Citrus Sinensis ID: 028925

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200--
MNVARYDFACAEVNGKIYAVGGYGMDGESLSSAEVYDPDTDKWNLIESLRRPRWGCFACSFDGKLYVMGGRSSFTIGNSKFVDVYNPERHTWCQMKNGCVMVTAHAVVGKKLFCMEWKNQRKLTIFDPEDNSWKMVPVPLTGSSSIGFRFGILDGKLLLFSLEEEPSYSTLLYDPNAASGSEWQTSKIKPSGLCLCSVTIKA
cccccccEEEEEEccEEEEEcccccccccccEEEEEEcccccEEEccccccccEEEEEEEEccEEEEEccccccccccccEEEEEEcccccEEEcccccccccEEEEEccEEEEEEcccccEEEEEEcccccEEEEccccccccccccEEEEEccEEEEEEcccccccEEEEEEccccccEEEEccccccccEEEEEEEEEc
ccccccccEEEEEccEEEEEEccccccccccEEEEEccccccEEEcccccccccccEEEEEccEEEEEEcccccccccccEEEEEccccccEEEEccccccccEEEEEccEEEEEEccccccEEEEccccccEEEEccccccccccEEEEEEEccEEEEEEcccccccccEEEccccccccEEEEcccccccccEEEEEEEc
MNVARYDFACAEVNGKIyavggygmdgeslssaevydpdtdkwnlieslrrprwgcfacsfdgklyvmggrssftignskfvdvynperhtwcqmkngcVMVTAHAVVGKKLFCMEWknqrkltifdpednswkmvpvpltgsssigfrfgILDGKLLLfsleeepsystllydpnaasgsewqtskikpsglclcsvtika
MNVARYDFACAEVNGKIYAVGGYGMDGESLSSAEVYDPDTDKWNLIESLRRPRWGCFACSFDGKLYVMGGRSSFTIGNSKFVDVYNPERHTWCQMKNGCVMVTAHAVVGKKLFCMEWKNQRkltifdpednsWKMVPVPLTGSSSIGFRFGILDGKLLLFSLEEEPSYSTLLYDPNAASgsewqtskikpsglclcsvtika
MNVARYDFACAEVNGKIYAVGGYGMDGESLSSAEVYDPDTDKWNLIESLRRPRWGCFACSFDGKLYVMGGRSSFTIGNSKFVDVYNPERHTWCQMKNGCVMVTAHAVVGKKLFCMEWKNQRKLTIFDPEDNSWKMVPVPLTGSSSIGFRFGILDGKLLLFSLEEEPSYSTLLYDPNAASGSEWQTSKIKPSGLCLCSVTIKA
***ARYDFACAEVNGKIYAVGGYGMDGESLSSAEVYDPDTDKWNLIESLRRPRWGCFACSFDGKLYVMGGRSSFTIGNSKFVDVYNPERHTWCQMKNGCVMVTAHAVVGKKLFCMEWKNQRKLTIFDPEDNSWKMVPVPLTGSSSIGFRFGILDGKLLLFSLEEEPSYSTLLYDP************IKPSGLCLCSVT***
**VARYDFACAEVNGKIYAVGGYGMDGESLSSAEVYDPDTDKWNLIESLRRPRWGCFACSFDGKLYVMGGRSSFTIGNSKFVDVYNPERHTWCQMKNGCVMVTAHAVVGKKLFCMEWKNQRKLTIFDPEDNSWKMVPVPLTGSSSIGFRFGILDGKLLLFSLEEEPSYSTLLYDPNAASGSEWQTSKIKPSGLCLCSVTIKA
MNVARYDFACAEVNGKIYAVGGYGMDGESLSSAEVYDPDTDKWNLIESLRRPRWGCFACSFDGKLYVMGGRSSFTIGNSKFVDVYNPERHTWCQMKNGCVMVTAHAVVGKKLFCMEWKNQRKLTIFDPEDNSWKMVPVPLTGSSSIGFRFGILDGKLLLFSLEEEPSYSTLLYDPNAASGSEWQTSKIKPSGLCLCSVTIKA
****RYDFACAEVNGKIYAVGGYGMDGESLSSAEVYDPDTDKWNLIESLRRPRWGCFACSFDGKLYVMGGRSSFTIGNSKFVDVYNPERHTWCQMKNGCVMVTAHAVVGKKLFCMEWKNQRKLTIFDPEDNSWKMVPVPLTGSSSIGFRFGILDGKLLLFSLEEEPSYSTLLYDPNAASGSEWQTSKIKPSGLCLCSVTIKA
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNVARYDFACAEVNGKIYAVGGYGMDGESLSSAEVYDPDTDKWNLIESLRRPRWGCFACSFDGKLYVMGGRSSFTIGNSKFVDVYNPERHTWCQMKNGCVMVTAHAVVGKKLFCMEWKNQRKLTIFDPEDNSWKMVPVPLTGSSSIGFRFGILDGKLLLFSLEEEPSYSTLLYDPNAASGSEWQTSKIKPSGLCLCSVTIKA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query202 2.2.26 [Sep-21-2011]
Q9CAG8376 F-box/kelch-repeat protei yes no 1.0 0.537 0.668 3e-78
Q9FZJ3346 Putative F-box/kelch-repe no no 0.940 0.549 0.405 2e-34
Q920Q8642 Influenza virus NS1A-bind no no 0.777 0.244 0.296 7e-15
Q9Y6Y0642 Influenza virus NS1A-bind yes no 0.777 0.244 0.284 1e-12
Q6DFU2638 Influenza virus NS1A-bind N/A no 0.777 0.246 0.284 2e-12
Q0WW40383 F-box/kelch-repeat protei no no 0.594 0.313 0.320 1e-11
Q04652 1477 Ring canal kelch protein no no 0.663 0.090 0.342 2e-11
Q9NR64748 Kelch-like protein 1 OS=H no no 0.663 0.179 0.326 2e-11
Q9LI89422 F-box/kelch-repeat protei no no 0.896 0.428 0.283 5e-11
P28575584 Actin-binding protein IPP no no 0.5 0.172 0.314 6e-11
>sp|Q9CAG8|FBK28_ARATH F-box/kelch-repeat protein At1g67480 OS=Arabidopsis thaliana GN=At1g67480 PE=2 SV=1 Back     alignment and function desciption
 Score =  290 bits (743), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 135/202 (66%), Positives = 166/202 (82%)

Query: 1   MNVARYDFACAEVNGKIYAVGGYGMDGESLSSAEVYDPDTDKWNLIESLRRPRWGCFACS 60
           + VARYDFACAEVNG +Y VGG+G+DGESLSSAEVYDP+T  W  IESLRRPRWGCFA +
Sbjct: 175 LEVARYDFACAEVNGHVYVVGGHGVDGESLSSAEVYDPETCTWTFIESLRRPRWGCFASA 234

Query: 61  FDGKLYVMGGRSSFTIGNSKFVDVYNPERHTWCQMKNGCVMVTAHAVVGKKLFCMEWKNQ 120
           F+GKLYVMGGRS+FTIGNSK +DVYN +  +W   KNG  MVTAH  VGKKLFC++WKN 
Sbjct: 235 FNGKLYVMGGRSNFTIGNSKLLDVYNTQCGSWHGSKNGLTMVTAHVEVGKKLFCIDWKNH 294

Query: 121 RKLTIFDPEDNSWKMVPVPLTGSSSIGFRFGILDGKLLLFSLEEEPSYSTLLYDPNAASG 180
           RK+++F+ ED +W++V +PL+GSS  GF+FG L GKLLLFS +EE    TLLYDP+A+ G
Sbjct: 295 RKMSVFNAEDETWEVVALPLSGSSRAGFQFGKLSGKLLLFSSQEETGQCTLLYDPDASPG 354

Query: 181 SEWQTSKIKPSGLCLCSVTIKA 202
           ++W+TS+IK SG C+CSVTI A
Sbjct: 355 TQWKTSEIKLSGSCVCSVTITA 376

Arabidopsis thaliana (taxid: 3702)
>sp|Q9FZJ3|FBK16_ARATH Putative F-box/kelch-repeat protein At1g27420 OS=Arabidopsis thaliana GN=At1g27420 PE=4 SV=2 Back     alignment and function description
>sp|Q920Q8|NS1BP_MOUSE Influenza virus NS1A-binding protein homolog OS=Mus musculus GN=Ivns1abp PE=1 SV=2 Back     alignment and function description
>sp|Q9Y6Y0|NS1BP_HUMAN Influenza virus NS1A-binding protein OS=Homo sapiens GN=IVNS1ABP PE=1 SV=3 Back     alignment and function description
>sp|Q6DFU2|NS1BP_XENLA Influenza virus NS1A-binding protein homolog OS=Xenopus laevis GN=ivns1abp PE=2 SV=1 Back     alignment and function description
>sp|Q0WW40|FBK5_ARATH F-box/kelch-repeat protein At1g16250 OS=Arabidopsis thaliana GN=At1g16250 PE=2 SV=1 Back     alignment and function description
>sp|Q04652|KELC_DROME Ring canal kelch protein OS=Drosophila melanogaster GN=kel PE=1 SV=4 Back     alignment and function description
>sp|Q9NR64|KLHL1_HUMAN Kelch-like protein 1 OS=Homo sapiens GN=KLHL1 PE=2 SV=1 Back     alignment and function description
>sp|Q9LI89|FBK70_ARATH F-box/kelch-repeat protein At3g27150 OS=Arabidopsis thaliana GN=At3g27150 PE=2 SV=1 Back     alignment and function description
>sp|P28575|IPP_MOUSE Actin-binding protein IPP OS=Mus musculus GN=Ipp PE=2 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query202
255547748 391 Protein AFR, putative [Ricinus communis] 1.0 0.516 0.891 1e-105
388510780202 unknown [Lotus japonicus] 1.0 1.0 0.876 1e-102
225425476 385 PREDICTED: F-box/kelch-repeat protein At 1.0 0.524 0.876 1e-102
147773577 371 hypothetical protein VITISV_018334 [Viti 1.0 0.544 0.876 1e-102
356525146 388 PREDICTED: F-box/kelch-repeat protein At 1.0 0.520 0.881 1e-102
356540156 385 PREDICTED: F-box/kelch-repeat protein At 1.0 0.524 0.856 1e-101
449452895 382 PREDICTED: F-box/kelch-repeat protein At 1.0 0.528 0.856 1e-101
224100025 371 f-box family protein [Populus trichocarp 1.0 0.544 0.846 1e-101
224135705 381 predicted protein [Populus trichocarpa] 1.0 0.530 0.871 1e-100
357463045 372 F-box family protein [Medicago truncatul 1.0 0.543 0.816 5e-98
>gi|255547748|ref|XP_002514931.1| Protein AFR, putative [Ricinus communis] gi|223545982|gb|EEF47485.1| Protein AFR, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  387 bits (994), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 180/202 (89%), Positives = 192/202 (95%)

Query: 1   MNVARYDFACAEVNGKIYAVGGYGMDGESLSSAEVYDPDTDKWNLIESLRRPRWGCFACS 60
           MNVARYDFACAEVNGK+YAVGGYG+DG+SLSSAE YDPDT KW LIESLRRPRWGCFACS
Sbjct: 190 MNVARYDFACAEVNGKVYAVGGYGVDGDSLSSAETYDPDTKKWTLIESLRRPRWGCFACS 249

Query: 61  FDGKLYVMGGRSSFTIGNSKFVDVYNPERHTWCQMKNGCVMVTAHAVVGKKLFCMEWKNQ 120
           F+GKLYVMGGRSSFTIGNSK VDVYNPERHTWC+MKNGCVMVTAHAV+GKKLFCMEWKNQ
Sbjct: 250 FEGKLYVMGGRSSFTIGNSKKVDVYNPERHTWCEMKNGCVMVTAHAVLGKKLFCMEWKNQ 309

Query: 121 RKLTIFDPEDNSWKMVPVPLTGSSSIGFRFGILDGKLLLFSLEEEPSYSTLLYDPNAASG 180
           RKL IF+PEDNSWKMVPVP+TGSSSIGF+FGILDGKLLLFSLE+ P Y TLLYDPNA+ G
Sbjct: 310 RKLAIFNPEDNSWKMVPVPVTGSSSIGFQFGILDGKLLLFSLEKAPDYHTLLYDPNASPG 369

Query: 181 SEWQTSKIKPSGLCLCSVTIKA 202
           SEWQTS+IKPSG CLCSVTIKA
Sbjct: 370 SEWQTSEIKPSGQCLCSVTIKA 391

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|388510780|gb|AFK43456.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|225425476|ref|XP_002272745.1| PREDICTED: F-box/kelch-repeat protein At1g67480 [Vitis vinifera] gi|297738424|emb|CBI27625.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147773577|emb|CAN74339.1| hypothetical protein VITISV_018334 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356525146|ref|XP_003531188.1| PREDICTED: F-box/kelch-repeat protein At1g67480-like [Glycine max] Back     alignment and taxonomy information
>gi|356540156|ref|XP_003538556.1| PREDICTED: F-box/kelch-repeat protein At1g67480-like [Glycine max] Back     alignment and taxonomy information
>gi|449452895|ref|XP_004144194.1| PREDICTED: F-box/kelch-repeat protein At1g67480-like [Cucumis sativus] gi|449489229|ref|XP_004158253.1| PREDICTED: F-box/kelch-repeat protein At1g67480-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|224100025|ref|XP_002311715.1| f-box family protein [Populus trichocarpa] gi|222851535|gb|EEE89082.1| f-box family protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224135705|ref|XP_002327284.1| predicted protein [Populus trichocarpa] gi|222835654|gb|EEE74089.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|357463045|ref|XP_003601804.1| F-box family protein [Medicago truncatula] gi|355490852|gb|AES72055.1| F-box family protein [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query202
TAIR|locus:2008773376 AT1G67480 "AT1G67480" [Arabido 1.0 0.537 0.668 2.5e-74
TAIR|locus:2015979346 AT1G27420 "AT1G27420" [Arabido 0.940 0.549 0.405 1.7e-34
MGI|MGI:2152389642 Ivns1abp "influenza virus NS1A 0.886 0.278 0.286 4.2e-17
RGD|1306290302 Ivns1abp "influenza virus NS1A 0.886 0.592 0.286 8.6e-17
UNIPROTKB|Q9Y6Y0642 IVNS1ABP "Influenza virus NS1A 0.975 0.306 0.274 2.2e-15
UNIPROTKB|F1RJ37583 KLHL1 "Uncharacterized protein 0.648 0.224 0.333 3.8e-13
UNIPROTKB|F1N065583 KLHL1 "Uncharacterized protein 0.648 0.224 0.333 4.9e-13
UNIPROTKB|E1BQF2594 KLHL1 "Uncharacterized protein 0.648 0.220 0.333 5.1e-13
UNIPROTKB|Q9NR64748 KLHL1 "Kelch-like protein 1" [ 0.648 0.175 0.333 7.3e-13
TAIR|locus:2032855383 AT1G16250 "AT1G16250" [Arabido 0.589 0.310 0.333 9.2e-13
TAIR|locus:2008773 AT1G67480 "AT1G67480" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 750 (269.1 bits), Expect = 2.5e-74, P = 2.5e-74
 Identities = 135/202 (66%), Positives = 166/202 (82%)

Query:     1 MNVARYDFACAEVNGKIYAVGGYGMDGESLSSAEVYDPDTDKWNLIESLRRPRWGCFACS 60
             + VARYDFACAEVNG +Y VGG+G+DGESLSSAEVYDP+T  W  IESLRRPRWGCFA +
Sbjct:   175 LEVARYDFACAEVNGHVYVVGGHGVDGESLSSAEVYDPETCTWTFIESLRRPRWGCFASA 234

Query:    61 FDGKLYVMGGRSSFTIGNSKFVDVYNPERHTWCQMKNGCVMVTAHAVVGKKLFCMEWKNQ 120
             F+GKLYVMGGRS+FTIGNSK +DVYN +  +W   KNG  MVTAH  VGKKLFC++WKN 
Sbjct:   235 FNGKLYVMGGRSNFTIGNSKLLDVYNTQCGSWHGSKNGLTMVTAHVEVGKKLFCIDWKNH 294

Query:   121 RKLTIFDPEDNSWKMVPVPLTGSSSIGFRFGILDGKLLLFSLEEEPSYSTLLYDPNAASG 180
             RK+++F+ ED +W++V +PL+GSS  GF+FG L GKLLLFS +EE    TLLYDP+A+ G
Sbjct:   295 RKMSVFNAEDETWEVVALPLSGSSRAGFQFGKLSGKLLLFSSQEETGQCTLLYDPDASPG 354

Query:   181 SEWQTSKIKPSGLCLCSVTIKA 202
             ++W+TS+IK SG C+CSVTI A
Sbjct:   355 TQWKTSEIKLSGSCVCSVTITA 376
GO:0003674 "molecular_function" evidence=ND
GO:0005737 "cytoplasm" evidence=ISM
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2015979 AT1G27420 "AT1G27420" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
MGI|MGI:2152389 Ivns1abp "influenza virus NS1A binding protein" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1306290 Ivns1abp "influenza virus NS1A binding protein" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q9Y6Y0 IVNS1ABP "Influenza virus NS1A-binding protein" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1RJ37 KLHL1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1N065 KLHL1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E1BQF2 KLHL1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q9NR64 KLHL1 "Kelch-like protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
TAIR|locus:2032855 AT1G16250 "AT1G16250" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query202
PHA03098534 PHA03098, PHA03098, kelch-like protein; Provisiona 5e-14
PHA03098534 PHA03098, PHA03098, kelch-like protein; Provisiona 1e-12
pfam0134446 pfam01344, Kelch_1, Kelch motif 1e-10
PHA03098534 PHA03098, PHA03098, kelch-like protein; Provisiona 5e-10
smart0061247 smart00612, Kelch, Kelch domain 5e-10
pfam1396450 pfam13964, Kelch_6, Kelch motif 4e-09
pfam0134446 pfam01344, Kelch_1, Kelch motif 3e-08
pfam1341548 pfam13415, Kelch_3, Galactose oxidase, central dom 2e-05
pfam1341849 pfam13418, Kelch_4, Galactose oxidase, central dom 3e-05
TIGR03547346 TIGR03547, muta_rot_YjhT, mutatrotase, YjhT family 1e-04
pfam0764648 pfam07646, Kelch_2, Kelch motif 1e-04
pfam0764648 pfam07646, Kelch_2, Kelch motif 3e-04
pfam1396450 pfam13964, Kelch_6, Kelch motif 6e-04
PHA02790480 PHA02790, PHA02790, Kelch-like protein; Provisiona 0.002
COG3055381 COG3055, COG3055, Uncharacterized protein conserve 0.004
>gnl|CDD|222983 PHA03098, PHA03098, kelch-like protein; Provisional Back     alignment and domain information 
 Score = 69.4 bits (170), Expect = 5e-14
 Identities = 40/156 (25%), Positives = 67/156 (42%), Gaps = 13/156 (8%)

Query: 1   MNVARYDFACAEVNGKIYAVGGYGMDGESLSSAEVYDPDTDKWNLIESLRRPRWGCFACS 60
           +   RY+     VN  IY +GG   + E L + E +  +T+KW+    L    +G  A  
Sbjct: 376 LIFPRYNPCVVNVNNLIYVIGGISKNDELLKTVECFSLNTNKWSKGSPLPISHYGGCAIY 435

Query: 61  FDGKLYVMGGRSSFT-IGNSKFVDVYNPERHTWCQMK---------NGCVMVTAHAVVGK 110
            DGK+YV+GG S    I     V+ YNP  + W ++          + C+      VVG 
Sbjct: 436 HDGKIYVIGGISYIDNIKVYNIVESYNPVTNKWTELSSLNFPRINASLCIFNNKIYVVGG 495

Query: 111 KLFCMEWKNQRKLTIFDPEDNSWKMVPVPLTGSSSI 146
                E+    ++ ++D + N+W +         S+
Sbjct: 496 --DKYEYYI-NEIEVYDDKTNTWTLFCKFPKVIGSL 528

Length = 534
>gnl|CDD|222983 PHA03098, PHA03098, kelch-like protein; Provisional Back     alignment and domain information
>gnl|CDD|201739 pfam01344, Kelch_1, Kelch motif Back     alignment and domain information
>gnl|CDD|222983 PHA03098, PHA03098, kelch-like protein; Provisional Back     alignment and domain information
>gnl|CDD|128874 smart00612, Kelch, Kelch domain Back     alignment and domain information
>gnl|CDD|206134 pfam13964, Kelch_6, Kelch motif Back     alignment and domain information
>gnl|CDD|201739 pfam01344, Kelch_1, Kelch motif Back     alignment and domain information
>gnl|CDD|222113 pfam13415, Kelch_3, Galactose oxidase, central domain Back     alignment and domain information
>gnl|CDD|205596 pfam13418, Kelch_4, Galactose oxidase, central domain Back     alignment and domain information
>gnl|CDD|234253 TIGR03547, muta_rot_YjhT, mutatrotase, YjhT family Back     alignment and domain information
>gnl|CDD|116261 pfam07646, Kelch_2, Kelch motif Back     alignment and domain information
>gnl|CDD|116261 pfam07646, Kelch_2, Kelch motif Back     alignment and domain information
>gnl|CDD|206134 pfam13964, Kelch_6, Kelch motif Back     alignment and domain information
>gnl|CDD|165153 PHA02790, PHA02790, Kelch-like protein; Provisional Back     alignment and domain information
>gnl|CDD|225597 COG3055, COG3055, Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 202
PHA02713557 hypothetical protein; Provisional 100.0
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 100.0
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 100.0
PHA02713557 hypothetical protein; Provisional 100.0
PLN02153341 epithiospecifier protein 100.0
TIGR03548323 mutarot_permut cyclically-permuted mutatrotase fam 100.0
PLN02153341 epithiospecifier protein 100.0
PHA02790480 Kelch-like protein; Provisional 100.0
PHA03098534 kelch-like protein; Provisional 100.0
TIGR03547346 muta_rot_YjhT mutatrotase, YjhT family. Members of 100.0
PLN02193470 nitrile-specifier protein 100.0
TIGR03547346 muta_rot_YjhT mutatrotase, YjhT family. Members of 100.0
PHA03098534 kelch-like protein; Provisional 100.0
PHA02790480 Kelch-like protein; Provisional 100.0
PLN02193470 nitrile-specifier protein 100.0
PRK14131376 N-acetylneuraminic acid mutarotase; Provisional 100.0
PRK14131 376 N-acetylneuraminic acid mutarotase; Provisional 99.98
TIGR03548 323 mutarot_permut cyclically-permuted mutatrotase fam 99.98
KOG4693392 consensus Uncharacterized conserved protein, conta 99.97
KOG0379 482 consensus Kelch repeat-containing proteins [Genera 99.96
KOG1230 521 consensus Protein containing repeated kelch motifs 99.95
KOG4693 392 consensus Uncharacterized conserved protein, conta 99.95
KOG0379 482 consensus Kelch repeat-containing proteins [Genera 99.95
KOG1230 521 consensus Protein containing repeated kelch motifs 99.9
KOG4152 830 consensus Host cell transcription factor HCFC1 [Ce 99.86
KOG4152 830 consensus Host cell transcription factor HCFC1 [Ce 99.8
COG3055 381 Uncharacterized protein conserved in bacteria [Fun 99.76
COG3055381 Uncharacterized protein conserved in bacteria [Fun 99.73
PF1396450 Kelch_6: Kelch motif 99.63
PF0134447 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is 99.5
KOG2437 723 consensus Muskelin [Signal transduction mechanisms 99.39
PF1341849 Kelch_4: Galactose oxidase, central domain; PDB: 2 99.39
PF0764649 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is 99.36
PF1341549 Kelch_3: Galactose oxidase, central domain 99.36
PF1396450 Kelch_6: Kelch motif 99.29
PF0134447 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is 99.21
smart0061247 Kelch Kelch domain. 99.2
PF0764649 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is 99.14
PF1385442 Kelch_5: Kelch motif 99.1
PLN02772 398 guanylate kinase 99.06
PF07250243 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterP 99.05
KOG2437 723 consensus Muskelin [Signal transduction mechanisms 99.01
PF1341849 Kelch_4: Galactose oxidase, central domain; PDB: 2 98.98
PF1341549 Kelch_3: Galactose oxidase, central domain 98.8
PF1385442 Kelch_5: Kelch motif 98.64
PLN02772 398 guanylate kinase 98.6
TIGR01640230 F_box_assoc_1 F-box protein interaction domain. Th 98.6
PF07250243 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterP 98.55
smart0061247 Kelch Kelch domain. 98.47
PF03089337 RAG2: Recombination activating protein 2; InterPro 98.31
TIGR01640230 F_box_assoc_1 F-box protein interaction domain. Th 98.29
PF07893342 DUF1668: Protein of unknown function (DUF1668); In 98.25
PF07893 342 DUF1668: Protein of unknown function (DUF1668); In 97.96
PRK11138 394 outer membrane biogenesis protein BamB; Provisiona 97.76
PF12768281 Rax2: Cortical protein marker for cell polarity 97.63
PF12768 281 Rax2: Cortical protein marker for cell polarity 97.56
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 97.45
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 97.33
TIGR03300 377 assembly_YfgL outer membrane assembly lipoprotein 97.26
PF03089 337 RAG2: Recombination activating protein 2; InterPro 97.23
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 97.1
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 97.07
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 97.07
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 96.76
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 96.68
KOG2055514 consensus WD40 repeat protein [General function pr 96.64
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 96.46
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 96.46
KOG2055 514 consensus WD40 repeat protein [General function pr 96.31
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 96.3
PRK04792448 tolB translocation protein TolB; Provisional 96.24
cd00216 488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 96.18
PF08268129 FBA_3: F-box associated domain; InterPro: IPR01318 95.98
PRK04922433 tolB translocation protein TolB; Provisional 95.97
cd00094194 HX Hemopexin-like repeats.; Hemopexin is a heme-bi 95.94
TIGR03866 300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 95.85
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 95.72
TIGR03075 527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 95.63
PRK00178430 tolB translocation protein TolB; Provisional 95.62
KOG1036323 consensus Mitotic spindle checkpoint protein BUB3, 95.56
smart00284255 OLF Olfactomedin-like domains. 95.5
TIGR03075 527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 95.5
PRK05137435 tolB translocation protein TolB; Provisional 95.09
PLN03215373 ascorbic acid mannose pathway regulator 1; Provisi 95.06
PF03178 321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 95.04
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 94.92
KOG0310 487 consensus Conserved WD40 repeat-containing protein 94.89
PF08268129 FBA_3: F-box associated domain; InterPro: IPR01318 94.88
PTZ00421 493 coronin; Provisional 94.74
KOG0281499 consensus Beta-TrCP (transducin repeats containing 94.66
PRK13684334 Ycf48-like protein; Provisional 94.58
KOG0315311 consensus G-protein beta subunit-like protein (con 94.51
COG4257353 Vgb Streptogramin lyase [Defense mechanisms] 94.49
PRK03629429 tolB translocation protein TolB; Provisional 94.44
KOG2321 703 consensus WD40 repeat protein [General function pr 94.33
PF02191250 OLF: Olfactomedin-like domain; InterPro: IPR003112 94.03
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 93.67
PRK05137435 tolB translocation protein TolB; Provisional 93.65
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 93.56
COG1520 370 FOG: WD40-like repeat [Function unknown] 93.55
cd00094194 HX Hemopexin-like repeats.; Hemopexin is a heme-bi 93.52
KOG0296 399 consensus Angio-associated migratory cell protein 93.21
PRK11028 330 6-phosphogluconolactonase; Provisional 93.11
KOG0266456 consensus WD40 repeat-containing protein [General 92.96
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 92.96
PLN00181793 protein SPA1-RELATED; Provisional 92.88
PRK04792448 tolB translocation protein TolB; Provisional 92.79
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 92.78
PRK04043419 tolB translocation protein TolB; Provisional 92.69
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 92.69
PTZ00421 493 coronin; Provisional 92.18
PLN00033398 photosystem II stability/assembly factor; Provisio 91.57
PRK02889427 tolB translocation protein TolB; Provisional 91.57
KOG2048 691 consensus WD40 repeat protein [General function pr 91.13
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 90.96
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 89.86
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 89.72
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 89.63
PRK01742429 tolB translocation protein TolB; Provisional 89.35
TIGR03074 764 PQQ_membr_DH membrane-bound PQQ-dependent dehydrog 89.18
PRK13684334 Ycf48-like protein; Provisional 88.9
KOG0316307 consensus Conserved WD40 repeat-containing protein 88.52
TIGR03074 764 PQQ_membr_DH membrane-bound PQQ-dependent dehydrog 88.33
PRK00178430 tolB translocation protein TolB; Provisional 88.18
KOG0291 893 consensus WD40-repeat-containing subunit of the 18 87.8
KOG1332299 consensus Vesicle coat complex COPII, subunit SEC1 87.75
PRK04922433 tolB translocation protein TolB; Provisional 86.83
PF13859310 BNR_3: BNR repeat-like domain; PDB: 3B69_A. 86.8
PRK03629429 tolB translocation protein TolB; Provisional 86.37
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 86.16
PF12217367 End_beta_propel: Catalytic beta propeller domain o 86.11
PRK04043419 tolB translocation protein TolB; Provisional 84.79
KOG0289506 consensus mRNA splicing factor [General function p 84.66
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 84.48
KOG2321 703 consensus WD40 repeat protein [General function pr 83.49
KOG0640430 consensus mRNA cleavage stimulating factor complex 83.48
PF14870 302 PSII_BNR: Photosynthesis system II assembly factor 83.48
COG4257353 Vgb Streptogramin lyase [Defense mechanisms] 83.25
COG4447 339 Uncharacterized protein related to plant photosyst 83.2
KOG0291 893 consensus WD40-repeat-containing subunit of the 18 82.82
KOG0263707 consensus Transcription initiation factor TFIID, s 82.5
COG4946 668 Uncharacterized protein related to the periplasmic 81.28
PRK10115 686 protease 2; Provisional 80.32
KOG0310 487 consensus Conserved WD40 repeat-containing protein 80.08
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information 
Probab=100.00  E-value=3.4e-38  Score=259.71  Aligned_cols=193  Identities=15%  Similarity=0.275  Sum_probs=163.3

Q ss_pred             CCccccceEEEEECCEEEEEcCcCCCCCceeeeEEEeCCCCCeEEcCCCCCCceeeeeEEECCEEEEEcCccCCCCCCcc
Q 028925            1 MNVARYDFACAEVNGKIYAVGGYGMDGESLSSAEVYDPDTDKWNLIESLRRPRWGCFACSFDGKLYVMGGRSSFTIGNSK   80 (202)
Q Consensus         1 m~~~r~~~~~~~~~~~iyv~GG~~~~~~~~~~~~~yd~~t~~W~~~~~~~~~r~~~~~~~~~~~iy~~gG~~~~~~~~~~   80 (202)
                      ||.+|.++++++++++|||+||.+.....++++++|||.+++|..+++|+.+|..+++++++|+||++||..+..  ..+
T Consensus       290 mp~~r~~~~~a~l~~~IYviGG~~~~~~~~~~v~~Yd~~~n~W~~~~~m~~~R~~~~~~~~~g~IYviGG~~~~~--~~~  367 (557)
T PHA02713        290 IPNHIINYASAIVDNEIIIAGGYNFNNPSLNKVYKINIENKIHVELPPMIKNRCRFSLAVIDDTIYAIGGQNGTN--VER  367 (557)
T ss_pred             CCccccceEEEEECCEEEEEcCCCCCCCccceEEEEECCCCeEeeCCCCcchhhceeEEEECCEEEEECCcCCCC--CCc
Confidence            788999999999999999999975334457889999999999999999999999999999999999999985432  356


Q ss_pred             eEEEEeCCCCeEEeccCcc--ceeeeeEEECCEEEEEeCCC----------------------CCeEEEEeCCCCcEEEe
Q 028925           81 FVDVYNPERHTWCQMKNGC--VMVTAHAVVGKKLFCMEWKN----------------------QRKLTIFDPEDNSWKMV  136 (202)
Q Consensus        81 ~~~~yd~~~~~W~~~~~~~--~~~~~~~~~~~~iyv~Gg~~----------------------~~~~~~yd~~~~~W~~~  136 (202)
                      ++++|||.+++|+.+++++  +..+++++++++||++||..                      .+.+++|||++++|+.+
T Consensus       368 sve~Ydp~~~~W~~~~~mp~~r~~~~~~~~~g~IYviGG~~~~~~~~~~~~~~~~~~~~~~~~~~~ve~YDP~td~W~~v  447 (557)
T PHA02713        368 TIECYTMGDDKWKMLPDMPIALSSYGMCVLDQYIYIIGGRTEHIDYTSVHHMNSIDMEEDTHSSNKVIRYDTVNNIWETL  447 (557)
T ss_pred             eEEEEECCCCeEEECCCCCcccccccEEEECCEEEEEeCCCcccccccccccccccccccccccceEEEECCCCCeEeec
Confidence            8999999999999998544  45566788999999999843                      35799999999999999


Q ss_pred             ccCCCCCCCCCeeEEEECCeEEEEcccCCCC---ceeEEEeCCC-CCCCcceeecccCCceeeeEEEe
Q 028925          137 PVPLTGSSSIGFRFGILDGKLLLFSLEEEPS---YSTLLYDPNA-ASGSEWQTSKIKPSGLCLCSVTI  200 (202)
Q Consensus       137 ~~~~~~~~~~~~~~~~~~~~i~v~gG~~~~~---~~~~~yd~~~-~~~~~W~~~~~~p~~~~~~~~~~  200 (202)
                      +.+..  .+..+++++++|+||++||.....   ..+++|||++ +   +|+.++.||.+|..+++++
T Consensus       448 ~~m~~--~r~~~~~~~~~~~IYv~GG~~~~~~~~~~ve~Ydp~~~~---~W~~~~~m~~~r~~~~~~~  510 (557)
T PHA02713        448 PNFWT--GTIRPGVVSHKDDIYVVCDIKDEKNVKTCIFRYNTNTYN---GWELITTTESRLSALHTIL  510 (557)
T ss_pred             CCCCc--ccccCcEEEECCEEEEEeCCCCCCccceeEEEecCCCCC---CeeEccccCcccccceeEE
Confidence            74433  477888999999999999975322   3579999999 8   9999999999999666543

>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>PLN02153 epithiospecifier protein Back     alignment and domain information
>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein Back     alignment and domain information
>PLN02153 epithiospecifier protein Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>TIGR03547 muta_rot_YjhT mutatrotase, YjhT family Back     alignment and domain information
>PLN02193 nitrile-specifier protein Back     alignment and domain information
>TIGR03547 muta_rot_YjhT mutatrotase, YjhT family Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>PLN02193 nitrile-specifier protein Back     alignment and domain information
>PRK14131 N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>PRK14131 N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein Back     alignment and domain information
>KOG4693 consensus Uncharacterized conserved protein, contains kelch repeat [General function prediction only] Back     alignment and domain information
>KOG0379 consensus Kelch repeat-containing proteins [General function prediction only] Back     alignment and domain information
>KOG1230 consensus Protein containing repeated kelch motifs [General function prediction only] Back     alignment and domain information
>KOG4693 consensus Uncharacterized conserved protein, contains kelch repeat [General function prediction only] Back     alignment and domain information
>KOG0379 consensus Kelch repeat-containing proteins [General function prediction only] Back     alignment and domain information
>KOG1230 consensus Protein containing repeated kelch motifs [General function prediction only] Back     alignment and domain information
>KOG4152 consensus Host cell transcription factor HCFC1 [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>KOG4152 consensus Host cell transcription factor HCFC1 [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>COG3055 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG3055 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13964 Kelch_6: Kelch motif Back     alignment and domain information
>PF01344 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>KOG2437 consensus Muskelin [Signal transduction mechanisms] Back     alignment and domain information
>PF13418 Kelch_4: Galactose oxidase, central domain; PDB: 2UVK_B Back     alignment and domain information
>PF07646 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF13415 Kelch_3: Galactose oxidase, central domain Back     alignment and domain information
>PF13964 Kelch_6: Kelch motif Back     alignment and domain information
>PF01344 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>smart00612 Kelch Kelch domain Back     alignment and domain information
>PF07646 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF13854 Kelch_5: Kelch motif Back     alignment and domain information
>PLN02772 guanylate kinase Back     alignment and domain information
>PF07250 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterPro: IPR009880 This entry represents the N terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes Back     alignment and domain information
>KOG2437 consensus Muskelin [Signal transduction mechanisms] Back     alignment and domain information
>PF13418 Kelch_4: Galactose oxidase, central domain; PDB: 2UVK_B Back     alignment and domain information
>PF13415 Kelch_3: Galactose oxidase, central domain Back     alignment and domain information
>PF13854 Kelch_5: Kelch motif Back     alignment and domain information
>PLN02772 guanylate kinase Back     alignment and domain information
>TIGR01640 F_box_assoc_1 F-box protein interaction domain Back     alignment and domain information
>PF07250 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterPro: IPR009880 This entry represents the N terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes Back     alignment and domain information
>smart00612 Kelch Kelch domain Back     alignment and domain information
>PF03089 RAG2: Recombination activating protein 2; InterPro: IPR004321 The variable portion of the genes encoding immunoglobulins and T cell receptors are assembled from component V, D, and J DNA segments by a site-specific recombination reaction termed V(D)J recombination Back     alignment and domain information
>TIGR01640 F_box_assoc_1 F-box protein interaction domain Back     alignment and domain information
>PF07893 DUF1668: Protein of unknown function (DUF1668); InterPro: IPR012871 The hypothetical proteins found in this family are expressed by Oryza sativa (Rice) and are of unknown function Back     alignment and domain information
>PF07893 DUF1668: Protein of unknown function (DUF1668); InterPro: IPR012871 The hypothetical proteins found in this family are expressed by Oryza sativa (Rice) and are of unknown function Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PF12768 Rax2: Cortical protein marker for cell polarity Back     alignment and domain information
>PF12768 Rax2: Cortical protein marker for cell polarity Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>PF03089 RAG2: Recombination activating protein 2; InterPro: IPR004321 The variable portion of the genes encoding immunoglobulins and T cell receptors are assembled from component V, D, and J DNA segments by a site-specific recombination reaction termed V(D)J recombination Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>PF08268 FBA_3: F-box associated domain; InterPro: IPR013187 This domain occurs in a diverse superfamily of genes in plants Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>cd00094 HX Hemopexin-like repeats Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>smart00284 OLF Olfactomedin-like domains Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PLN03215 ascorbic acid mannose pathway regulator 1; Provisional Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PF08268 FBA_3: F-box associated domain; InterPro: IPR013187 This domain occurs in a diverse superfamily of genes in plants Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] Back     alignment and domain information
>COG4257 Vgb Streptogramin lyase [Defense mechanisms] Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2321 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF02191 OLF: Olfactomedin-like domain; InterPro: IPR003112 The olfactomedin-domain was first identified in olfactomedin, an extracellular matrix protein of the olfactory neuroepithelium [] Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG1520 FOG: WD40-like repeat [Function unknown] Back     alignment and domain information
>cd00094 HX Hemopexin-like repeats Back     alignment and domain information
>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>PLN00033 photosystem II stability/assembly factor; Provisional Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2048 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR03074 PQQ_membr_DH membrane-bound PQQ-dependent dehydrogenase, glucose/quinate/shikimate family Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>TIGR03074 PQQ_membr_DH membrane-bound PQQ-dependent dehydrogenase, glucose/quinate/shikimate family Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF13859 BNR_3: BNR repeat-like domain; PDB: 3B69_A Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>PF12217 End_beta_propel: Catalytic beta propeller domain of bacteriophage endosialidase; InterPro: IPR024428 This entry represents the beta propeller domain of endosialidases, which consists of catalytically active part of the enzymes Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>KOG2321 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification] Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>COG4257 Vgb Streptogramin lyase [Defense mechanisms] Back     alignment and domain information
>COG4447 Uncharacterized protein related to plant photosystem II stability/assembly factor [General function prediction only] Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>PRK10115 protease 2; Provisional Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query202
1zgk_A308 1.35 Angstrom Structure Of The Kelch Domain Of Keap 2e-10
3vng_A309 Crystal Structure Of Keap1 In Complex With Syntheti 3e-10
2dyh_A318 Crystal Structure Of The Keap1 Protein In Complexed 5e-10
1x2j_A316 Structural Basis For The Defects Of Human Lung Canc 5e-10
1u6d_X308 Crystal Structure Of The Kelch Domain Of Human Keap 6e-10
2woz_A318 The Novel Beta-Propeller Of The Btb-Kelch Protein K 4e-07
3ii7_A306 Crystal Structure Of The Kelch Domain Of Human Klhl 7e-07
2xn4_A302 Crystal Structure Of The Kelch Domain Of Human Klhl 1e-06
2xn4_A302 Crystal Structure Of The Kelch Domain Of Human Klhl 3e-06
2vpj_A301 Crystal Structure Of The Kelch Domain Of Human Klhl 8e-06
2vpj_A301 Crystal Structure Of The Kelch Domain Of Human Klhl 9e-05
2zw9_A695 Crystal Structure Of Trna Wybutosine Synthesizing E 2e-04
>pdb|1ZGK|A Chain A, 1.35 Angstrom Structure Of The Kelch Domain Of Keap1 Length = 308 Back     alignment and structure 
Iteration: 1

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 51/181 (28%), Positives = 76/181 (41%), Gaps = 19/181 (10%)
Query: 1   MNVARYDFACAEVNGKIYAVGGYGM--DGESLSSA-EVYDPDTDKWNLIESLRRPRWGCF 57
           + V R   A   V G +YAVGG     DG + SSA + Y+P T++W+       PR    
Sbjct: 57  LQVPRSGLAGCVVGGLLYAVGGRNNSPDGNTDSSALDCYNPXTNQWSPCAPXSVPRNRIG 116
Query: 58  ACSFDGKLYVMGGRSSFTIGNSKFVDVYNPERHTWCQMKNGCV--MVTAHAVVGKKLFCM 115
               DG +Y +GG       NS  V+ Y PER  W  +       +    AV+ + L+ +
Sbjct: 117 VGVIDGHIYAVGGSHGCIHHNS--VERYEPERDEWHLVAPXLTRRIGVGVAVLNRLLYAV 174
Query: 116 -EWKNQRKLT---IFDPEDNSWKMVPVPLTGSSSIG--------FRFGILDGKLLLFSLE 163
             +    +L     + PE N W+ +    T  S  G        +  G  DG+  L S+E
Sbjct: 175 GGFDGTNRLNSAECYYPERNEWRXITAXNTIRSGAGVCVLHNCIYAAGGYDGQDQLNSVE 234
Query: 164 E 164
Sbjct: 235 R 235
>pdb|3VNG|A Chain A, Crystal Structure Of Keap1 In Complex With Synthetic Small Molecular Based On A Co-crystallization Length = 309 Back     alignment and structure
>pdb|2DYH|A Chain A, Crystal Structure Of The Keap1 Protein In Complexed With The N-Terminal Region Of The Nrf2 Transcription Factor Length = 318 Back     alignment and structure
>pdb|1X2J|A Chain A, Structural Basis For The Defects Of Human Lung Cancer Somatic Mutations In The Repression Activity Of Keap1 On Nrf2 Length = 316 Back     alignment and structure
>pdb|1U6D|X Chain X, Crystal Structure Of The Kelch Domain Of Human Keap1 Length = 308 Back     alignment and structure
>pdb|2WOZ|A Chain A, The Novel Beta-Propeller Of The Btb-Kelch Protein Krp1 Provides The Binding Site For Lasp-1 That Is Necessary For Pseudopodia Extension Length = 318 Back     alignment and structure
>pdb|3II7|A Chain A, Crystal Structure Of The Kelch Domain Of Human Klhl7 Length = 306 Back     alignment and structure
>pdb|2XN4|A Chain A, Crystal Structure Of The Kelch Domain Of Human Klhl2 (mayven) Length = 302 Back     alignment and structure
>pdb|2XN4|A Chain A, Crystal Structure Of The Kelch Domain Of Human Klhl2 (mayven) Length = 302 Back     alignment and structure
>pdb|2VPJ|A Chain A, Crystal Structure Of The Kelch Domain Of Human Klhl12 Length = 301 Back     alignment and structure
>pdb|2VPJ|A Chain A, Crystal Structure Of The Kelch Domain Of Human Klhl12 Length = 301 Back     alignment and structure
>pdb|2ZW9|A Chain A, Crystal Structure Of Trna Wybutosine Synthesizing Enzyme Tyw4 Length = 695 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query202
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 1e-35
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 3e-29
3ii7_A 306 Kelch-like protein 7; protein-binding, kelch-repea 3e-21
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 6e-34
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 3e-33
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 7e-28
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 5e-26
4asc_A 315 Kelch repeat and BTB domain-containing protein 5; 5e-19
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 5e-17
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 9e-34
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 4e-30
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 5e-26
1zgk_A 308 Kelch-like ECH-associated protein 1; beta-propelle 1e-06
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 2e-33
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 7e-28
2woz_A 318 Kelch repeat and BTB domain-containing protein 10; 6e-18
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 2e-33
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 2e-24
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 3e-24
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 7e-33
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 5e-25
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 1e-15
2uvk_A 357 YJHT; unknown function, hypothetical protein, sial 1e-23
2uvk_A 357 YJHT; unknown function, hypothetical protein, sial 5e-18
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 2e-13
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 2e-13
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 2e-12
2uvk_A 357 YJHT; unknown function, hypothetical protein, sial 1e-07
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 4e-05
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 2e-17
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 5e-06
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 1e-09
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 3e-09
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 9e-09
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 6e-07
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
 Score =  125 bits (317), Expect = 1e-35
 Identities = 43/209 (20%), Positives = 69/209 (33%), Gaps = 14/209 (6%)

Query: 1   MNVARYDFACAEVNGKIYAVGGYGMDGESLSSAEVYDPDTDKWNLIESLRRPRWGCFACS 60
               R   A     GKIY  GG  +   +L   E YD  T+ W+   S+   R       
Sbjct: 88  PPTPRDSLAACAAEGKIYTSGGSEVGNSALYLFECYDTRTESWHTKPSMLTQRCSHGMVE 147

Query: 61  FDGKLYVMGGR--SSFTIGNSKFVDVYNPERHTW---CQMKNGCVMVTAHAVVGKKLFCM 115
            +G +YV GG   ++ +       +VY+P   TW   C M            V  K+F +
Sbjct: 148 ANGLIYVCGGSLGNNVSGRVLNSCEVYDPATETWTELCPMIEARKNHGL-VFVKDKIFAV 206

Query: 116 ----EWKNQRKLTIFDPEDNSWKMVPVPLTGSSSIGFRFGILDGKLLLFSLEEEPSY--S 169
                      +  +D + N WKMV        ++      +   + + +  +       
Sbjct: 207 GGQNGLGGLDNVEYYDIKLNEWKMVSPMPWKGVTVK--CAAVGSIVYVLAGFQGVGRLGH 264

Query: 170 TLLYDPNAASGSEWQTSKIKPSGLCLCSV 198
            L Y+            +  P   CL  V
Sbjct: 265 ILEYNTETDKWVANSKVRAFPVTSCLICV 293
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Length = 695 Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Length = 695 Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Length = 656 Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Length = 656 Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Length = 656 Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Length = 656 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query202
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 100.0
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 100.0
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 100.0
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 100.0
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 100.0
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 100.0
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 100.0
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 100.0
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 100.0
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 100.0
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 100.0
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 100.0
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 100.0
2uvk_A 357 YJHT; unknown function, hypothetical protein, sial 100.0
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 100.0
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 99.97
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 99.96
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 99.94
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 98.66
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 98.61
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 98.5
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 98.43
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 98.31
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 98.18
3q7m_A 376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 97.94
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 97.73
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 97.52
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 97.5
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 97.49
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 97.46
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 97.32
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 97.32
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 97.26
3vgz_A 353 Uncharacterized protein YNCE; beta-propeller, prot 97.26
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 97.26
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 97.21
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 97.18
1p22_A 435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 97.18
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 97.16
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 97.12
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 97.1
1jmx_B 349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 97.09
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 96.97
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 96.96
2iwa_A 266 Glutamine cyclotransferase; pyroglutamate, acyltra 96.95
3bws_A 433 Protein LP49; two-domain, immunoglobulin-like, 7-b 96.94
1k8k_C 372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 96.93
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 96.9
3hfq_A 347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 96.89
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 96.86
2qc5_A 300 Streptogramin B lactonase; beta propeller, lyase; 96.86
3jrp_A 379 Fusion protein of protein transport protein SEC13 96.85
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 96.81
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 96.81
2z2n_A 299 Virginiamycin B lyase; seven-bladed beta-propeller 96.78
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 96.74
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 96.74
3u4y_A 331 Uncharacterized protein; structural genomics, PSI- 96.71
2aq5_A 402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 96.69
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 96.68
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 96.67
3v9f_A 781 Two-component system sensor histidine kinase/RESP 96.63
3fm0_A 345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 96.62
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 96.6
1kb0_A 677 Quinohemoprotein alcohol dehydrogenase; beta-prope 96.58
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 96.55
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 96.5
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 96.5
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 96.45
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 96.45
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 96.45
3v9f_A 781 Two-component system sensor histidine kinase/RESP 96.44
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 96.39
1kv9_A 668 Type II quinohemoprotein alcohol dehydrogenase; el 96.39
2ad6_A 571 Methanol dehydrogenase subunit 1; PQQ configuratio 96.38
1w6s_A 599 Methanol dehydrogenase subunit 1; anisotropic, ele 96.38
3jrp_A 379 Fusion protein of protein transport protein SEC13 96.37
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 96.36
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 96.36
1kv9_A 668 Type II quinohemoprotein alcohol dehydrogenase; el 96.35
4aez_A 401 CDC20, WD repeat-containing protein SLP1; cell cyc 96.35
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 96.35
3dwl_C 377 Actin-related protein 2/3 complex subunit 1; prope 96.33
3ow8_A321 WD repeat-containing protein 61; structural genomi 96.33
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 96.33
4ery_A 312 WD repeat-containing protein 5; WD40, WIN motif, b 96.26
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 96.21
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 96.2
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 96.14
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 96.1
3ott_A 758 Two-component system sensor histidine kinase; beta 96.08
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 96.06
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 96.04
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 96.02
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 96.0
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 95.99
4gga_A 420 P55CDC, cell division cycle protein 20 homolog; ce 95.99
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 95.94
3ow8_A321 WD repeat-containing protein 61; structural genomi 95.92
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 95.88
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 95.87
1kb0_A 677 Quinohemoprotein alcohol dehydrogenase; beta-prope 95.87
4a2l_A 795 BT_4663, two-component system sensor histidine kin 95.85
3ei3_B 383 DNA damage-binding protein 2; UV-damage, DDB, nucl 95.85
1pby_B 337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 95.83
1su3_A450 Interstitial collagenase; prodomain, hemopexin dom 95.82
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 95.81
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 95.81
4ggc_A 318 P55CDC, cell division cycle protein 20 homolog; ce 95.8
2ynn_A 304 Coatomer subunit beta'; protein transport, peptide 95.79
4e54_B 435 DNA damage-binding protein 2; beta barrel, double 95.79
2fp8_A322 Strictosidine synthase; six bladed beta propeller 95.78
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 95.78
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 95.73
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 95.71
1qhu_A 460 Protein (hemopexin); beta propeller, HAEM binding 95.71
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 95.68
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 95.61
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 95.58
1vyh_C 410 Platelet-activating factor acetylhydrolase IB alph 95.57
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 95.56
3bg1_A 316 Protein SEC13 homolog; NPC, transport, WD repeat, 95.54
1pex_A207 Collagenase-3, MMP-13; C-terminal hemopexin-like d 95.52
4g56_B357 MGC81050 protein; protein arginine methyltransfera 95.45
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 95.41
4a2l_A 795 BT_4663, two-component system sensor histidine kin 95.38
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 95.36
2pm7_B297 Protein transport protein SEC13, protein transport 95.36
2dg1_A 333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 95.35
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 95.33
3zwl_B 369 Eukaryotic translation initiation factor 3 subuni; 95.32
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 95.3
1flg_A 582 Protein (quinoprotein ethanol dehydrogenase); supe 95.28
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 95.27
3jro_A 753 Fusion protein of protein transport protein SEC13 95.27
1ri6_A 343 Putative isomerase YBHE; 7-bladed propeller, enzym 95.27
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 95.26
4g56_B357 MGC81050 protein; protein arginine methyltransfera 95.24
4e54_B435 DNA damage-binding protein 2; beta barrel, double 95.2
2ad6_A 571 Methanol dehydrogenase subunit 1; PQQ configuratio 95.2
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 95.19
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 95.18
3vl1_A 420 26S proteasome regulatory subunit RPN14; beta-prop 95.16
3scy_A 361 Hypothetical bacterial 6-phosphogluconolactonase; 95.12
3tc9_A 430 Hypothetical hydrolase; 6-bladed beta-propeller, i 95.1
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 95.08
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 95.08
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 95.04
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 95.04
4a11_B 408 DNA excision repair protein ERCC-8; DNA binding pr 95.0
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 94.99
1sq9_A 397 Antiviral protein SKI8; WD repeat, beta-transducin 94.96
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 94.88
3jro_A 753 Fusion protein of protein transport protein SEC13 94.88
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 94.84
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 94.79
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 94.73
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 94.72
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 94.59
3g4e_A 297 Regucalcin; six bladed beta-propeller, gluconolcat 94.53
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 94.52
3mmy_A 368 MRNA export factor; mRNA export, nuclear protein; 94.5
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 94.49
2pm9_A 416 Protein WEB1, protein transport protein SEC31; bet 94.48
1pby_B 337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 94.47
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 94.46
2fp8_A322 Strictosidine synthase; six bladed beta propeller 94.41
1r5m_A 425 SIR4-interacting protein SIF2; transcription corep 94.36
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 94.31
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 94.3
1nir_A 543 Nitrite reductase; hemoprotein, denitrification, d 94.21
3oyo_A225 Hemopexin fold protein CP4; seeds, plant protein; 94.21
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 94.2
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 94.19
2xbg_A 327 YCF48-like protein; photosynthesis, photosystem II 94.16
1k8k_C 372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 94.06
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 94.01
1itv_A195 MMP9; adaptive molecular recognition, beta propell 93.97
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 93.95
1qhu_A460 Protein (hemopexin); beta propeller, HAEM binding 93.87
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 93.86
1pgu_A 615 Actin interacting protein 1; WD repeat, seven-blad 93.74
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 93.73
1w6s_A 599 Methanol dehydrogenase subunit 1; anisotropic, ele 93.73
4hw6_A 433 Hypothetical protein, IPT/TIG domain protein; puta 93.71
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 93.71
3dwl_C 377 Actin-related protein 2/3 complex subunit 1; prope 93.67
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 93.66
2hz6_A 369 Endoplasmic reticulum to nucleus signalling 1 isof 93.65
3b7f_A 394 Glycosyl hydrolase, BNR repeat; 7-bladed beta-prop 93.62
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 93.55
3v65_B386 Low-density lipoprotein receptor-related protein; 93.3
1erj_A 393 Transcriptional repressor TUP1; beta-propeller, tr 93.29
2vdu_B 450 TRNA (guanine-N(7)-)-methyltransferase- associated 93.22
3i2n_A 357 WD repeat-containing protein 92; WD40 repeats, str 93.16
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 93.15
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 93.09
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 92.98
3c7x_A196 Matrix metalloproteinase-14; membrane protein inte 92.95
1n7d_A 699 LDL receptor, low-density lipoprotein receptor; fa 92.88
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 92.88
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 92.81
2pm7_B297 Protein transport protein SEC13, protein transport 92.78
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 92.73
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 92.71
3ba0_A365 Macrophage metalloelastase; FULL-length MMP-12, he 92.66
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 92.65
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 92.62
2hes_X 330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 92.56
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 92.55
1flg_A 582 Protein (quinoprotein ethanol dehydrogenase); supe 92.47
3ott_A 758 Two-component system sensor histidine kinase; beta 92.44
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 92.43
3p5b_L400 Low density lipoprotein receptor variant; B-propel 92.38
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 92.34
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 92.32
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 92.22
3lrv_A 343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 92.18
4a11_B 408 DNA excision repair protein ERCC-8; DNA binding pr 92.15
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 92.05
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 92.01
3c7x_A196 Matrix metalloproteinase-14; membrane protein inte 91.91
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 91.75
1itv_A195 MMP9; adaptive molecular recognition, beta propell 91.62
1sq9_A 397 Antiviral protein SKI8; WD repeat, beta-transducin 91.61
1jmx_B 349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 91.55
1gen_A218 Gelatinase A; hydrolase, hemopexin domain, metallo 91.46
2p4o_A 306 Hypothetical protein; putative lactonase, structur 91.41
1pex_A207 Collagenase-3, MMP-13; C-terminal hemopexin-like d 91.3
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 91.28
3lp9_A227 LS-24; SEED albumin, plant protein; HET: SPM; 2.20 91.15
3oyo_A225 Hemopexin fold protein CP4; seeds, plant protein; 90.87
3lp9_A227 LS-24; SEED albumin, plant protein; HET: SPM; 2.20 90.77
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 90.68
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 90.62
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 90.56
3k26_A 366 Polycomb protein EED; WD40, structural genomics, N 90.56
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 90.11
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 89.91
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 89.9
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 89.77
1k32_A 1045 Tricorn protease; protein degradation, substrate g 89.77
3p5b_L400 Low density lipoprotein receptor variant; B-propel 89.7
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 89.53
1hxn_A219 Hemopexin, HPX; heme, binding protein; 1.80A {Oryc 89.41
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 89.25
3k26_A 366 Polycomb protein EED; WD40, structural genomics, N 89.2
3v65_B386 Low-density lipoprotein receptor-related protein; 88.49
2xyi_A430 Probable histone-binding protein CAF1; transcripti 88.48
1su3_A450 Interstitial collagenase; prodomain, hemopexin dom 88.46
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 88.4
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 87.96
1ck7_A631 Protein (gelatinase A); hydrolase (metalloprotease 87.96
2xbg_A 327 YCF48-like protein; photosynthesis, photosystem II 87.94
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 87.82
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 87.79
3ba0_A365 Macrophage metalloelastase; FULL-length MMP-12, he 87.78
2xyi_A430 Probable histone-binding protein CAF1; transcripti 87.7
1yfq_A 342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 87.29
2p4o_A306 Hypothetical protein; putative lactonase, structur 87.16
2ymu_A577 WD-40 repeat protein; unknown function, two domain 86.92
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 86.05
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 84.71
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 84.12
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 83.88
1nr0_A 611 Actin interacting protein 1; beta propeller, WD40 83.09
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 82.76
3ei3_A 1158 DNA damage-binding protein 1; UV-damage, DDB, nucl 82.71
3ju4_A 670 Endo-N-acetylneuraminidase; endonf, polysia, high- 82.69
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 81.96
3f3f_A 351 Nucleoporin SEH1; structural protein, protein comp 81.93
1nr0_A 611 Actin interacting protein 1; beta propeller, WD40 81.77
1k32_A 1045 Tricorn protease; protein degradation, substrate g 81.32
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 81.18
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 80.75
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 80.52
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 80.4
1qks_A 567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 80.29
1gen_A218 Gelatinase A; hydrolase, hemopexin domain, metallo 80.19
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
Probab=100.00  E-value=1.5e-37  Score=238.35  Aligned_cols=194  Identities=21%  Similarity=0.381  Sum_probs=165.4

Q ss_pred             CCccccceEEEEECCEEEEEcCcCCCCCceeeeEEEeCCCCCeEEcCCCCCCceeeeeEEECCEEEEEcCccCCCCCCcc
Q 028925            1 MNVARYDFACAEVNGKIYAVGGYGMDGESLSSAEVYDPDTDKWNLIESLRRPRWGCFACSFDGKLYVMGGRSSFTIGNSK   80 (202)
Q Consensus         1 m~~~r~~~~~~~~~~~iyv~GG~~~~~~~~~~~~~yd~~t~~W~~~~~~~~~r~~~~~~~~~~~iy~~gG~~~~~~~~~~   80 (202)
                      ||.+|..|++++++++||++||.+. ...++++++||+.+++|+.++++|.+|..|+++.++++||++||..........
T Consensus        95 ~p~~r~~~~~~~~~~~iyv~GG~~~-~~~~~~~~~~d~~~~~W~~~~~~p~~r~~~~~~~~~~~iyv~GG~~~~~~~~~~  173 (302)
T 2xn4_A           95 MRDRRSTLGAAVLNGLLYAVGGFDG-STGLSSVEAYNIKSNEWFHVAPMNTRRSSVGVGVVGGLLYAVGGYDVASRQCLS  173 (302)
T ss_dssp             CSSCCBSCEEEEETTEEEEEEEECS-SCEEEEEEEEETTTTEEEEECCCSSCCBSCEEEEETTEEEEECCEETTTTEECC
T ss_pred             CCccccceEEEEECCEEEEEcCCCC-CccCceEEEEeCCCCeEeecCCCCCcccCceEEEECCEEEEEeCCCCCCCcccc
Confidence            7899999999999999999999863 356789999999999999999999999999999999999999998654322357


Q ss_pred             eEEEEeCCCCeEEecc--CccceeeeeEEECCEEEEEeCCC----CCeEEEEeCCCCcEEEeccCCCCCCCCCeeEEEEC
Q 028925           81 FVDVYNPERHTWCQMK--NGCVMVTAHAVVGKKLFCMEWKN----QRKLTIFDPEDNSWKMVPVPLTGSSSIGFRFGILD  154 (202)
Q Consensus        81 ~~~~yd~~~~~W~~~~--~~~~~~~~~~~~~~~iyv~Gg~~----~~~~~~yd~~~~~W~~~~~~~~~~~~~~~~~~~~~  154 (202)
                      ++++||+.+++|+.++  |.++..+++++++++||++||..    .+.+++||+++++|+.++.++  ..+..++++..+
T Consensus       174 ~~~~yd~~~~~W~~~~~~p~~r~~~~~~~~~~~iyv~GG~~~~~~~~~~~~yd~~~~~W~~~~~~~--~~r~~~~~~~~~  251 (302)
T 2xn4_A          174 TVECYNATTNEWTYIAEMSTRRSGAGVGVLNNLLYAVGGHDGPLVRKSVEVYDPTTNAWRQVADMN--MCRRNAGVCAVN  251 (302)
T ss_dssp             CEEEEETTTTEEEEECCCSSCCBSCEEEEETTEEEEECCBSSSSBCCCEEEEETTTTEEEEECCCS--SCCBSCEEEEET
T ss_pred             EEEEEeCCCCcEEECCCCccccccccEEEECCEEEEECCCCCCcccceEEEEeCCCCCEeeCCCCC--CccccCeEEEEC
Confidence            8999999999999998  45566677888999999999843    468999999999999997433  347788889999


Q ss_pred             CeEEEEcccCCCC--ceeEEEeCCCCCCCcceeec-ccCCcee-eeEEEe
Q 028925          155 GKLLLFSLEEEPS--YSTLLYDPNAASGSEWQTSK-IKPSGLC-LCSVTI  200 (202)
Q Consensus       155 ~~i~v~gG~~~~~--~~~~~yd~~~~~~~~W~~~~-~~p~~~~-~~~~~~  200 (202)
                      ++||++||.....  ..+++||++++   +|+.++ .+|.+|. ++++++
T Consensus       252 ~~i~v~GG~~~~~~~~~v~~yd~~~~---~W~~~~~~~~~~r~~~~~~~~  298 (302)
T 2xn4_A          252 GLLYVVGGDDGSCNLASVEYYNPTTD---KWTVVSSCMSTGRSYAGVTVI  298 (302)
T ss_dssp             TEEEEECCBCSSSBCCCEEEEETTTT---EEEECSSCCSSCCBSCEEEEE
T ss_pred             CEEEEECCcCCCcccccEEEEcCCCC---eEEECCcccCcccccceEEEe
Confidence            9999999976432  47999999999   999996 8999988 444454
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>1su3_A Interstitial collagenase; prodomain, hemopexin domain, exocite, structural proteomics in europe, spine, structural genomics, hydrolase; HET: EPE; 2.20A {Homo sapiens} SCOP: a.20.1.2 b.66.1.1 d.92.1.11 PDB: 2clt_A 1fbl_A* Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>1qhu_A Protein (hemopexin); beta propeller, HAEM binding and transport, iron metabolism, binding protein; HET: HEM; 2.30A {Oryctolagus cuniculus} SCOP: b.66.1.1 b.66.1.1 PDB: 1qjs_A* Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>1pex_A Collagenase-3, MMP-13; C-terminal hemopexin-like domain of matrix- metalloproteinase, metalloprotease; 2.70A {Homo sapiens} SCOP: b.66.1.1 Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>3oyo_A Hemopexin fold protein CP4; seeds, plant protein; 2.10A {Vigna unguiculata} Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>1itv_A MMP9; adaptive molecular recognition, beta propeller, dimer, hydrolase; 1.95A {Homo sapiens} SCOP: b.66.1.1 Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>1qhu_A Protein (hemopexin); beta propeller, HAEM binding and transport, iron metabolism, binding protein; HET: HEM; 2.30A {Oryctolagus cuniculus} SCOP: b.66.1.1 b.66.1.1 PDB: 1qjs_A* Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>3b7f_A Glycosyl hydrolase, BNR repeat; 7-bladed beta-propeller fold, structural genomics, joint CEN structural genomics, JCSG; 2.20A {Ralstonia eutropha} Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>3c7x_A Matrix metalloproteinase-14; membrane protein interaction, Pro-MMP-2, TIMP-2, metastasis, calcium, cleavage on PAIR of basic residues, hydrolase; 1.70A {Homo sapiens} Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>3ba0_A Macrophage metalloelastase; FULL-length MMP-12, hemopexin domain, catalytic domain, domain interaction., calcium, extracellular matrix; 3.00A {Homo sapiens} PDB: 2jxy_A Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>3c7x_A Matrix metalloproteinase-14; membrane protein interaction, Pro-MMP-2, TIMP-2, metastasis, calcium, cleavage on PAIR of basic residues, hydrolase; 1.70A {Homo sapiens} Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>1itv_A MMP9; adaptive molecular recognition, beta propeller, dimer, hydrolase; 1.95A {Homo sapiens} SCOP: b.66.1.1 Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>1gen_A Gelatinase A; hydrolase, hemopexin domain, metalloprotease, hydrolase (metalloprotease); 2.15A {Homo sapiens} SCOP: b.66.1.1 PDB: 1rtg_A Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>1pex_A Collagenase-3, MMP-13; C-terminal hemopexin-like domain of matrix- metalloproteinase, metalloprotease; 2.70A {Homo sapiens} SCOP: b.66.1.1 Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>3lp9_A LS-24; SEED albumin, plant protein; HET: SPM; 2.20A {Lathyrus sativus} PDB: 3s0l_A 3v6n_A 4hsd_A 3s18_A Back     alignment and structure
>3oyo_A Hemopexin fold protein CP4; seeds, plant protein; 2.10A {Vigna unguiculata} Back     alignment and structure
>3lp9_A LS-24; SEED albumin, plant protein; HET: SPM; 2.20A {Lathyrus sativus} PDB: 3s0l_A 3v6n_A 4hsd_A 3s18_A Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>1hxn_A Hemopexin, HPX; heme, binding protein; 1.80A {Oryctolagus cuniculus} SCOP: b.66.1.1 Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>1su3_A Interstitial collagenase; prodomain, hemopexin domain, exocite, structural proteomics in europe, spine, structural genomics, hydrolase; HET: EPE; 2.20A {Homo sapiens} SCOP: a.20.1.2 b.66.1.1 d.92.1.11 PDB: 2clt_A 1fbl_A* Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>1ck7_A Protein (gelatinase A); hydrolase (metalloprotease), FULL-length, metalloproteinase; 2.80A {Homo sapiens} SCOP: a.20.1.2 b.66.1.1 d.92.1.11 g.14.1.2 g.14.1.2 g.14.1.2 PDB: 1gxd_A Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>3ba0_A Macrophage metalloelastase; FULL-length MMP-12, hemopexin domain, catalytic domain, domain interaction., calcium, extracellular matrix; 3.00A {Homo sapiens} PDB: 2jxy_A Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>3ei3_A DNA damage-binding protein 1; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Homo sapiens} PDB: 3ei1_A* 3ei2_A* 3ei4_A* 4a0l_A* 3e0c_A* 3i7k_A* 3i7h_A* 3i7l_A* 3i7n_A* 3i7o_A* 3i7p_A* 3i89_A* 3i8c_A* 3i8e_A* 2b5l_A 2b5m_A 2hye_A* 4a11_A* 4a0k_C* 4a0a_A* ... Back     alignment and structure
>3ju4_A Endo-N-acetylneuraminidase; endonf, polysia, high-resolution, glycosidase, hydrolase; HET: SLB; 0.98A {Enterobacteria phage K1F} PDB: 3gvl_A* 3gvj_A* 3gvk_A* 1v0e_A 1v0f_A* Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>1gen_A Gelatinase A; hydrolase, hemopexin domain, metalloprotease, hydrolase (metalloprotease); 2.15A {Homo sapiens} SCOP: b.66.1.1 PDB: 1rtg_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 202
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 2e-13
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 7e-10
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 5e-05
d1k3ia3 387 b.69.1.1 (A:151-537) Galactose oxidase, central do 7e-12
d1k3ia3387 b.69.1.1 (A:151-537) Galactose oxidase, central do 3e-10
d1k3ia3 387 b.69.1.1 (A:151-537) Galactose oxidase, central do 3e-06
d1k3ia3387 b.69.1.1 (A:151-537) Galactose oxidase, central do 0.004
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure

class: All beta proteins
fold: 6-bladed beta-propeller
superfamily: Kelch motif
family: Kelch motif
domain: Kelch-like ECH-associated protein 1, KEAP1
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 64.9 bits (156), Expect = 2e-13
 Identities = 28/106 (26%), Positives = 43/106 (40%), Gaps = 2/106 (1%)

Query: 12  EVNGKIYAVGGYGMDGESLSSAEVYDPDTDKWNLIESLRRPRWGCFACSFDGKLYVMGGR 71
           +V   IY  GGY    +SLS  E Y+P    W  +  L+ PR G   C   G LY +GGR
Sbjct: 2   KVGRLIYTAGGY--FRQSLSYLEAYNPSNGTWLRLADLQVPRSGLAGCVVGGLLYAVGGR 59

Query: 72  SSFTIGNSKFVDVYNPERHTWCQMKNGCVMVTAHAVVGKKLFCMEW 117
           ++   GN+    +      T        + V  + +    +    +
Sbjct: 60  NNSPDGNTDSSALDCYNPMTNQWSPCAPMSVPRNRIGVGVIDGHIY 105
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query202
d1zgka1288 Kelch-like ECH-associated protein 1, KEAP1 {Human 100.0
d1zgka1288 Kelch-like ECH-associated protein 1, KEAP1 {Human 99.97
d1k3ia3 387 Galactose oxidase, central domain {Fungi (Fusarium 99.93
d1k3ia3 387 Galactose oxidase, central domain {Fungi (Fusarium 99.83
d1su3a2195 Collagenase (MMP1), C-terminal domain {Human (Homo 97.05
d1pexa_192 Collagenase-3 (MMP-13), C-terminal domain {Human ( 96.95
d1k32a3 360 Tricorn protease domain 2 {Archaeon Thermoplasma a 96.89
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 96.77
d1k8kc_ 371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 96.73
d1itva_195 Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 96.64
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 96.54
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 96.52
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 96.46
d1l0qa2 301 Surface layer protein {Archaeon Methanosarcina maz 96.32
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 95.99
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 95.93
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 95.74
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 95.7
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 95.69
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 95.6
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 95.52
d1qhua1192 Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: 95.51
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 95.38
d1kb0a2 573 Quinoprotein alcohol dehydrogenase, N-terminal dom 95.27
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 94.93
d1jmxb_ 346 Quinohemoprotein amine dehydrogenase B chain {Pseu 94.84
d1tbga_340 beta1-subunit of the signal-transducing G protein 94.63
d1kv9a2 560 Quinoprotein alcohol dehydrogenase, N-terminal dom 94.52
d1kv9a2 560 Quinoprotein alcohol dehydrogenase, N-terminal dom 94.51
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 94.46
d1pexa_192 Collagenase-3 (MMP-13), C-terminal domain {Human ( 94.32
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 94.28
d1su3a2195 Collagenase (MMP1), C-terminal domain {Human (Homo 94.25
d1qksa2 432 C-terminal (heme d1) domain of cytochrome cd1-nitr 94.12
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 93.97
d2ad6a1 571 Methanol dehydrogenase, heavy chain {Methylophilus 93.95
d1k32a3 360 Tricorn protease domain 2 {Archaeon Thermoplasma a 93.68
d1qhua1192 Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: 93.68
d1gena_200 Gelatinase A (MMP-2), C-terminal domain {Human (Ho 93.6
d1kb0a2 573 Quinoprotein alcohol dehydrogenase, N-terminal dom 93.58
d1k8kc_ 371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 93.54
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 93.25
d2ad6a1 571 Methanol dehydrogenase, heavy chain {Methