PIKELADRVASYVHLCTLYWWLRPFGCGVILGGYDRDGPQLYMVEPSGISYRYFGAAIGK 167

Query: 121 GRQAAKTEIEKLKLSEMTCRQGVIEVAKIIYGVHDEAKDKAFELEMSWVCDESNRQHQKV 180
           G+QAAKTEIEKLKLSEMTCR+GVIEVAKIIY VHDEAKDKAFELEMSWVCDES RQH+KV
Sbjct: 168 GKQAAKTEIEKLKLSEMTCREGVIEVAKIIYKVHDEAKDKAFELEMSWVCDESKRQHEKV 227

Query: 181 PDELLEEAKAAARAALEEMDAD 202
           PD+LLEEAKAAAR ALEEMDAD
Sbjct: 228 PDDLLEEAKAAARNALEEMDAD 249

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224106660|ref|XP_002314241.1| predicted protein [Populus trichocarpa] gi|118488569|gb|ABK96097.1| unknown [Populus trichocarpa] gi|222850649|gb|EEE88196.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|217072000|gb|ACJ84360.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|388503392|gb|AFK39762.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|297825981|ref|XP_002880873.1| hypothetical protein ARALYDRAFT_481580 [Arabidopsis lyrata subsp. lyrata] gi|297326712|gb|EFH57132.1| hypothetical protein ARALYDRAFT_481580 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|15225839|ref|NP_180270.1| proteasome subunit alpha type-3 [Arabidopsis thaliana] gi|12644056|sp|O23715.2|PSA3_ARATH RecName: Full=Proteasome subunit alpha type-3; AltName: Full=20S proteasome alpha subunit G-1; AltName: Full=DiDi 17A-2a; AltName: Full=Proteasome component 8; AltName: Full=Proteasome subunit alpha type-7 gi|14030729|gb|AAK53039.1|AF375455_1 At2g27020/T20P8.7 [Arabidopsis thaliana] gi|3421096|gb|AAC32064.1| 20S proteasome subunit PAG1 [Arabidopsis thaliana] gi|3885332|gb|AAC77860.1| 20S proteasome alpha subunit G (PAG1) [Arabidopsis thaliana] gi|21617882|gb|AAM66932.1| 20S proteasome subunit C8 (PAG1/PRC8_ARATH) [Arabidopsis thaliana] gi|21700783|gb|AAM70515.1| At2g27020/T20P8.7 [Arabidopsis thaliana] gi|330252829|gb|AEC07923.1| proteasome subunit alpha type-3 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|2511592|emb|CAA74027.1| multicatalytic endopeptidase complex, proteasome component, alpha subunit [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|3914431|sp|O24362.1|PSA3_SPIOL RecName: Full=Proteasome subunit alpha type-3; AltName: Full=20S proteasome alpha subunit G; AltName: Full=20S proteasome subunit alpha-7; AltName: Full=Proteasome component C8 gi|2285802|dbj|BAA21651.1| 26S proteasome alpha subunit [Spinacia oleracea] Back     alignment and taxonomy information
>gi|115440617|ref|NP_001044588.1| Os01g0811100 [Oryza sativa Japonica Group] gi|12229919|sp|Q9LSU0.1|PSA3_ORYSJ RecName: Full=Proteasome subunit alpha type-3; AltName: Full=20S proteasome alpha subunit G; AltName: Full=20S proteasome subunit alpha-7 gi|8671500|dbj|BAA96833.1| alpha 7 subunit of 20S proteasome [Oryza sativa Japonica Group] gi|55297486|dbj|BAD68202.1| putative proteasome subunit alpha type 3 [Oryza sativa Japonica Group] gi|55297673|dbj|BAD68244.1| putative proteasome subunit alpha type 3 [Oryza sativa Japonica Group] gi|113534119|dbj|BAF06502.1| Os01g0811100 [Oryza sativa Japonica Group] gi|215737208|dbj|BAG96137.1| unnamed protein product [Oryza sativa Japonica Group] gi|218189257|gb|EEC71684.1| hypothetical protein OsI_04163 [Oryza sativa Indica Group] gi|222619429|gb|EEE55561.1| hypothetical protein OsJ_03826 [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|224031643|gb|ACN34897.1| unknown [Zea mays] gi|414880044|tpg|DAA57175.1| TPA: proteasome subunit alpha type [Zea mays] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query202
TAIR|locus:2059319249 PAG1 "20S proteasome alpha sub 0.896 0.726 0.895 1.1e-87
DICTYBASE|DDB_G0267408248 psmA3 "proteasome subunit alph 0.896 0.729 0.591 2.7e-59
UNIPROTKB|Q5ZLI2255 PSMA3 "Proteasome subunit alph 0.891 0.705 0.629 1.8e-55
ZFIN|ZDB-GENE-050913-120255 psma3 "proteasome (prosome, ma 0.891 0.705 0.618 1.8e-55
UNIPROTKB|Q58DU5255 PSMA3 "Proteasome subunit alph 0.891 0.705 0.624 7.8e-55
UNIPROTKB|P25788255 PSMA3 "Proteasome subunit alph 0.891 0.705 0.624 9.9e-55
UNIPROTKB|F1SSL6255 PSMA3 "Proteasome subunit alph 0.891 0.705 0.618 3.4e-54
MGI|MGI:104883255 Psma3 "proteasome (prosome, ma 0.891 0.705 0.618 3.4e-54
RGD|61844255 Psma3 "proteasome (prosome, ma 0.891 0.705 0.618 3.4e-54
UNIPROTKB|E2RKR4255 PSMA3 "Proteasome subunit alph 0.891 0.705 0.618 4.3e-54
TAIR|locus:2059319 PAG1 "20S proteasome alpha subunit G1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 876 (313.4 bits), Expect = 1.1e-87, P = 1.1e-87
 Identities = 162/181 (89%), Positives = 175/181 (96%)

Query:     1 MGVEKLIASKMMLPGSNRRIHSVHRHSGMAVAGLAADGRQIVTRAKSEATNYESVYGEPI 60
             MGVEKLIASKMMLPGSNRRIHSVHRH+GMAVAGLAADGRQIV RAKSEA +YESVYG+ +
Sbjct:    48 MGVEKLIASKMMLPGSNRRIHSVHRHAGMAVAGLAADGRQIVARAKSEARSYESVYGDAV 107

Query:    61 PVKELAQRVASYVHLCTLYWWLRPFGCGVILGGYDRDGPQLYMIEPSGISYRYFGAAIGK 120
             PVKEL++RVASYVHLCTLYWWLRPFGCGVILGGYDRDGPQLYMIEPSGISYRYFGAAIGK
Sbjct:   108 PVKELSERVASYVHLCTLYWWLRPFGCGVILGGYDRDGPQLYMIEPSGISYRYFGAAIGK 167

Query:   121 GRQAAKTEIEKLKLSEMTCRQGVIEVAKIIYGVHDEAKDKAFELEMSWVCDESNRQHQKV 180
             G+QAAKTEIEKL LSEMTC++GVIEVAKIIY +HDEAKDKAFELEMSW+C+ES R+HQKV
Sbjct:   168 GKQAAKTEIEKLNLSEMTCKEGVIEVAKIIYKLHDEAKDKAFELEMSWICEESKREHQKV 227

Query:   181 P 181
             P
Sbjct:   228 P 228
GO:0004175 "endopeptidase activity" evidence=IEA
GO:0004298 "threonine-type endopeptidase activity" evidence=IEA
GO:0005737 "cytoplasm" evidence=ISM
GO:0005839 "proteasome core complex" evidence=IEA;TAS
GO:0006511 "ubiquitin-dependent protein catabolic process" evidence=IEA;RCA;TAS
GO:0008233 "peptidase activity" evidence=ISS
GO:0019773 "proteasome core complex, alpha-subunit complex" evidence=IEA
GO:0051603 "proteolysis involved in cellular protein catabolic process" evidence=IEA
GO:0005634 "nucleus" evidence=IDA
GO:0009409 "response to cold" evidence=IEP
GO:0005773 "vacuole" evidence=IDA
GO:0046686 "response to cadmium ion" evidence=IEP;RCA
GO:0005774 "vacuolar membrane" evidence=IDA
GO:0048046 "apoplast" evidence=IDA
GO:0000502 "proteasome complex" evidence=IDA
GO:0005829 "cytosol" evidence=IDA
GO:0006094 "gluconeogenesis" evidence=RCA
GO:0006096 "glycolysis" evidence=RCA
GO:0006833 "water transport" evidence=RCA
GO:0006972 "hyperosmotic response" evidence=RCA
GO:0007030 "Golgi organization" evidence=RCA
GO:0009266 "response to temperature stimulus" evidence=RCA
GO:0009651 "response to salt stress" evidence=RCA
GO:0009853 "photorespiration" evidence=RCA
GO:0043161 "proteasomal ubiquitin-dependent protein catabolic process" evidence=RCA
GO:0043248 "proteasome assembly" evidence=RCA
GO:0051788 "response to misfolded protein" evidence=RCA
GO:0080129 "proteasome core complex assembly" evidence=RCA
DICTYBASE|DDB_G0267408 psmA3 "proteasome subunit alpha type 3" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZLI2 PSMA3 "Proteasome subunit alpha type" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050913-120 psma3 "proteasome (prosome, macropain) subunit, alpha type, 3" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q58DU5 PSMA3 "Proteasome subunit alpha type-3" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|P25788 PSMA3 "Proteasome subunit alpha type-3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1SSL6 PSMA3 "Proteasome subunit alpha type" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:104883 Psma3 "proteasome (prosome, macropain) subunit, alpha type 3" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|61844 Psma3 "proteasome (prosome, macropain) subunit, alpha type 3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E2RKR4 PSMA3 "Proteasome subunit alpha type" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q58DU5PSA3_BOVIN3, ., 4, ., 2, 5, ., 10.59700.99000.7843yesno
Q27563PSA3_DICDI3, ., 4, ., 2, 5, ., 10.5750.99000.8064yesno
P25788PSA3_HUMAN3, ., 4, ., 2, 5, ., 10.59700.99000.7843yesno
O24362PSA3_SPIOL3, ., 4, ., 2, 5, ., 10.91581.00.8112N/Ano
P18422PSA3_RAT3, ., 4, ., 2, 5, ., 10.59200.99000.7843yesno
Q9LSU0PSA3_ORYSJ3, ., 4, ., 2, 5, ., 10.87121.00.8112yesno
O23715PSA3_ARATH3, ., 4, ., 2, 5, ., 10.88611.00.8112yesno
O70435PSA3_MOUSE3, ., 4, ., 2, 5, ., 10.59200.99000.7843yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.4.25.10.979
3rd Layer3.4.250.983

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
eugene3.00011128
RecName- Full=Proteasome subunit alpha type; EC=3.4.25.1;; The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity (By similarity) (249 aa)
(Populus trichocarpa)
Predicted Functional Partners:
eugene3.00050879
hypothetical protein; The proteasome is a multicatalytic proteinase complex which is characteri [...] (204 aa)
  ••••  0.683
estExt_Genewise1_v1.C_LG_II2236
RecName- Full=Proteasome subunit beta type; EC=3.4.25.1;; The proteasome is a multicatalytic pr [...] (204 aa)
  ••••  0.648
eugene3.00061745
hypothetical protein; The proteasome is a multicatalytic proteinase complex which is characteri [...] (245 aa)
  ••••  0.594
estExt_Genewise1_v1.C_LG_XVIII1299
hypothetical protein; The proteasome is a multicatalytic proteinase complex which is characteri [...] (245 aa)
  ••••  0.592
gw1.X.4845.1
hypothetical protein; The proteasome is a multicatalytic proteinase complex which is characteri [...] (260 aa)
  ••••  0.578
gw1.VIII.591.1
hypothetical protein; The proteasome is a multicatalytic proteinase complex which is characteri [...] (265 aa)
  ••••  0.574
estExt_fgenesh4_kg.C_LG_X0022
hypothetical protein; The proteasome is a multicatalytic proteinase complex which is characteri [...] (210 aa)
  ••••  0.552
grail3.0164005201
RecName- Full=Proteasome subunit beta type; EC=3.4.25.1;; The proteasome is a multicatalytic pr [...] (237 aa)
  ••••  0.523
estExt_fgenesh4_pg.C_LG_VI0598
hypothetical protein; The proteasome is a multicatalytic proteinase complex which is characteri [...] (237 aa)
  ••••  0.521
estExt_fgenesh4_pm.C_LG_II0671
RecName- Full=Proteasome subunit beta type; EC=3.4.25.1;; The proteasome is a multicatalytic pr [...] (224 aa)
  ••••  0.508

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query202
cd03751212 cd03751, proteasome_alpha_type_3, proteasome_alpha 1e-113
cd01911209 cd01911, proteasome_alpha, proteasome alpha subuni 4e-76
pfam00227188 pfam00227, Proteasome, Proteasome subunit 5e-51
cd01906182 cd01906, proteasome_protease_HslV, proteasome_prot 2e-47
COG0638236 COG0638, PRE1, 20S proteasome, alpha and beta subu 3e-39
PRK03996241 PRK03996, PRK03996, proteasome subunit alpha; Prov 4e-35
cd01901164 cd01901, Ntn_hydrolase, The Ntn hydrolases (N-term 2e-34
TIGR03633224 TIGR03633, arc_protsome_A, proteasome endopeptidas 8e-34
cd03749211 cd03749, proteasome_alpha_type_1, proteasome_alpha 5e-33
cd03753213 cd03753, proteasome_alpha_type_5, proteasome_alpha 7e-32
cd03756211 cd03756, proteasome_alpha_archeal, proteasome_alph 9e-31
cd03750227 cd03750, proteasome_alpha_type_2, proteasome_alpha 2e-28
PTZ00246253 PTZ00246, PTZ00246, proteasome subunit alpha; Prov 1e-24
cd03754215 cd03754, proteasome_alpha_type_6, proteasome_alpha 4e-24
cd03755207 cd03755, proteasome_alpha_type_7, proteasome_alpha 3e-23
cd03752213 cd03752, proteasome_alpha_type_4, proteasome_alpha 3e-20
cd03764188 cd03764, proteasome_beta_archeal, Archeal proteaso 7e-14
TIGR03634185 TIGR03634, arc_protsome_B, proteasome endopeptidas 4e-12
cd01912189 cd01912, proteasome_beta, proteasome beta subunit 9e-12
cd03763189 cd03763, proteasome_beta_type_7, proteasome beta t 3e-05
cd03762188 cd03762, proteasome_beta_type_6, proteasome beta t 3e-04
>gnl|CDD|239720 cd03751, proteasome_alpha_type_3, proteasome_alpha_type_3 Back     alignment and domain information 
 Score =  320 bits (822), Expect = e-113
 Identities = 119/169 (70%), Positives = 137/169 (81%)

Query: 1   MGVEKLIASKMMLPGSNRRIHSVHRHSGMAVAGLAADGRQIVTRAKSEATNYESVYGEPI 60
           + VEKL+ SK+  PGSN+RI +V RH G+AVAGL ADGR +V+RA+ EA NY   YG PI
Sbjct: 44  LAVEKLVTSKLYEPGSNKRIFNVDRHIGIAVAGLLADGRHLVSRAREEAENYRDNYGTPI 103

Query: 61  PVKELAQRVASYVHLCTLYWWLRPFGCGVILGGYDRDGPQLYMIEPSGISYRYFGAAIGK 120
           PVK LA RVA Y+H  TLY  +RPFGC V+LGGYD DGPQLYMIEPSG+SY YFG AIGK
Sbjct: 104 PVKVLADRVAMYMHAYTLYSSVRPFGCSVLLGGYDSDGPQLYMIEPSGVSYGYFGCAIGK 163

Query: 121 GRQAAKTEIEKLKLSEMTCRQGVIEVAKIIYGVHDEAKDKAFELEMSWV 169
           G+QAAKTE+EKLK SE+TCR+ V E AKIIY VHDE KDKAFELE+SWV
Sbjct: 164 GKQAAKTELEKLKFSELTCREAVKEAAKIIYIVHDEIKDKAFELELSWV 212

The 20S proteasome, multisubunit proteolytic complex, is the central enzyme of nonlysosomal protein degradation in both the cytosol and nucleus. It is composed of 28 subunits arranged as four homoheptameric rings that stack on top of one another forming an elongated alpha-beta-beta-alpha cylinder with a central cavity. The proteasome alpha and beta subunits are members of the N-terminal nucleophile (Ntn)-hydrolase superfamily. Their N-terminal threonine residues are exposed as a nucleophile in peptide bond hydrolysis. Mammals have 7 alpha and 7 beta proteasome subunits while archaea have one of each. Length = 212
>gnl|CDD|238892 cd01911, proteasome_alpha, proteasome alpha subunit Back     alignment and domain information
>gnl|CDD|215805 pfam00227, Proteasome, Proteasome subunit Back     alignment and domain information
>gnl|CDD|238887 cd01906, proteasome_protease_HslV, proteasome_protease_HslV Back     alignment and domain information
>gnl|CDD|223711 COG0638, PRE1, 20S proteasome, alpha and beta subunits [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|235192 PRK03996, PRK03996, proteasome subunit alpha; Provisional Back     alignment and domain information
>gnl|CDD|238884 cd01901, Ntn_hydrolase, The Ntn hydrolases (N-terminal nucleophile) are a diverse superfamily of of enzymes that are activated autocatalytically via an N-terminally lcated nucleophilic amino acid Back     alignment and domain information
>gnl|CDD|163366 TIGR03633, arc_protsome_A, proteasome endopeptidase complex, archaeal, alpha subunit Back     alignment and domain information
>gnl|CDD|239718 cd03749, proteasome_alpha_type_1, proteasome_alpha_type_1 Back     alignment and domain information
>gnl|CDD|239722 cd03753, proteasome_alpha_type_5, proteasome_alpha_type_5 Back     alignment and domain information
>gnl|CDD|239725 cd03756, proteasome_alpha_archeal, proteasome_alpha_archeal Back     alignment and domain information
>gnl|CDD|239719 cd03750, proteasome_alpha_type_2, proteasome_alpha_type_2 Back     alignment and domain information
>gnl|CDD|173491 PTZ00246, PTZ00246, proteasome subunit alpha; Provisional Back     alignment and domain information
>gnl|CDD|239723 cd03754, proteasome_alpha_type_6, proteasome_alpha_type_6 Back     alignment and domain information
>gnl|CDD|239724 cd03755, proteasome_alpha_type_7, proteasome_alpha_type_7 Back     alignment and domain information
>gnl|CDD|239721 cd03752, proteasome_alpha_type_4, proteasome_alpha_type_4 Back     alignment and domain information
>gnl|CDD|239733 cd03764, proteasome_beta_archeal, Archeal proteasome, beta subunit Back     alignment and domain information
>gnl|CDD|234287 TIGR03634, arc_protsome_B, proteasome endopeptidase complex, archaeal, beta subunit Back     alignment and domain information
>gnl|CDD|238893 cd01912, proteasome_beta, proteasome beta subunit Back     alignment and domain information
>gnl|CDD|239732 cd03763, proteasome_beta_type_7, proteasome beta type-7 subunit Back     alignment and domain information
>gnl|CDD|239731 cd03762, proteasome_beta_type_6, proteasome beta type-6 subunit Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 202
cd03750227 proteasome_alpha_type_2 proteasome_alpha_type_2. T 100.0
PTZ00246253 proteasome subunit alpha; Provisional 100.0
COG0638236 PRE1 20S proteasome, alpha and beta subunits [Post 100.0
PRK03996241 proteasome subunit alpha; Provisional 100.0
KOG0176241 consensus 20S proteasome, regulatory subunit alpha 100.0
cd03751212 proteasome_alpha_type_3 proteasome_alpha_type_3. T 100.0
TIGR03690219 20S_bact_beta proteasome, beta subunit, bacterial 100.0
TIGR03633224 arc_protsome_A proteasome endopeptidase complex, a 100.0
cd03761188 proteasome_beta_type_5 proteasome beta type-5 subu 100.0
KOG0181233 consensus 20S proteasome, regulatory subunit alpha 100.0
KOG0184254 consensus 20S proteasome, regulatory subunit alpha 100.0
PTZ00488247 Proteasome subunit beta type-5; Provisional 100.0
cd03752213 proteasome_alpha_type_4 proteasome_alpha_type_4. T 100.0
KOG0178249 consensus 20S proteasome, regulatory subunit alpha 100.0
cd03758193 proteasome_beta_type_2 proteasome beta type-2 subu 100.0
KOG0183249 consensus 20S proteasome, regulatory subunit alpha 100.0
cd03755207 proteasome_alpha_type_7 proteasome_alpha_type_7. T 100.0
cd03759195 proteasome_beta_type_3 proteasome beta type-3 subu 100.0
cd03749211 proteasome_alpha_type_1 proteasome_alpha_type_1. T 100.0
cd03754215 proteasome_alpha_type_6 proteasome_alpha_type_6. T 100.0
cd03760197 proteasome_beta_type_4 proteasome beta type-4 subu 100.0
cd03765236 proteasome_beta_bacterial Bacterial proteasome, be 100.0
cd03756211 proteasome_alpha_archeal proteasome_alpha_archeal. 100.0
TIGR03634185 arc_protsome_B proteasome endopeptidase complex, a 100.0
cd03764188 proteasome_beta_archeal Archeal proteasome, beta s 100.0
TIGR03691228 20S_bact_alpha proteasome, alpha subunit, bacteria 100.0
cd03753213 proteasome_alpha_type_5 proteasome_alpha_type_5. T 100.0
cd03757212 proteasome_beta_type_1 proteasome beta type-1 subu 100.0
cd01911209 proteasome_alpha proteasome alpha subunit. The 20S 100.0
cd03763189 proteasome_beta_type_7 proteasome beta type-7 subu 100.0
KOG0182246 consensus 20S proteasome, regulatory subunit alpha 100.0
cd03762188 proteasome_beta_type_6 proteasome beta type-6 subu 100.0
cd01912189 proteasome_beta proteasome beta subunit. The 20S p 100.0
cd01906182 proteasome_protease_HslV proteasome_protease_HslV. 100.0
PF00227190 Proteasome: Proteasome subunit; InterPro: IPR00135 100.0
KOG0863264 consensus 20S proteasome, regulatory subunit alpha 100.0
KOG0175285 consensus 20S proteasome, regulatory subunit beta 100.0
KOG0179235 consensus 20S proteasome, regulatory subunit beta 100.0
KOG0177200 consensus 20S proteasome, regulatory subunit beta 100.0
KOG0174224 consensus 20S proteasome, regulatory subunit beta 99.97
KOG0173271 consensus 20S proteasome, regulatory subunit beta 99.97
cd01901164 Ntn_hydrolase The Ntn hydrolases (N-terminal nucle 99.96
KOG0180204 consensus 20S proteasome, regulatory subunit beta 99.96
PRK05456172 ATP-dependent protease subunit HslV; Provisional 99.95
cd01913171 protease_HslV Protease HslV and the ATPase/chapero 99.94
TIGR03692171 ATP_dep_HslV ATP-dependent protease HslVU, peptida 99.93
KOG0185256 consensus 20S proteasome, regulatory subunit beta 99.93
COG5405178 HslV ATP-dependent protease HslVU (ClpYQ), peptida 98.35
COG3484255 Predicted proteasome-type protease [Posttranslatio 97.52
COG4079293 Uncharacterized protein conserved in archaea [Func 84.23
KOG3361157 consensus Iron binding protein involved in Fe-S cl 81.41
>cd03750 proteasome_alpha_type_2 proteasome_alpha_type_2 Back     alignment and domain information 
Probab=100.00  E-value=9.4e-46  Score=300.50  Aligned_cols=186  Identities=26%  Similarity=0.441  Sum_probs=177.1

Q ss_pred             CcccccCCCCCcccCCcCceEEecCcEEEEEecchhhHHHHHHHHHHHHHHhHHHhCCCCCHHHHHHHHHHHHHHhhhcc
Q 028888            1 MGVEKLIASKMMLPGSNRRIHSVHRHSGMAVAGLAADGRQIVTRAKSEATNYESVYGEPIPVKELAQRVASYVHLCTLYW   80 (202)
Q Consensus         1 la~d~r~~~~l~~~~~~~Ki~~i~~~i~~~~sG~~~D~~~l~~~~r~~~~~~~~~~~~~i~~~~la~~ls~~~~~~~~~~   80 (202)
                      ||+|+|.+++++.+++.+||++|++|++|+++|+.+|++.+.+.+|.+++.|++.+|++|+++.++++|++++|.|++++
T Consensus        41 laad~~~~~~l~~~~~~~KI~~I~~~i~~~~sG~~~D~~~l~~~~r~~~~~~~~~~~~~~~v~~la~~l~~~~~~~t~~~  120 (227)
T cd03750          41 LATEKKVPSPLIDESSVHKVEQITPHIGMVYSGMGPDFRVLVKKARKIAQQYYLVYGEPIPVSQLVREIASVMQEYTQSG  120 (227)
T ss_pred             EEEeecCCccccCCCCcceEEEEcCCEEEEEeEcHHhHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHhcCCC
Confidence            68999999888888889999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cccceeeeEEEEEEeCCCCeEEEECCCcceeeeeEEeeCCChHHHHHHHHhcCCCCCCHHHHHHHHHHHHHHhhhccCCC
Q 028888           81 WLRPFGCGVILGGYDRDGPQLYMIEPSGISYRYFGAAIGKGRQAAKTEIEKLKLSEMTCRQGVIEVAKIIYGVHDEAKDK  160 (202)
Q Consensus        81 ~~rP~~~~~iiaG~D~~gp~Ly~~d~~G~~~~~~~~a~G~gs~~~~~~Le~~~~~~~s~~eai~la~~~l~~~~~~~~~~  160 (202)
                      +.|||+|++||+|||++||+||++||+|++.+++++|+|+|+..++++||++|+++||++||++++++||+.+.++ ..+
T Consensus       121 ~~rP~~v~~li~G~D~~g~~Ly~~d~~G~~~~~~~~a~G~g~~~~~~~Le~~~~~~ms~eeai~l~~~~l~~~~~~-~l~  199 (227)
T cd03750         121 GVRPFGVSLLIAGWDEGGPYLYQVDPSGSYFTWKATAIGKNYSNAKTFLEKRYNEDLELEDAIHTAILTLKEGFEG-QMT  199 (227)
T ss_pred             CCCChheEEEEEEEeCCCCEEEEECCCCCEEeeeEEEECCCCHHHHHHHHhhccCCCCHHHHHHHHHHHHHHHhcc-cCC
Confidence            9999999999999998899999999999999999999999999999999999999999999999999999999887 457


Q ss_pred             CceEEEEEEEecCCCeEEEcCHHHHHHHH
Q 028888          161 AFELEMSWVCDESNRQHQKVPDELLEEAK  189 (202)
Q Consensus       161 ~~~iei~~i~~~~~~~~~~l~~~~i~~~~  189 (202)
                      +.++||++|+++ + .++.++++||++++
T Consensus       200 ~~~iev~iv~~~-~-~~~~~~~~ei~~~~  226 (227)
T cd03750         200 EKNIEIGICGET-K-GFRLLTPAEIKDYL  226 (227)
T ss_pred             CCcEEEEEEECC-C-CEEECCHHHHHHHh
Confidence            778999999975 2 49999999999876

The 20S proteasome, multisubunit proteolytic complex, is the central enzyme of nonlysosomal protein degradation in both the cytosol and nucleus. It is composed of 28 subunits arranged as four homoheptameric rings that stack on top of one another forming an elongated alpha-beta-beta-alpha cylinder with a central cavity. The proteasome alpha and beta subunits are members of the N-terminal nucleophile (Ntn)-hydrolase superfamily. Their N-terminal threonine residues are exposed as a nucleophile in peptide bond hydrolysis. Mammals have 7 alpha and 7 beta proteasome subunits while archaea have one of each.
>PTZ00246 proteasome subunit alpha; Provisional Back     alignment and domain information
>COG0638 PRE1 20S proteasome, alpha and beta subunits [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK03996 proteasome subunit alpha; Provisional Back     alignment and domain information
>KOG0176 consensus 20S proteasome, regulatory subunit alpha type PSMA5/PUP2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03751 proteasome_alpha_type_3 proteasome_alpha_type_3 Back     alignment and domain information
>TIGR03690 20S_bact_beta proteasome, beta subunit, bacterial type Back     alignment and domain information
>TIGR03633 arc_protsome_A proteasome endopeptidase complex, archaeal, alpha subunit Back     alignment and domain information
>cd03761 proteasome_beta_type_5 proteasome beta type-5 subunit Back     alignment and domain information
>KOG0181 consensus 20S proteasome, regulatory subunit alpha type PSMA2/PRE8 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0184 consensus 20S proteasome, regulatory subunit alpha type PSMA3/PRE10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00488 Proteasome subunit beta type-5; Provisional Back     alignment and domain information
>cd03752 proteasome_alpha_type_4 proteasome_alpha_type_4 Back     alignment and domain information
>KOG0178 consensus 20S proteasome, regulatory subunit alpha type PSMA4/PRE9 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03758 proteasome_beta_type_2 proteasome beta type-2 subunit Back     alignment and domain information
>KOG0183 consensus 20S proteasome, regulatory subunit alpha type PSMA7/PRE6 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03755 proteasome_alpha_type_7 proteasome_alpha_type_7 Back     alignment and domain information
>cd03759 proteasome_beta_type_3 proteasome beta type-3 subunit Back     alignment and domain information
>cd03749 proteasome_alpha_type_1 proteasome_alpha_type_1 Back     alignment and domain information
>cd03754 proteasome_alpha_type_6 proteasome_alpha_type_6 Back     alignment and domain information
>cd03760 proteasome_beta_type_4 proteasome beta type-4 subunit Back     alignment and domain information
>cd03765 proteasome_beta_bacterial Bacterial proteasome, beta subunit Back     alignment and domain information
>cd03756 proteasome_alpha_archeal proteasome_alpha_archeal Back     alignment and domain information
>TIGR03634 arc_protsome_B proteasome endopeptidase complex, archaeal, beta subunit Back     alignment and domain information
>cd03764 proteasome_beta_archeal Archeal proteasome, beta subunit Back     alignment and domain information
>TIGR03691 20S_bact_alpha proteasome, alpha subunit, bacterial type Back     alignment and domain information
>cd03753 proteasome_alpha_type_5 proteasome_alpha_type_5 Back     alignment and domain information
>cd03757 proteasome_beta_type_1 proteasome beta type-1 subunit Back     alignment and domain information
>cd01911 proteasome_alpha proteasome alpha subunit Back     alignment and domain information
>cd03763 proteasome_beta_type_7 proteasome beta type-7 subunit Back     alignment and domain information
>KOG0182 consensus 20S proteasome, regulatory subunit alpha type PSMA6/SCL1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03762 proteasome_beta_type_6 proteasome beta type-6 subunit Back     alignment and domain information
>cd01912 proteasome_beta proteasome beta subunit Back     alignment and domain information
>cd01906 proteasome_protease_HslV proteasome_protease_HslV Back     alignment and domain information
>PF00227 Proteasome: Proteasome subunit; InterPro: IPR001353 ATP-dependent protease complexes are present in all three kingdoms of life, where they rid the cell of misfolded or damaged proteins and control the level of certain regulatory proteins Back     alignment and domain information
>KOG0863 consensus 20S proteasome, regulatory subunit alpha type PSMA1/PRE5 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0175 consensus 20S proteasome, regulatory subunit beta type PSMB5/PSMB8/PRE2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0179 consensus 20S proteasome, regulatory subunit beta type PSMB1/PRE7 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0177 consensus 20S proteasome, regulatory subunit beta type PSMB2/PRE1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0174 consensus 20S proteasome, regulatory subunit beta type PSMB6/PSMB9/PRE3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0173 consensus 20S proteasome, regulatory subunit beta type PSMB7/PSMB10/PUP1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01901 Ntn_hydrolase The Ntn hydrolases (N-terminal nucleophile) are a diverse superfamily of of enzymes that are activated autocatalytically via an N-terminally lcated nucleophilic amino acid Back     alignment and domain information
>KOG0180 consensus 20S proteasome, regulatory subunit beta type PSMB3/PUP3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK05456 ATP-dependent protease subunit HslV; Provisional Back     alignment and domain information
>cd01913 protease_HslV Protease HslV and the ATPase/chaperone HslU are part of an ATP-dependent proteolytic system that is the prokaryotic homolog of the proteasome Back     alignment and domain information
>TIGR03692 ATP_dep_HslV ATP-dependent protease HslVU, peptidase subunit Back     alignment and domain information
>KOG0185 consensus 20S proteasome, regulatory subunit beta type PSMB4/PRE4 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5405 HslV ATP-dependent protease HslVU (ClpYQ), peptidase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3484 Predicted proteasome-type protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4079 Uncharacterized protein conserved in archaea [Function unknown] Back     alignment and domain information
>KOG3361 consensus Iron binding protein involved in Fe-S cluster formation [Energy production and conversion] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query202
1iru_G254 Crystal Structure Of The Mammalian 20s Proteasome A 2e-60
3unb_F255 Mouse Constitutive 20s Proteasome In Complex With P 1e-59
1z7q_G288 Crystal Structure Of The 20s Proteasome From Yeast 5e-42
1fnt_G287 Crystal Structure Of The 20s Proteasome From Yeast 5e-42
1ryp_G244 Crystal Structure Of The 20s Proteasome From Yeast 6e-42
1g0u_F248 A Gated Channel Into The Proteasome Core Particle L 6e-42
3oeu_F242 Structure Of Yeast 20s Open-Gate Proteasome With Co 6e-42
1g0u_D241 A Gated Channel Into The Proteasome Core Particle L 1e-20
1ryp_E242 Crystal Structure Of The 20s Proteasome From Yeast 3e-19
1vsy_E250 Proteasome Activator Complex Length = 250 3e-19
4g4s_E261 Structure Of Proteasome-Pba1-Pba2 Complex Length = 3e-19
1fnt_E260 Crystal Structure Of The 20s Proteasome From Yeast 3e-19
2z5c_C262 Crystal Structure Of A Novel Chaperone Complex For 3e-19
1j2q_A237 20s Proteasome In Complex With Calpain-inhibitor I 8e-19
3h4p_A264 Proteasome 20s Core Particle From Methanocaldococcu 3e-18
1iru_E241 Crystal Structure Of The Mammalian 20s Proteasome A 4e-18
3unb_D241 Mouse Constitutive 20s Proteasome In Complex With P 1e-17
1j2p_A246 Alpha-Ring From The Proteasome From Archaeoglobus F 5e-17
3unb_A234 Mouse Constitutive 20s Proteasome In Complex With P 3e-15
1iru_B233 Crystal Structure Of The Mammalian 20s Proteasome A 3e-15
3une_C248 Mouse Constitutive 20s Proteasome Length = 248 3e-15
1iru_D248 Crystal Structure Of The Mammalian 20s Proteasome A 3e-15
3unb_E263 Mouse Constitutive 20s Proteasome In Complex With P 7e-15
1iru_F263 Crystal Structure Of The Mammalian 20s Proteasome A 8e-15
3unb_C248 Mouse Constitutive 20s Proteasome In Complex With P 2e-14
3jrm_A227 Crystal Structure Of Archaeal 20s Proteasome In Com 2e-14
1pma_A233 Proteasome From Thermoplasma Acidophilum Length = 2 2e-14
2ku1_A237 Dynamic Regulation Of Archaeal Proteasome Gate Open 2e-14
1yar_A233 Structure Of Archeabacterial 20s Proteasome Mutant 3e-14
1yau_A233 Structure Of Archeabacterial 20s Proteasome- Pa26 C 3e-14
2ku2_A237 Dynamic Regulation Of Archaeal Proteasome Gate Open 3e-14
1vsy_B231 Proteasome Activator Complex Length = 231 1e-13
1ryp_B250 Crystal Structure Of The 20s Proteasome From Yeast 1e-13
1iru_A246 Crystal Structure Of The Mammalian 20s Proteasome A 2e-13
3oeu_B235 Structure Of Yeast 20s Open-Gate Proteasome With Co 2e-13
1z7q_C258 Crystal Structure Of The 20s Proteasome From Yeast 2e-13
1vsy_C232 Proteasome Activator Complex Length = 232 2e-13
1ryp_C244 Crystal Structure Of The 20s Proteasome From Yeast 2e-13
1g0u_B245 A Gated Channel Into The Proteasome Core Particle L 3e-13
3unb_G246 Mouse Constitutive 20s Proteasome In Complex With P 3e-13
1vsy_D227 Proteasome Activator Complex Length = 227 7e-12
1g0u_C243 A Gated Channel Into The Proteasome Core Particle L 8e-12
1ryp_D241 Crystal Structure Of The 20s Proteasome From Yeast 8e-12
1fnt_D254 Crystal Structure Of The 20s Proteasome From Yeast 9e-12
1fnt_F234 Crystal Structure Of The 20s Proteasome From Yeast 7e-11
4g4s_F235 Structure Of Proteasome-Pba1-Pba2 Complex Length = 7e-11
1ryp_F233 Crystal Structure Of The 20s Proteasome From Yeast 7e-11
1g0u_E234 A Gated Channel Into The Proteasome Core Particle L 3e-10
3sdi_E233 Structure Of Yeast 20s Open-Gate Proteasome With Co 3e-10
3unb_B261 Mouse Constitutive 20s Proteasome In Complex With P 6e-10
1iru_C261 Crystal Structure Of The Mammalian 20s Proteasome A 2e-09
1g0u_G252 A Gated Channel Into The Proteasome Core Particle L 2e-09
1ryp_A243 Crystal Structure Of The 20s Proteasome From Yeast 3e-09
3unf_H234 Mouse 20s Immunoproteasome In Complex With Pr-957 L 1e-04
>pdb|1IRU|G Chain G, Crystal Structure Of The Mammalian 20s Proteasome At 2.75 A Resolution Length = 254 Back     alignment and structure 
Iteration: 1

 Score =  228 bits (580), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 113/182 (62%), Positives = 136/182 (74%), Gaps = 1/182 (0%)
Query: 1   MGVEKLIASKMMLPGSNRRIHSVHRHSGMAVAGLAADGRQIVTRAKSEATNYESVYGEPI 60
            GVEKL+ SK+   GSN+R+ +V RH GMAVAGL AD R +   A+ EA+N+ S +G  I
Sbjct: 47  FGVEKLVLSKLYEEGSNKRLFNVDRHVGMAVAGLLADARSLADIAREEASNFRSNFGYNI 106
Query: 61  PVKELAQRVASYVHLCTLYWWLRPFGCGVILGGYD-RDGPQLYMIEPSGISYRYFGAAIG 119
           P+K LA RVA YVH  TLY  +RPFGC  +LG Y   DG QLYMI+PSG+SY Y+G AIG
Sbjct: 107 PLKHLADRVAMYVHAYTLYSAVRPFGCSFMLGSYSVNDGAQLYMIDPSGVSYGYWGCAIG 166
Query: 120 KGRQAAKTEIEKLKLSEMTCRQGVIEVAKIIYGVHDEAKDKAFELEMSWVCDESNRQHQK 179
           K RQAAKTEIEKL++ EMTCR  V EVAKIIY VHDE KDKAFELE+SWV + +N +H+ 
Sbjct: 167 KARQAAKTEIEKLQMKEMTCRDIVKEVAKIIYIVHDEVKDKAFELELSWVGELTNGRHEI 226
Query: 180 VP 181
           VP
Sbjct: 227 VP 228
>pdb|3UNB|F Chain F, Mouse Constitutive 20s Proteasome In Complex With Pr-957 Length = 255 Back     alignment and structure
>pdb|1Z7Q|G Chain G, Crystal Structure Of The 20s Proteasome From Yeast In Complex With The Proteasome Activator Pa26 From Trypanosome Brucei At 3.2 Angstroms Resolution Length = 288 Back     alignment and structure
>pdb|1FNT|G Chain G, Crystal Structure Of The 20s Proteasome From Yeast In Complex With The Proteasome Activator Pa26 From Trypanosome Brucei At 3.2 Angstroms Resolution Length = 287 Back     alignment and structure
>pdb|1RYP|G Chain G, Crystal Structure Of The 20s Proteasome From Yeast At 2.4 Angstroms Resolution Length = 244 Back     alignment and structure
>pdb|1G0U|F Chain F, A Gated Channel Into The Proteasome Core Particle Length = 248 Back     alignment and structure
>pdb|3OEU|F Chain F, Structure Of Yeast 20s Open-Gate Proteasome With Compound 24 Length = 242 Back     alignment and structure
>pdb|1G0U|D Chain D, A Gated Channel Into The Proteasome Core Particle Length = 241 Back     alignment and structure
>pdb|1RYP|E Chain E, Crystal Structure Of The 20s Proteasome From Yeast At 2.4 Angstroms Resolution Length = 242 Back     alignment and structure
>pdb|1VSY|E Chain E, Proteasome Activator Complex Length = 250 Back     alignment and structure
>pdb|4G4S|E Chain E, Structure Of Proteasome-Pba1-Pba2 Complex Length = 261 Back     alignment and structure
>pdb|1FNT|E Chain E, Crystal Structure Of The 20s Proteasome From Yeast In Complex With The Proteasome Activator Pa26 From Trypanosome Brucei At 3.2 Angstroms Resolution Length = 260 Back     alignment and structure
>pdb|2Z5C|C Chain C, Crystal Structure Of A Novel Chaperone Complex For Yeast 20s Proteasome Assembly Length = 262 Back     alignment and structure
>pdb|1J2Q|A Chain A, 20s Proteasome In Complex With Calpain-inhibitor I From Archaeoglobus Fulgidus Length = 237 Back     alignment and structure
>pdb|3H4P|A Chain A, Proteasome 20s Core Particle From Methanocaldococcus Jannaschii Length = 264 Back     alignment and structure
>pdb|1IRU|E Chain E, Crystal Structure Of The Mammalian 20s Proteasome At 2.75 A Resolution Length = 241 Back     alignment and structure
>pdb|3UNB|D Chain D, Mouse Constitutive 20s Proteasome In Complex With Pr-957 Length = 241 Back     alignment and structure
>pdb|1J2P|A Chain A, Alpha-Ring From The Proteasome From Archaeoglobus Fulgidus Length = 246 Back     alignment and structure
>pdb|3UNB|A Chain A, Mouse Constitutive 20s Proteasome In Complex With Pr-957 Length = 234 Back     alignment and structure
>pdb|1IRU|B Chain B, Crystal Structure Of The Mammalian 20s Proteasome At 2.75 A Resolution Length = 233 Back     alignment and structure
>pdb|3UNE|C Chain C, Mouse Constitutive 20s Proteasome Length = 248 Back     alignment and structure
>pdb|1IRU|D Chain D, Crystal Structure Of The Mammalian 20s Proteasome At 2.75 A Resolution Length = 248 Back     alignment and structure
>pdb|3UNB|E Chain E, Mouse Constitutive 20s Proteasome In Complex With Pr-957 Length = 263 Back     alignment and structure
>pdb|1IRU|F Chain F, Crystal Structure Of The Mammalian 20s Proteasome At 2.75 A Resolution Length = 263 Back     alignment and structure
>pdb|3UNB|C Chain C, Mouse Constitutive 20s Proteasome In Complex With Pr-957 Length = 248 Back     alignment and structure
>pdb|3JRM|A Chain A, Crystal Structure Of Archaeal 20s Proteasome In Complex With Mutated P26 Activator Length = 227 Back     alignment and structure
>pdb|1PMA|A Chain A, Proteasome From Thermoplasma Acidophilum Length = 233 Back     alignment and structure
>pdb|2KU1|A Chain A, Dynamic Regulation Of Archaeal Proteasome Gate Opening As Studied By Trosy-Nmr Length = 237 Back     alignment and structure
>pdb|1YAR|A Chain A, Structure Of Archeabacterial 20s Proteasome Mutant D9s- Pa26 Complex Length = 233 Back     alignment and structure
>pdb|1YAU|A Chain A, Structure Of Archeabacterial 20s Proteasome- Pa26 Complex Length = 233 Back     alignment and structure
>pdb|2KU2|A Chain A, Dynamic Regulation Of Archaeal Proteasome Gate Opening As Studied By Trosy-Nmr Length = 237 Back     alignment and structure
>pdb|1VSY|B Chain B, Proteasome Activator Complex Length = 231 Back     alignment and structure
>pdb|1RYP|B Chain B, Crystal Structure Of The 20s Proteasome From Yeast At 2.4 Angstroms Resolution Length = 250 Back     alignment and structure
>pdb|1IRU|A Chain A, Crystal Structure Of The Mammalian 20s Proteasome At 2.75 A Resolution Length = 246 Back     alignment and structure
>pdb|3OEU|B Chain B, Structure Of Yeast 20s Open-Gate Proteasome With Compound 24 Length = 235 Back     alignment and structure
>pdb|1Z7Q|C Chain C, Crystal Structure Of The 20s Proteasome From Yeast In Complex With The Proteasome Activator Pa26 From Trypanosome Brucei At 3.2 Angstroms Resolution Length = 258 Back     alignment and structure
>pdb|1VSY|C Chain C, Proteasome Activator Complex Length = 232 Back     alignment and structure
>pdb|1RYP|C Chain C, Crystal Structure Of The 20s Proteasome From Yeast At 2.4 Angstroms Resolution Length = 244 Back     alignment and structure
>pdb|1G0U|B Chain B, A Gated Channel Into The Proteasome Core Particle Length = 245 Back     alignment and structure
>pdb|3UNB|G Chain G, Mouse Constitutive 20s Proteasome In Complex With Pr-957 Length = 246 Back     alignment and structure
>pdb|1VSY|D Chain D, Proteasome Activator Complex Length = 227 Back     alignment and structure
>pdb|1G0U|C Chain C, A Gated Channel Into The Proteasome Core Particle Length = 243 Back     alignment and structure
>pdb|1RYP|D Chain D, Crystal Structure Of The 20s Proteasome From Yeast At 2.4 Angstroms Resolution Length = 241 Back     alignment and structure
>pdb|1FNT|D Chain D, Crystal Structure Of The 20s Proteasome From Yeast In Complex With The Proteasome Activator Pa26 From Trypanosome Brucei At 3.2 Angstroms Resolution Length = 254 Back     alignment and structure
>pdb|1FNT|F Chain F, Crystal Structure Of The 20s Proteasome From Yeast In Complex With The Proteasome Activator Pa26 From Trypanosome Brucei At 3.2 Angstroms Resolution Length = 234 Back     alignment and structure
>pdb|4G4S|F Chain F, Structure Of Proteasome-Pba1-Pba2 Complex Length = 235 Back     alignment and structure
>pdb|1RYP|F Chain F, Crystal Structure Of The 20s Proteasome From Yeast At 2.4 Angstroms Resolution Length = 233 Back     alignment and structure
>pdb|1G0U|E Chain E, A Gated Channel Into The Proteasome Core Particle Length = 234 Back     alignment and structure
>pdb|3SDI|E Chain E, Structure Of Yeast 20s Open-Gate Proteasome With Compound 20 Length = 233 Back     alignment and structure
>pdb|3UNB|B Chain B, Mouse Constitutive 20s Proteasome In Complex With Pr-957 Length = 261 Back     alignment and structure
>pdb|1IRU|C Chain C, Crystal Structure Of The Mammalian 20s Proteasome At 2.75 A Resolution Length = 261 Back     alignment and structure
>pdb|1G0U|G Chain G, A Gated Channel Into The Proteasome Core Particle Length = 252 Back     alignment and structure
>pdb|1RYP|A Chain A, Crystal Structure Of The 20s Proteasome From Yeast At 2.4 Angstroms Resolution Length = 243 Back     alignment and structure
>pdb|3UNF|H Chain H, Mouse 20s Immunoproteasome In Complex With Pr-957 Length = 234 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query202
1iru_G254 20S proteasome; cell cycle, immune response, prote 7e-96
1ryp_G244 20S proteasome; multicatalytic proteinase, protein 1e-92
3nzj_F288 Proteasome component C1; ubiquitin, protein degrad 5e-92
1j2p_A246 Alpha-ring, proteasome alpha subunit; hydrolase; 2 3e-91
3h4p_A264 Proteasome subunit alpha; core particle, cytoplasm 5e-91
1yar_A233 Proteasome alpha subunit; proteasome 20S, PA26 pro 2e-86
1iru_A246 20S proteasome; cell cycle, immune response, prote 1e-85
1iru_B233 20S proteasome; cell cycle, immune response, prote 2e-85
1iru_E241 20S proteasome; cell cycle, immune response, prote 4e-85
1ryp_C244 20S proteasome; multicatalytic proteinase, protein 6e-85
1ryp_B250 20S proteasome; multicatalytic proteinase, protein 4e-84
1iru_C261 20S proteasome; cell cycle, immune response, prote 1e-82
1ryp_F233 20S proteasome; multicatalytic proteinase, protein 5e-82
1ryp_E242 20S proteasome; multicatalytic proteinase, protein 3e-81
1iru_F263 20S proteasome; cell cycle, immune response, prote 2e-77
1iru_D248 20S proteasome; cell cycle, immune response, prote 1e-72
1ryp_A243 20S proteasome; multicatalytic proteinase, protein 4e-72
1ryp_D241 20S proteasome; multicatalytic proteinase, protein 1e-71
3nzj_H261 Proteasome component PUP1; ubiquitin, protein degr 1e-26
1ryp_I222 20S proteasome; multicatalytic proteinase, protein 3e-26
3unf_H234 Proteasome subunit beta type-10; antigen presentat 5e-26
1iru_I234 20S proteasome; cell cycle, immune response, prote 5e-25
1yar_H217 Proteasome beta subunit; proteasome 20S, PA26 prot 2e-23
1q5q_A259 Proteasome alpha-type subunit 1; proteasome assemb 2e-23
3mi0_A248 Proteasome subunit alpha; enzyme inhibitors, lacto 1e-19
1iru_L204 20S proteasome; cell cycle, immune response, prote 2e-19
1j2q_H202 Proteasome beta subunit; ubiquitin, CP, hydrolase; 6e-18
3nzj_K287 Proteasome component PRE2; ubiquitin, protein degr 1e-17
1ryp_L212 20S proteasome; multicatalytic proteinase, protein 2e-17
1q5q_H235 Proteasome beta-type subunit 1; proteasome assembl 2e-17
1q5r_H294 Proteasome beta-type subunit 1; proteasome assembl 3e-17
2jay_A291 Proteasome; hydrolase; 1.99A {Mycobacterium tuberc 9e-17
3unf_N199 Proteasome subunit beta type-9; antigen presentati 2e-16
1iru_H205 20S proteasome; cell cycle, immune response, prote 1e-15
1iru_H205 20S proteasome; cell cycle, immune response, prote 1e-15
1ryp_K198 20S proteasome; multicatalytic proteinase, protein 4e-14
1iru_K201 20S proteasome; cell cycle, immune response, prote 2e-13
1iru_J205 20S proteasome; cell cycle, immune response, prote 6e-13
1ryp_H205 20S proteasome; multicatalytic proteinase, protein 9e-13
1iru_N219 20S proteasome; cell cycle, immune response, prote 1e-12
1iru_M213 20S proteasome; cell cycle, immune response, prote 4e-12
1ryp_M222 20S proteasome; multicatalytic proteinase, protein 7e-12
1ryp_N233 20S proteasome; multicatalytic proteinase, protein 4e-11
1g0u_M266 Proteasome component PRE4; ubiquitin, degradation, 7e-11
1ryp_J204 20S proteasome; multicatalytic proteinase, protein 6e-10
>1iru_G 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_F* 3une_F 3unf_F* 3unh_F Length = 254 Back     alignment and structure
 Score =  278 bits (713), Expect = 7e-96
 Identities = 120/203 (59%), Positives = 149/203 (73%), Gaps = 1/203 (0%)

Query: 1   MGVEKLIASKMMLPGSNRRIHSVHRHSGMAVAGLAADGRQIVTRAKSEATNYESVYGEPI 60
            GVEKL+ SK+   GSN+R+ +V RH GMAVAGL AD R +   A+ EA+N+ S +G  I
Sbjct: 47  FGVEKLVLSKLYEEGSNKRLFNVDRHVGMAVAGLLADARSLADIAREEASNFRSNFGYNI 106

Query: 61  PVKELAQRVASYVHLCTLYWWLRPFGCGVILGGYD-RDGPQLYMIEPSGISYRYFGAAIG 119
           P+K LA RVA YVH  TLY  +RPFGC  +LG Y   DG QLYMI+PSG+SY Y+G AIG
Sbjct: 107 PLKHLADRVAMYVHAYTLYSAVRPFGCSFMLGSYSVNDGAQLYMIDPSGVSYGYWGCAIG 166

Query: 120 KGRQAAKTEIEKLKLSEMTCRQGVIEVAKIIYGVHDEAKDKAFELEMSWVCDESNRQHQK 179
           K RQAAKTEIEKL++ EMTCR  V EVAKIIY VHDE KDKAFELE+SWV + +N +H+ 
Sbjct: 167 KARQAAKTEIEKLQMKEMTCRDIVKEVAKIIYIVHDEVKDKAFELELSWVGELTNGRHEI 226

Query: 180 VPDELLEEAKAAARAALEEMDAD 202
           VP ++ EEA+  A+ +L+E D  
Sbjct: 227 VPKDIREEAEKYAKESLKEEDES 249
>1ryp_G 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_F* 1g65_F 1vsy_G 2f16_F* 2fak_F* 2fny_F* 2gpl_F* 3d29_F* 3dy3_F* 3dy4_F* 3e47_F* 3gpj_F* 3gpt_F* 3gpw_F* 3hye_F* 3l5q_L 3mg0_F* 3mg4_F* 3okj_F* 3shj_F* ... Length = 244 Back     alignment and structure
>3nzj_F Proteasome component C1; ubiquitin, protein degradation, N-terminal nucleophilic HYDR 19S regulatory particle; HET: TY5 TRO MES; 2.40A {Saccharomyces cerevisiae} PDB: 1z7q_G* 3nzw_F* 3nzx_F* 3un4_F* 3un8_F* 3bdm_F* 1fnt_G* 2zcy_F* Length = 288 Back     alignment and structure
>1j2p_A Alpha-ring, proteasome alpha subunit; hydrolase; 2.60A {Archaeoglobus fulgidus} SCOP: d.153.1.4 PDB: 1j2q_A* Length = 246 Back     alignment and structure
>3h4p_A Proteasome subunit alpha; core particle, cytoplasm, hydrolase, protease, threonine protease; 4.10A {Methanocaldococcus jannaschii} Length = 264 Back     alignment and structure
>1yar_A Proteasome alpha subunit; proteasome 20S, PA26 proteasome activator 11S, hydrolase-HYD activator complex; 1.90A {Thermoplasma acidophilum} SCOP: d.153.1.4 PDB: 1ya7_A 1pma_A 3c91_A 3c92_A 3ipm_A 2ku1_A 2ku2_A 1yau_A 3jrm_A 3jse_A 3jtl_A Length = 233 Back     alignment and structure
>1iru_A 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_G* 3une_G 3unf_G* 3unh_G Length = 246 Back     alignment and structure
>1iru_B 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_A* 3une_A 3unf_A* 3unh_A Length = 233 Back     alignment and structure
>1iru_E 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_D* 3une_D 3unf_D* 3unh_D Length = 241 Back     alignment and structure
>1ryp_C 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_B* 1g65_B 2f16_B* 2fak_B* 2fny_B* 2gpl_B* 3d29_B* 3dy3_B* 3dy4_B* 3e47_B* 3gpj_B* 3gpt_B* 3gpw_B* 3hye_B* 3mg0_B* 3mg4_B* 3okj_B* 3shj_B* 3tdd_B* 3nzj_B* ... Length = 244 Back     alignment and structure
>1ryp_B 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_B 1g0u_A* 1jd2_A* 1g65_A 1z7q_B 2f16_A* 2fak_A* 2fny_A* 2gpl_A* 2zcy_A* 3bdm_A* 3d29_A* 3dy3_A* 3dy4_A* 3e47_A* 3gpj_A* 3gpt_A* 3gpw_A* 3hye_A* 3mg0_A* ... Length = 250 Back     alignment and structure
>1iru_C 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_B* 3une_B 3unf_B* 3unh_B Length = 261 Back     alignment and structure
>1ryp_F 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_E* 1g65_E 2f16_E* 2fak_E* 2fny_E* 2gpl_E* 3d29_E* 3dy3_E* 3dy4_E* 3e47_E* 3gpj_E* 3gpt_E* 3gpw_E* 3hye_E* 3mg0_E* 3mg4_E* 3oeu_E* 3oev_E* 3okj_E* 3shj_E* ... Length = 233 Back     alignment and structure
>1ryp_E 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_D* 1g65_D 2f16_D* 2fak_D* 2fny_D* 2gpl_D* 3d29_D* 3dy3_D* 3dy4_D* 3e47_D* 3gpj_D* 3gpt_D* 3gpw_D* 3hye_D* 3mg0_D* 3mg4_D* 3okj_D* 3shj_D* 3tdd_D* 2z5c_C ... Length = 242 Back     alignment and structure
>1iru_F 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_E* 3une_E 3unf_E* 3unh_E Length = 263 Back     alignment and structure
>1iru_D 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unf_C* 3une_C* 3unh_C 3unb_C* Length = 248 Back     alignment and structure
>1ryp_A 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_G* 1g65_G 1vsy_A 2f16_G* 2fak_G* 2fny_G* 2gpl_G* 3d29_G* 3dy3_G* 3dy4_G* 3e47_G* 3gpj_G* 3gpt_G* 3gpw_G* 3hye_G* 3l5q_A 3mg0_G* 3mg4_G* 3oeu_G* 3oev_G* ... Length = 243 Back     alignment and structure
>1ryp_D 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_C* 1g65_C 2f16_C* 2fak_C* 2fny_C* 2gpl_C* 3d29_C* 3dy3_C* 3dy4_C* 3e47_C* 3gpj_C* 3gpt_C* 3gpw_C* 3hye_C* 3mg0_C* 3mg4_C* 3oeu_C* 3oev_C* 3okj_C* 3shj_C* ... Length = 241 Back     alignment and structure
>3nzj_H Proteasome component PUP1; ubiquitin, protein degradation, N-terminal nucleophilic HYDR 19S regulatory particle; HET: TY5 TRO MES; 2.40A {Saccharomyces cerevisiae} PDB: 3nzw_H* 3nzx_H* Length = 261 Back     alignment and structure
>1ryp_I 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1g0u_H* 1jd2_H* 1g65_H 1vsy_I 1z7q_I 2f16_H* 2fak_H* 2fny_H* 2gpl_H* 3d29_H* 3dy3_H* 3dy4_H* 3e47_H* 3gpj_H* 3gpt_H* 3gpw_H* 3hye_H* 3l5q_M 3mg0_H* 3mg4_H* ... Length = 222 Back     alignment and structure
>3unf_H Proteasome subunit beta type-10; antigen presentation, drug development, protein degradation, hydrolase-hydrolase inhibitor complex; HET: 04C; 2.90A {Mus musculus} PDB: 3unh_H Length = 234 Back     alignment and structure
>1iru_I 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_H* 3une_H Length = 234 Back     alignment and structure
>1yar_H Proteasome beta subunit; proteasome 20S, PA26 proteasome activator 11S, hydrolase-HYD activator complex; 1.90A {Thermoplasma acidophilum} SCOP: d.153.1.4 PDB: 1ya7_H 1yau_H 3ipm_H 1pma_B 3jrm_H 3c92_H 3c91_H 3jse_H 3jtl_H Length = 217 Back     alignment and structure
>1q5q_A Proteasome alpha-type subunit 1; proteasome assembly, Pro-peptide, inter-subunit contacts, RH erythropolis, hydrolase; 2.60A {Rhodococcus erythropolis} SCOP: d.153.1.4 PDB: 2h6j_A 1q5r_A Length = 259 Back     alignment and structure
>3mi0_A Proteasome subunit alpha; enzyme inhibitors, lactones, proteasome endopeptidase comple mycobacterium tuberculosis, hydrolase; HET: SA6; 2.20A {Mycobacterium tuberculosis} PDB: 3h6f_A 3krd_A* 3h6i_A* 3mka_A 2fhh_A* 2fhg_A 3hfa_D 3hf9_A 3mfe_D Length = 248 Back     alignment and structure
>1iru_L 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_K* 3une_K 3unf_K* 3unh_K Length = 204 Back     alignment and structure
>1j2q_H Proteasome beta subunit; ubiquitin, CP, hydrolase; HET: CIB; 2.83A {Archaeoglobus fulgidus} SCOP: d.153.1.4 Length = 202 Back     alignment and structure
>3nzj_K Proteasome component PRE2; ubiquitin, protein degradation, N-terminal nucleophilic HYDR 19S regulatory particle; HET: TY5 TRO MES; 2.40A {Saccharomyces cerevisiae} PDB: 3nzw_K* 3nzx_K* Length = 287 Back     alignment and structure
>1ryp_L 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_L 1vsy_L 1z7q_L 3l5q_P 1g65_K* 1g0u_K* 1jd2_K* 2f16_K* 2fak_K* 2fny_K* 2gpl_K* 2zcy_K* 3bdm_K* 3d29_K* 3dy3_K* 3dy4_K* 3e47_K* 3gpj_K* 3gpt_K* 3gpw_K* ... Length = 212 Back     alignment and structure
>1q5q_H Proteasome beta-type subunit 1; proteasome assembly, Pro-peptide, inter-subunit contacts, RH erythropolis, hydrolase; 2.60A {Rhodococcus erythropolis} SCOP: d.153.1.4 Length = 235 Back     alignment and structure
>1q5r_H Proteasome beta-type subunit 1; proteasome assembly, Pro-peptide, inter-subunit contacts, hydrolase; 3.10A {Rhodococcus erythropolis} SCOP: d.153.1.4 PDB: 2h6j_H Length = 294 Back     alignment and structure
>2jay_A Proteasome; hydrolase; 1.99A {Mycobacterium tuberculosis} PDB: 3mka_C 3mi0_C* 2fhg_H* 2fhh_H 3krd_C* 3mfe_G 3hfa_H* 3h6i_C 3h6f_C 3hf9_H 3mfe_H Length = 291 Back     alignment and structure
>3unf_N Proteasome subunit beta type-9; antigen presentation, drug development, protein degradation, hydrolase-hydrolase inhibitor complex; HET: 04C; 2.90A {Mus musculus} PDB: 3unh_N Length = 199 Back     alignment and structure
>1iru_H 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_N* 3une_N Length = 205 Back     alignment and structure
>1ryp_K 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_K 1g0u_J* 1jd2_J* 1g65_J 1vsy_K 1z7q_K 2f16_J* 2fak_J* 2fny_J* 2gpl_J* 2zcy_J* 3bdm_J* 3d29_J* 3dy3_J* 3dy4_J* 3e47_J* 3gpj_J* 3gpt_J* 3gpw_J* 3hye_J* ... Length = 198 Back     alignment and structure
>1iru_K 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_J* 3une_J 3unf_J* 3unh_J Length = 201 Back     alignment and structure
>1iru_J 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_I* 3une_I 3unf_I* 3unh_I Length = 205 Back     alignment and structure
>1ryp_H 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 3nzj_N* 3nzw_N* 3nzx_N* 1vsy_H 3l5q_B 1g65_N* 1fnt_H 1g0u_N* 1jd2_N* 1z7q_H 2f16_N* 2fak_N* 2fny_N* 2gpl_N* 2zcy_N* 3bdm_N* 3d29_N* 3dy3_N* 3dy4_N* 3e47_N* ... Length = 205 Back     alignment and structure
>1iru_N 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_M* 3une_M 3unf_M* 3unh_M Length = 219 Back     alignment and structure
>1iru_M 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_L* 3une_L 3unf_L* 3unh_L Length = 213 Back     alignment and structure
>1ryp_M 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_M* 1jd2_L* 1g65_L 1vsy_M 1z7q_M 2f16_L* 2fak_L* 2fny_L* 2gpl_L* 3d29_L* 3dy3_L* 3dy4_L* 3e47_L* 3gpj_L* 3gpt_L* 3gpw_L* 3hye_L* 3l5q_Q 3mg0_L* 3mg4_L* ... Length = 222 Back     alignment and structure
>1ryp_N 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_N* 1jd2_M* 1g65_M 1vsy_N 1z7q_N 2f16_M* 2fak_M* 2fny_M* 2gpl_M* 3d29_M* 3dy3_M* 3dy4_M* 3e47_M* 3gpj_M* 3gpt_M* 3gpw_M* 3hye_M* 3l5q_R 3mg0_M* 3mg4_M* ... Length = 233 Back     alignment and structure
>1g0u_M Proteasome component PRE4; ubiquitin, degradation, protease, NTN-hydrolase; 2.40A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 2zcy_M* 3bdm_M* 3mg6_M* 3mg7_M* 3mg8_M* 3nzj_M* 3nzw_M* 3nzx_M* Length = 266 Back     alignment and structure
>1ryp_J 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_I* 1g65_I 1vsy_J 2f16_I* 2fak_I* 2fny_I* 2gpl_I* 3d29_I* 3dy3_I* 3dy4_I* 3e47_I* 3gpj_I* 3gpt_I* 3gpw_I* 3hye_I* 3l5q_N 3mg0_I* 3mg4_I* 3oeu_I* 3oev_I* ... Length = 204 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query202
3nzj_F288 Proteasome component C1; ubiquitin, protein degrad 100.0
1iru_G254 20S proteasome; cell cycle, immune response, prote 100.0
3h4p_A264 Proteasome subunit alpha; core particle, cytoplasm 100.0
1ryp_A243 20S proteasome; multicatalytic proteinase, protein 100.0
1iru_C261 20S proteasome; cell cycle, immune response, prote 100.0
1ryp_C244 20S proteasome; multicatalytic proteinase, protein 100.0
1j2p_A246 Alpha-ring, proteasome alpha subunit; hydrolase; 2 100.0
1ryp_E242 20S proteasome; multicatalytic proteinase, protein 100.0
1iru_A246 20S proteasome; cell cycle, immune response, prote 100.0
1ryp_G244 20S proteasome; multicatalytic proteinase, protein 100.0
1ryp_D241 20S proteasome; multicatalytic proteinase, protein 100.0
1yar_A233 Proteasome alpha subunit; proteasome 20S, PA26 pro 100.0
1iru_B233 20S proteasome; cell cycle, immune response, prote 100.0
3h4p_a219 Proteasome subunit beta; core particle, cytoplasm, 100.0
1iru_D248 20S proteasome; cell cycle, immune response, prote 100.0
1iru_E241 20S proteasome; cell cycle, immune response, prote 100.0
1j2q_H202 Proteasome beta subunit; ubiquitin, CP, hydrolase; 100.0
1yar_H217 Proteasome beta subunit; proteasome 20S, PA26 prot 100.0
1ryp_F233 20S proteasome; multicatalytic proteinase, protein 100.0
1ryp_B250 20S proteasome; multicatalytic proteinase, protein 100.0
1iru_F263 20S proteasome; cell cycle, immune response, prote 100.0
3mi0_A248 Proteasome subunit alpha; enzyme inhibitors, lacto 100.0
1ryp_L212 20S proteasome; multicatalytic proteinase, protein 100.0
1iru_L204 20S proteasome; cell cycle, immune response, prote 100.0
1iru_H205 20S proteasome; cell cycle, immune response, prote 100.0
1q5q_H235 Proteasome beta-type subunit 1; proteasome assembl 100.0
3nzj_K287 Proteasome component PRE2; ubiquitin, protein degr 100.0
1ryp_K198 20S proteasome; multicatalytic proteinase, protein 100.0
3unf_H234 Proteasome subunit beta type-10; antigen presentat 100.0
1q5r_H294 Proteasome beta-type subunit 1; proteasome assembl 100.0
1q5q_A259 Proteasome alpha-type subunit 1; proteasome assemb 100.0
1iru_N219 20S proteasome; cell cycle, immune response, prote 100.0
1ryp_N233 20S proteasome; multicatalytic proteinase, protein 100.0
1iru_M213 20S proteasome; cell cycle, immune response, prote 100.0
3unf_N199 Proteasome subunit beta type-9; antigen presentati 100.0
1ryp_I222 20S proteasome; multicatalytic proteinase, protein 100.0
1iru_J205 20S proteasome; cell cycle, immune response, prote 100.0
1ryp_J204 20S proteasome; multicatalytic proteinase, protein 100.0
2jay_A291 Proteasome; hydrolase; 1.99A {Mycobacterium tuberc 100.0
1ryp_H205 20S proteasome; multicatalytic proteinase, protein 100.0
1ryp_M222 20S proteasome; multicatalytic proteinase, protein 100.0
1iru_K201 20S proteasome; cell cycle, immune response, prote 100.0
1g0u_M266 Proteasome component PRE4; ubiquitin, degradation, 100.0
1iru_I234 20S proteasome; cell cycle, immune response, prote 100.0
3nzj_H261 Proteasome component PUP1; ubiquitin, protein degr 100.0
1g3k_A174 ATP-dependent protease HSLV; hydrolase; 1.90A {Hae 100.0
1m4y_A171 ATP-dependent protease HSLV; N-terminal catalytic 99.98
2z3b_A180 ATP-dependent protease HSLV; N-terminal nucleophIl 99.97
>3nzj_F Proteasome component C1; ubiquitin, protein degradation, N-terminal nucleophilic HYDR 19S regulatory particle; HET: TY5 TRO MES; 2.40A {Saccharomyces cerevisiae} PDB: 1z7q_G* 3nzw_F* 3nzx_F* 3un4_F* 3un8_F* 4b4t_G 4g4s_G* 3bdm_F* 1fnt_G* 2zcy_F* Back     alignment and structure
Probab=100.00  E-value=1.5e-48  Score=325.19  Aligned_cols=201  Identities=45%  Similarity=0.774  Sum_probs=191.5

Q ss_pred             CcccccCCCCCcccCCcCceEEecCcEEEEEecchhhHHHHHHHHHHHHHHhHHHhCCCCCHHHHHHHHHHHHHHhhhcc
Q 028888            1 MGVEKLIASKMMLPGSNRRIHSVHRHSGMAVAGLAADGRQIVTRAKSEATNYESVYGEPIPVKELAQRVASYVHLCTLYW   80 (202)
Q Consensus         1 la~d~r~~~~l~~~~~~~Ki~~i~~~i~~~~sG~~~D~~~l~~~~r~~~~~~~~~~~~~i~~~~la~~ls~~~~~~~~~~   80 (202)
                      ||+|+|.++|+++.++++|||+|++||+|+++|+.+|++.|++.+|.+++.|+++++++|+++.++++|++++|.||+++
T Consensus        48 lAaD~r~t~gl~~~~~~~KI~~I~d~i~~~~aG~~aD~~~l~~~lr~e~~~y~~~~~~~i~v~~lA~~l~~~l~~yt~~~  127 (288)
T 3nzj_F           48 FAVEKLITSKLLVPQKNVKIQVVDRHIGCVYSGLIPDGRHLVNRGREEAASFKKLYKTPIPIPAFADRLGQYVQAHTLYN  127 (288)
T ss_dssp             EEEEEEECCTTBCTTCSCCCEEETTTEEEEEEECHHHHHHHHHHHHHHHHHHHHHHSSCCCHHHHHHHHHHHHHHTTSCT
T ss_pred             EEEcCCcccCCccccccceEEEEcCCEEEEecCcHHHHHHHHHHHHHHHHHHHHHcCCcCCHHHHHHHHHHHHHHHHHhc
Confidence            68999999999888888999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cccceeeeEEEEEEeCCCCeEEEECCCcceeeeeEEeeCCChHHHHHHHHhc---CCCCCCHHHHHHHHHHHHHHhhhcc
Q 028888           81 WLRPFGCGVILGGYDRDGPQLYMIEPSGISYRYFGAAIGKGRQAAKTEIEKL---KLSEMTCRQGVIEVAKIIYGVHDEA  157 (202)
Q Consensus        81 ~~rP~~~~~iiaG~D~~gp~Ly~~d~~G~~~~~~~~a~G~gs~~~~~~Le~~---~~~~~s~~eai~la~~~l~~~~~~~  157 (202)
                      ++|||+|++||+|||++||+||++||+|++.+++++|+|+|++.++++||+.   |+++||++||++++++||..+++++
T Consensus       128 ~~rP~gv~~lvaG~D~~Gp~Ly~iDp~G~~~~~~~~aiGsgs~~a~~~Lek~~~~~~~~ms~eEAv~la~~al~~a~~~~  207 (288)
T 3nzj_F          128 SVRPFGVSTIFGGVDKNGAHLYMLEPSGSYWGYKGAATGKGRQSAKAELEKLVDHHPEGLSAREAVKQAAKIIYLAHEDN  207 (288)
T ss_dssp             TBCCCCEEEEEEEEETTEEEEEEECTTSCEEEBSEEEESTTHHHHHHHHHHHHHHCTTCCCHHHHHHHHHHHHHHHGGGG
T ss_pred             cCCCceEEEEEEEEeCCCCEEEEECCCCCEEEcCEEEEcCcHHHHHHHHHHhccccCCCCCHHHHHHHHHHHHHHHHhcc
Confidence            9999999999999999999999999999999999999999999999999999   9999999999999999999999998


Q ss_pred             CCCCceEEEEEEEe-cCCCeEEEcCHHHHHHHHHHHHHhhhhccc
Q 028888          158 KDKAFELEMSWVCD-ESNRQHQKVPDELLEEAKAAARAALEEMDA  201 (202)
Q Consensus       158 ~~~~~~iei~~i~~-~~~~~~~~l~~~~i~~~~~~~~~~~~~~~~  201 (202)
                      ..+++.+||+||++ ++++.|+.+|++++++..+.++.++|++|.
T Consensus       208 ~~~~~~iev~vIt~~~~~~~~~~vp~~~~~~~~~~~~~~~~~~~~  252 (288)
T 3nzj_F          208 KEKDFELEISWCSLSETNGLHKFVKGDLLQEAIDFAQKEINGDDD  252 (288)
T ss_dssp             TTSEEEEEEEEEETTTSTTCCEECCHHHHHHHHHHHHHHTC----
T ss_pred             cCCCCeEEEEEEEecCCCceEEECCHHHHHHHHHHHHHHhhcccc
Confidence            88889999999998 778889999999999999999999988775
>1iru_G 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_F* 3une_F 3unf_F* 3unh_F Back     alignment and structure
>3h4p_A Proteasome subunit alpha; core particle, cytoplasm, hydrolase, protease, threonine protease; 4.10A {Methanocaldococcus jannaschii} Back     alignment and structure
>1ryp_A 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_G* 1g65_G 1vsy_A 2f16_G* 2fak_G* 2fny_G* 2gpl_G* 3d29_G* 3dy3_G* 3dy4_G* 3e47_G* 3gpj_G* 3gpt_G* 3gpw_G* 3hye_G* 3l5q_A 3mg0_G* 3mg4_G* 3oeu_G* 3oev_G* ... Back     alignment and structure
>1iru_C 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_B* 3une_B 3unf_B* 3unh_B Back     alignment and structure
>1ryp_C 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_B* 1g65_B 2f16_B* 2fak_B* 2fny_B* 2gpl_B* 3d29_B* 3dy3_B* 3dy4_B* 3e47_B* 3gpj_B* 3gpt_B* 3gpw_B* 3hye_B* 3mg0_B* 3mg4_B* 3okj_B* 3shj_B* 3tdd_B* 3nzj_B* ... Back     alignment and structure
>1j2p_A Alpha-ring, proteasome alpha subunit; hydrolase; 2.60A {Archaeoglobus fulgidus} SCOP: d.153.1.4 PDB: 1j2q_A* Back     alignment and structure
>1ryp_E 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_D* 1g65_D 2f16_D* 2fak_D* 2fny_D* 2gpl_D* 3d29_D* 3dy3_D* 3dy4_D* 3e47_D* 3gpj_D* 3gpt_D* 3gpw_D* 3hye_D* 3mg0_D* 3mg4_D* 3okj_D* 3shj_D* 3tdd_D* 2z5c_C ... Back     alignment and structure
>1iru_A 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_G* 3une_G 3unf_G* 3unh_G Back     alignment and structure
>1ryp_G 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_F* 1g65_F 1vsy_G 2f16_F* 2fak_F* 2fny_F* 2gpl_F* 3d29_F* 3dy3_F* 3dy4_F* 3e47_F* 3gpj_F* 3gpt_F* 3gpw_F* 3hye_F* 3l5q_L 3mg0_F* 3mg4_F* 3okj_F* 3shj_F* ... Back     alignment and structure
>1ryp_D 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_C* 1g65_C 2f16_C* 2fak_C* 2fny_C* 2gpl_C* 3d29_C* 3dy3_C* 3dy4_C* 3e47_C* 3gpj_C* 3gpt_C* 3gpw_C* 3hye_C* 3mg0_C* 3mg4_C* 3oeu_C* 3oev_C* 3okj_C* 3shj_C* ... Back     alignment and structure
>1yar_A Proteasome alpha subunit; proteasome 20S, PA26 proteasome activator 11S, hydrolase-HYD activator complex; 1.90A {Thermoplasma acidophilum} SCOP: d.153.1.4 PDB: 1ya7_A 1pma_A 3c91_A 3c92_A 3ipm_A 2ku1_A 2ku2_A 1yau_A 3jrm_A 3jse_A 3jtl_A Back     alignment and structure
>1iru_B 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_A* 3une_A 3unf_A* 3unh_A Back     alignment and structure
>3h4p_a Proteasome subunit beta; core particle, cytoplasm, hydrolase, protease, threonine protease; 4.10A {Methanocaldococcus jannaschii} Back     alignment and structure
>1iru_D 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unf_C* 3une_C* 3unh_C 3unb_C* Back     alignment and structure
>1iru_E 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_D* 3une_D 3unf_D* 3unh_D Back     alignment and structure
>1j2q_H Proteasome beta subunit; ubiquitin, CP, hydrolase; HET: CIB; 2.83A {Archaeoglobus fulgidus} SCOP: d.153.1.4 Back     alignment and structure
>1yar_H Proteasome beta subunit; proteasome 20S, PA26 proteasome activator 11S, hydrolase-HYD activator complex; 1.90A {Thermoplasma acidophilum} SCOP: d.153.1.4 PDB: 1ya7_H 1yau_H 3ipm_H 1pma_B 3jrm_H 3c92_H 3c91_H 3jse_H 3jtl_H Back     alignment and structure
>1ryp_F 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_E* 1g65_E 2f16_E* 2fak_E* 2fny_E* 2gpl_E* 3d29_E* 3dy3_E* 3dy4_E* 3e47_E* 3gpj_E* 3gpt_E* 3gpw_E* 3hye_E* 3mg0_E* 3mg4_E* 3oeu_E* 3oev_E* 3okj_E* 3shj_E* ... Back     alignment and structure
>1ryp_B 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_B 1g0u_A* 1jd2_A* 1g65_A 1z7q_B 2f16_A* 2fak_A* 2fny_A* 2gpl_A* 2zcy_A* 3bdm_A* 3d29_A* 3dy3_A* 3dy4_A* 3e47_A* 3gpj_A* 3gpt_A* 3gpw_A* 3hye_A* 3mg0_A* ... Back     alignment and structure
>1iru_F 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_E* 3une_E 3unf_E* 3unh_E Back     alignment and structure
>3mi0_A Proteasome subunit alpha; enzyme inhibitors, lactones, proteasome endopeptidase comple mycobacterium tuberculosis, hydrolase; HET: SA6; 2.20A {Mycobacterium tuberculosis} SCOP: d.153.1.4 PDB: 3h6f_A 3krd_A* 3h6i_A* 3mka_A 2fhh_A* 2fhg_A 3hfa_D 3hf9_A 3mfe_D Back     alignment and structure
>1ryp_L 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_L 1vsy_L 1z7q_L 3l5q_P 1g65_K* 1g0u_K* 1jd2_K* 2f16_K* 2fak_K* 2fny_K* 2gpl_K* 2zcy_K* 3bdm_K* 3d29_K* 3dy3_K* 3dy4_K* 3e47_K* 3gpj_K* 3gpt_K* 3gpw_K* ... Back     alignment and structure
>1iru_L 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_K* 3une_K 3unf_K* 3unh_K Back     alignment and structure
>1iru_H 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_N* 3une_N Back     alignment and structure
>1q5q_H Proteasome beta-type subunit 1; proteasome assembly, Pro-peptide, inter-subunit contacts, RH erythropolis, hydrolase; 2.60A {Rhodococcus erythropolis} SCOP: d.153.1.4 Back     alignment and structure
>3nzj_K Proteasome component PRE2; ubiquitin, protein degradation, N-terminal nucleophilic HYDR 19S regulatory particle; HET: TY5 TRO MES; 2.40A {Saccharomyces cerevisiae} PDB: 3nzw_K* 3nzx_K* 4b4t_5 Back     alignment and structure
>1ryp_K 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_K 1g0u_J* 1jd2_J* 1g65_J 1vsy_K 1z7q_K 2f16_J* 2fak_J* 2fny_J* 2gpl_J* 2zcy_J* 3bdm_J* 3d29_J* 3dy3_J* 3dy4_J* 3e47_J* 3gpj_J* 3gpt_J* 3gpw_J* 3hye_J* ... Back     alignment and structure
>3unf_H Proteasome subunit beta type-10; antigen presentation, drug development, protein degradation, hydrolase-hydrolase inhibitor complex; HET: 04C; 2.90A {Mus musculus} PDB: 3unh_H Back     alignment and structure
>1q5r_H Proteasome beta-type subunit 1; proteasome assembly, Pro-peptide, inter-subunit contacts, hydrolase; 3.10A {Rhodococcus erythropolis} SCOP: d.153.1.4 PDB: 2h6j_H Back     alignment and structure
>1q5q_A Proteasome alpha-type subunit 1; proteasome assembly, Pro-peptide, inter-subunit contacts, RH erythropolis, hydrolase; 2.60A {Rhodococcus erythropolis} SCOP: d.153.1.4 PDB: 2h6j_A 1q5r_A Back     alignment and structure
>1iru_N 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_M* 3une_M 3unf_M* 3unh_M Back     alignment and structure
>1ryp_N 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_N* 1jd2_M* 1g65_M 1vsy_N 1z7q_N 2f16_M* 2fak_M* 2fny_M* 2gpl_M* 3d29_M* 3dy3_M* 3dy4_M* 3e47_M* 3gpj_M* 3gpt_M* 3gpw_M* 3hye_M* 3l5q_R 3mg0_M* 3mg4_M* ... Back     alignment and structure
>1iru_M 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_L* 3une_L 3unf_L* 3unh_L Back     alignment and structure
>3unf_N Proteasome subunit beta type-9; antigen presentation, drug development, protein degradation, hydrolase-hydrolase inhibitor complex; HET: 04C; 2.90A {Mus musculus} PDB: 3unh_N Back     alignment and structure
>1ryp_I 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1g0u_H* 1jd2_H* 1g65_H 1vsy_I 1z7q_I 2f16_H* 2fak_H* 2fny_H* 2gpl_H* 3d29_H* 3dy3_H* 3dy4_H* 3e47_H* 3gpj_H* 3gpt_H* 3gpw_H* 3hye_H* 3l5q_M 3mg0_H* 3mg4_H* ... Back     alignment and structure
>1iru_J 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_I* 3une_I 3unf_I* 3unh_I Back     alignment and structure
>1ryp_J 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_I* 1g65_I 1vsy_J 2f16_I* 2fak_I* 2fny_I* 2gpl_I* 3d29_I* 3dy3_I* 3dy4_I* 3e47_I* 3gpj_I* 3gpt_I* 3gpw_I* 3hye_I* 3l5q_N 3mg0_I* 3mg4_I* 3oeu_I* 3oev_I* ... Back     alignment and structure
>2jay_A Proteasome; hydrolase; 1.99A {Mycobacterium tuberculosis} PDB: 3mka_C 3mi0_C* 2fhg_H* 2fhh_H 3krd_C* 3mfe_G 3hfa_H* 3h6i_C 3h6f_C 3hf9_H 3mfe_H Back     alignment and structure
>1ryp_H 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 3nzj_N* 3nzw_N* 3nzx_N* 1vsy_H 3l5q_B 1g65_N* 1fnt_H 1g0u_N* 1jd2_N* 1z7q_H 2f16_N* 2fak_N* 2fny_N* 2gpl_N* 2zcy_N* 3bdm_N* 3d29_N* 3dy3_N* 3dy4_N* 3e47_N* ... Back     alignment and structure
>1ryp_M 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_M* 1jd2_L* 1g65_L 1vsy_M 1z7q_M 2f16_L* 2fak_L* 2fny_L* 2gpl_L* 3d29_L* 3dy3_L* 3dy4_L* 3e47_L* 3gpj_L* 3gpt_L* 3gpw_L* 3hye_L* 3l5q_Q 3mg0_L* 3mg4_L* ... Back     alignment and structure
>1iru_K 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_J* 3une_J 3unf_J* 3unh_J Back     alignment and structure
>1g0u_M Proteasome component PRE4; ubiquitin, degradation, protease, NTN-hydrolase; 2.40A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 2zcy_M* 3bdm_M* 3mg6_M* 3mg7_M* 3mg8_M* 3nzj_M* 3nzw_M* 3nzx_M* Back     alignment and structure
>1iru_I 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_H* 3une_H Back     alignment and structure
>3nzj_H Proteasome component PUP1; ubiquitin, protein degradation, N-terminal nucleophilic HYDR 19S regulatory particle; HET: TY5 TRO MES; 2.40A {Saccharomyces cerevisiae} PDB: 3nzw_H* 3nzx_H* 4b4t_2 Back     alignment and structure
>1g3k_A ATP-dependent protease HSLV; hydrolase; 1.90A {Haemophilus influenzae} SCOP: d.153.1.4 PDB: 1g3i_G 1jjw_A 1kyi_G* 1ofh_G* 1ofi_G* 1e94_A* 1g4a_B* 1g4b_M 1hqy_A* 1ht1_C* 1ht2_A* 1ned_A Back     alignment and structure
>1m4y_A ATP-dependent protease HSLV; N-terminal catalytic threonine residue, hydrolase; 2.10A {Thermotoga maritima} SCOP: d.153.1.4 Back     alignment and structure
>2z3b_A ATP-dependent protease HSLV; N-terminal nucleophIle hydrolase; 2.50A {Bacillus subtilis} SCOP: d.153.1.4 PDB: 2z3a_A 1yyf_D* 3ty6_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 202
d1irug_245 d.153.1.4 (G:) Proteasome alpha subunit (non-catal 3e-60
d1rypg_244 d.153.1.4 (G:) Proteasome alpha subunit (non-catal 2e-51
d1irue_234 d.153.1.4 (E:) Proteasome alpha subunit (non-catal 3e-39
d1j2pa_243 d.153.1.4 (A:) Proteasome alpha subunit (non-catal 3e-36
d1yara1221 d.153.1.4 (A:13-233) Proteasome alpha subunit (non 8e-36
d1iruc_250 d.153.1.4 (C:) Proteasome alpha subunit (non-catal 1e-35
d1rypf_233 d.153.1.4 (F:) Proteasome alpha subunit (non-catal 1e-35
d1irua_244 d.153.1.4 (A:) Proteasome alpha subunit (non-catal 2e-35
d1iruf_238 d.153.1.4 (F:) Proteasome alpha subunit (non-catal 9e-35
d1rypb_250 d.153.1.4 (B:) Proteasome alpha subunit (non-catal 1e-34
d1rypc_244 d.153.1.4 (C:) Proteasome alpha subunit (non-catal 3e-34
d1rype_242 d.153.1.4 (E:) Proteasome alpha subunit (non-catal 1e-32
d1irud_243 d.153.1.4 (D:) Proteasome alpha subunit (non-catal 6e-32
d1irub_233 d.153.1.4 (B:) Proteasome alpha subunit (non-catal 1e-30
d1rypa_243 d.153.1.4 (A:) Proteasome alpha subunit (non-catal 4e-29
d1rypd_241 d.153.1.4 (D:) Proteasome alpha subunit (non-catal 8e-28
d1q5qa_227 d.153.1.4 (A:) Proteasome alpha subunit (non-catal 5e-22
d1yarh1203 d.153.1.4 (H:1-203) Proteasome beta subunit (catal 5e-22
d1rypi_222 d.153.1.4 (I:) Proteasome beta subunit (catalytic) 5e-21
d1irui_220 d.153.1.4 (I:) Proteasome beta subunit (catalytic) 2e-20
d1irul_201 d.153.1.4 (L:) Proteasome beta subunit (catalytic) 3e-20
d1j2qh_202 d.153.1.4 (H:) Proteasome beta subunit (catalytic) 4e-20
d1iruh_202 d.153.1.4 (H:) Proteasome beta subunit (catalytic) 4e-20
d1ryp1_222 d.153.1.4 (1:) Proteasome beta subunit (catalytic) 5e-20
d1ryp2_233 d.153.1.4 (2:) Proteasome beta subunit (catalytic) 4e-17
d1rypk_198 d.153.1.4 (K:) Proteasome beta subunit (catalytic) 1e-16
d1rypl_212 d.153.1.4 (L:) Proteasome beta subunit (catalytic) 2e-16
d1ryph_205 d.153.1.4 (H:) Proteasome beta subunit (catalytic) 5e-16
d1iru2_217 d.153.1.4 (2:) Proteasome beta subunit (catalytic) 6e-16
d1q5qh_224 d.153.1.4 (H:) Proteasome beta subunit (catalytic) 1e-14
d1iruk_199 d.153.1.4 (K:) Proteasome beta subunit (catalytic) 8e-14
d1iruj_204 d.153.1.4 (J:) Proteasome beta subunit (catalytic) 1e-12
>d1irug_ d.153.1.4 (G:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 245 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ntn hydrolase-like
superfamily: N-terminal nucleophile aminohydrolases (Ntn hydrolases)
family: Proteasome subunits
domain: Proteasome alpha subunit (non-catalytic)
species: Cow (Bos taurus) [TaxId: 9913]

 Score =  186 bits (473), Expect = 3e-60
 Identities = 117/199 (58%), Positives = 147/199 (73%), Gaps = 1/199 (0%)

Query: 1   MGVEKLIASKMMLPGSNRRIHSVHRHSGMAVAGLAADGRQIVTRAKSEATNYESVYGEPI 60
            GVEKL+ SK+   GSN+R+ +V RH GMAVAGL AD R +   A+ EA+N+ S +G  I
Sbjct: 47  FGVEKLVLSKLYEEGSNKRLFNVDRHVGMAVAGLLADARSLADIAREEASNFRSNFGYNI 106

Query: 61  PVKELAQRVASYVHLCTLYWWLRPFGCGVILGGYDRDG-PQLYMIEPSGISYRYFGAAIG 119
           P+K LA RVA YVH  TLY  +RPFGC  +LG Y  +   QLYMI+PSG+SY Y+G AIG
Sbjct: 107 PLKHLADRVAMYVHAYTLYSAVRPFGCSFMLGSYSVNDGAQLYMIDPSGVSYGYWGCAIG 166

Query: 120 KGRQAAKTEIEKLKLSEMTCRQGVIEVAKIIYGVHDEAKDKAFELEMSWVCDESNRQHQK 179
           K RQAAKTEIEKL++ EMTCR  V EVAKIIY VHDE KDKAFELE+SWV + +N +H+ 
Sbjct: 167 KARQAAKTEIEKLQMKEMTCRDIVKEVAKIIYIVHDEVKDKAFELELSWVGELTNGRHEI 226

Query: 180 VPDELLEEAKAAARAALEE 198
           VP ++ EEA+  A+ +L+E
Sbjct: 227 VPKDIREEAEKYAKESLKE 245
>d1rypg_ d.153.1.4 (G:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 244 Back     information, alignment and structure
>d1irue_ d.153.1.4 (E:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 234 Back     information, alignment and structure
>d1j2pa_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 243 Back     information, alignment and structure
>d1yara1 d.153.1.4 (A:13-233) Proteasome alpha subunit (non-catalytic) {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 221 Back     information, alignment and structure
>d1iruc_ d.153.1.4 (C:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 250 Back     information, alignment and structure
>d1rypf_ d.153.1.4 (F:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 233 Back     information, alignment and structure
>d1irua_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 244 Back     information, alignment and structure
>d1iruf_ d.153.1.4 (F:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 238 Back     information, alignment and structure
>d1rypb_ d.153.1.4 (B:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 250 Back     information, alignment and structure
>d1rypc_ d.153.1.4 (C:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 244 Back     information, alignment and structure
>d1rype_ d.153.1.4 (E:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 242 Back     information, alignment and structure
>d1irud_ d.153.1.4 (D:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 243 Back     information, alignment and structure
>d1irub_ d.153.1.4 (B:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 233 Back     information, alignment and structure
>d1rypa_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 243 Back     information, alignment and structure
>d1rypd_ d.153.1.4 (D:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 241 Back     information, alignment and structure
>d1q5qa_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Rhodococcus erythropolis [TaxId: 1833]} Length = 227 Back     information, alignment and structure
>d1yarh1 d.153.1.4 (H:1-203) Proteasome beta subunit (catalytic) {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 203 Back     information, alignment and structure
>d1rypi_ d.153.1.4 (I:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 222 Back     information, alignment and structure
>d1irui_ d.153.1.4 (I:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 220 Back     information, alignment and structure
>d1irul_ d.153.1.4 (L:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 201 Back     information, alignment and structure
>d1j2qh_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 202 Back     information, alignment and structure
>d1iruh_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 202 Back     information, alignment and structure
>d1ryp1_ d.153.1.4 (1:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 222 Back     information, alignment and structure
>d1ryp2_ d.153.1.4 (2:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 233 Back     information, alignment and structure
>d1rypk_ d.153.1.4 (K:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 198 Back     information, alignment and structure
>d1rypl_ d.153.1.4 (L:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 212 Back     information, alignment and structure
>d1ryph_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 205 Back     information, alignment and structure
>d1iru2_ d.153.1.4 (2:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 217 Back     information, alignment and structure
>d1q5qh_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Rhodococcus erythropolis [TaxId: 1833]} Length = 224 Back     information, alignment and structure
>d1iruk_ d.153.1.4 (K:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 199 Back     information, alignment and structure
>d1iruj_ d.153.1.4 (J:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 204 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query202
d1irug_245 Proteasome alpha subunit (non-catalytic) {Cow (Bos 100.0
d1iruc_250 Proteasome alpha subunit (non-catalytic) {Cow (Bos 100.0
d1j2pa_243 Proteasome alpha subunit (non-catalytic) {Archaeon 100.0
d1irua_244 Proteasome alpha subunit (non-catalytic) {Cow (Bos 100.0
d1yara1221 Proteasome alpha subunit (non-catalytic) {Archaeon 100.0
d1rypg_244 Proteasome alpha subunit (non-catalytic) {Baker's 100.0
d1irue_234 Proteasome alpha subunit (non-catalytic) {Cow (Bos 100.0
d1rypf_233 Proteasome alpha subunit (non-catalytic) {Baker's 100.0
d1irud_243 Proteasome alpha subunit (non-catalytic) {Cow (Bos 100.0
d1rype_242 Proteasome alpha subunit (non-catalytic) {Baker's 100.0
d1rypb_250 Proteasome alpha subunit (non-catalytic) {Baker's 100.0
d1iruf_238 Proteasome alpha subunit (non-catalytic) {Cow (Bos 100.0
d1rypc_244 Proteasome alpha subunit (non-catalytic) {Baker's 100.0
d1rypa_243 Proteasome alpha subunit (non-catalytic) {Baker's 100.0
d1rypd_241 Proteasome alpha subunit (non-catalytic) {Baker's 100.0
d1yarh1203 Proteasome beta subunit (catalytic) {Archaeon Ther 100.0
d1irul_201 Proteasome beta subunit (catalytic) {Cow (Bos taur 100.0
d1irub_233 Proteasome alpha subunit (non-catalytic) {Cow (Bos 100.0
d1j2qh_202 Proteasome beta subunit (catalytic) {Archaeon Arch 100.0
d1rypk_198 Proteasome beta subunit (catalytic) {Baker's yeast 100.0
d1rypl_212 Proteasome beta subunit (catalytic) {Baker's yeast 100.0
d1ryph_205 Proteasome beta subunit (catalytic) {Baker's yeast 100.0
d1iruh_202 Proteasome beta subunit (catalytic) {Cow (Bos taur 100.0
d1q5qa_227 Proteasome alpha subunit (non-catalytic) {Rhodococ 100.0
d1irui_220 Proteasome beta subunit (catalytic) {Cow (Bos taur 100.0
d1rypi_222 Proteasome beta subunit (catalytic) {Baker's yeast 100.0
d1ryp2_233 Proteasome beta subunit (catalytic) {Baker's yeast 100.0
d1q5qh_224 Proteasome beta subunit (catalytic) {Rhodococcus e 100.0
d1iruj_204 Proteasome beta subunit (catalytic) {Cow (Bos taur 100.0
d1rypj_204 Proteasome beta subunit (catalytic) {Baker's yeast 100.0
d1iru2_217 Proteasome beta subunit (catalytic) {Cow (Bos taur 100.0
d1ryp1_222 Proteasome beta subunit (catalytic) {Baker's yeast 100.0
d1iruk_199 Proteasome beta subunit (catalytic) {Cow (Bos taur 100.0
d1iru1_213 Proteasome beta subunit (catalytic) {Cow (Bos taur 100.0
d2z3ba1180 HslV (ClpQ) protease {Bacillus subtilis [TaxId: 14 99.79
d1m4ya_171 HslV (ClpQ) protease {Thermotoga maritima [TaxId: 99.78
d1g3ka_173 HslV (ClpQ) protease {Haemophilus influenzae [TaxI 99.73
d1cuka148 DNA helicase RuvA subunit, C-terminal domain {Esch 86.22
>d1irug_ d.153.1.4 (G:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ntn hydrolase-like
superfamily: N-terminal nucleophile aminohydrolases (Ntn hydrolases)
family: Proteasome subunits
domain: Proteasome alpha subunit (non-catalytic)
species: Cow (Bos taurus) [TaxId: 9913]

Probab=100.00  E-value=1.7e-47  Score=310.90  Aligned_cols=198  Identities=60%  Similarity=0.942  Sum_probs=186.1

Q ss_pred             CcccccCCCCCcccCCcCceEEecCcEEEEEecchhhHHHHHHHHHHHHHHhHHHhCCCCCHHHHHHHHHHHHHHhhhcc
Q 028888            1 MGVEKLIASKMMLPGSNRRIHSVHRHSGMAVAGLAADGRQIVTRAKSEATNYESVYGEPIPVKELAQRVASYVHLCTLYW   80 (202)
Q Consensus         1 la~d~r~~~~l~~~~~~~Ki~~i~~~i~~~~sG~~~D~~~l~~~~r~~~~~~~~~~~~~i~~~~la~~ls~~~~~~~~~~   80 (202)
                      ||+|+|.+++++..++.+|||+|++|++|++||+.+|++.+++.+|.+++.|++++|++|+++.+++.|++++|.||+++
T Consensus        47 laad~~~~~~~~~~~~~~Ki~~I~~~i~~~~sG~~~D~~~l~~~~~~~~~~~~~~~g~~i~~~~la~~la~~~~~~t~~~  126 (245)
T d1irug_          47 FGVEKLVLSKLYEEGSNKRLFNVDRHVGMAVAGLLADARSLADIAREEASNFRSNFGYNIPLKHLADRVAMYVHAYTLYS  126 (245)
T ss_dssp             EEEEEECSCTTBCTTTTCCEEEEETTEEEEEEECHHHHHHHHHHHHHHHHHHHHHHSSCCCHHHHHHHHHHHHHHTTSBS
T ss_pred             EEEeccccccccccCccceEEEcCCCEEEEeccCchhHHHHHHHHHHHHHHHHHHhCCCCCHHHHHHHHHHHHHHhhccc
Confidence            68999999999888888999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cccceeeeEEEEEEeCC-CCeEEEECCCcceeeeeEEeeCCChHHHHHHHHhcCCCCCCHHHHHHHHHHHHHHhhhccCC
Q 028888           81 WLRPFGCGVILGGYDRD-GPQLYMIEPSGISYRYFGAAIGKGRQAAKTEIEKLKLSEMTCRQGVIEVAKIIYGVHDEAKD  159 (202)
Q Consensus        81 ~~rP~~~~~iiaG~D~~-gp~Ly~~d~~G~~~~~~~~a~G~gs~~~~~~Le~~~~~~~s~~eai~la~~~l~~~~~~~~~  159 (202)
                      ++|||+|++||+|||++ ||+||++||+|++.+++++|+|++++.++++||+.|+++||++||++++++||+.+++++..
T Consensus       127 ~~rP~~vs~li~G~D~~~gp~Ly~iDp~G~~~~~~~~a~G~gs~~a~~~Le~~~~~dmt~eea~~l~~~~l~~~~~~~~~  206 (245)
T d1irug_         127 AVRPFGCSFMLGSYSVNDGAQLYMIDPSGVSYGYWGCAIGKARQAAKTEIEKLQMKEMTCRDIVKEVAKIIYIVHDEVKD  206 (245)
T ss_dssp             SBCCCSEEEEEEEEETTTEEEEEEECTTCCEEEBSEEEESTTHHHHHHHHTTSCGGGCCHHHHHHHHHHHHHHHSCSSSS
T ss_pred             cccccceEEEEEEEcCCCCceEEEEcCCceEEeeeEEEECCccHHHHHHHHhhcCCCCCHHHHHHHHHHHHHHHHhhccC
Confidence            99999999999999965 79999999999999999999999999999999999999999999999999999999988777


Q ss_pred             CCceEEEEEEEecCCCeEEEcCHHHHHHHHHHHHHhhhh
Q 028888          160 KAFELEMSWVCDESNRQHQKVPDELLEEAKAAARAALEE  198 (202)
Q Consensus       160 ~~~~iei~~i~~~~~~~~~~l~~~~i~~~~~~~~~~~~~  198 (202)
                      +.++|||++|++++++.++.+|++..+++.+.+....||
T Consensus       207 ~~~~iei~~v~~~~~~~~~~~~~e~~~~~~~~~~~~~~~  245 (245)
T d1irug_         207 KAFELELSWVGELTNGRHEIVPKDIREEAEKYAKESLKE  245 (245)
T ss_dssp             CCEEEEEEECBTTTTTCCEECCHHHHHHHHHHHHHHHCC
T ss_pred             CCceEEEEEEEecCCCeEEEChHHHHHHHHHHHHHhhcC
Confidence            888899999999878888889988777777777666553
>d1iruc_ d.153.1.4 (C:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1j2pa_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1irua_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1yara1 d.153.1.4 (A:13-233) Proteasome alpha subunit (non-catalytic) {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1rypg_ d.153.1.4 (G:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1irue_ d.153.1.4 (E:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1rypf_ d.153.1.4 (F:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1irud_ d.153.1.4 (D:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1rype_ d.153.1.4 (E:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rypb_ d.153.1.4 (B:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1iruf_ d.153.1.4 (F:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1rypc_ d.153.1.4 (C:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rypa_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rypd_ d.153.1.4 (D:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yarh1 d.153.1.4 (H:1-203) Proteasome beta subunit (catalytic) {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1irul_ d.153.1.4 (L:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1irub_ d.153.1.4 (B:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1j2qh_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1rypk_ d.153.1.4 (K:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rypl_ d.153.1.4 (L:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ryph_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1iruh_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1q5qa_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Rhodococcus erythropolis [TaxId: 1833]} Back     information, alignment and structure
>d1irui_ d.153.1.4 (I:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1rypi_ d.153.1.4 (I:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ryp2_ d.153.1.4 (2:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q5qh_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Rhodococcus erythropolis [TaxId: 1833]} Back     information, alignment and structure
>d1iruj_ d.153.1.4 (J:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1rypj_ d.153.1.4 (J:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1iru2_ d.153.1.4 (2:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ryp1_ d.153.1.4 (1:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1iruk_ d.153.1.4 (K:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1iru1_ d.153.1.4 (1:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2z3ba1 d.153.1.4 (A:1-180) HslV (ClpQ) protease {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1m4ya_ d.153.1.4 (A:) HslV (ClpQ) protease {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1g3ka_ d.153.1.4 (A:) HslV (ClpQ) protease {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1cuka1 a.5.1.1 (A:156-203) DNA helicase RuvA subunit, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure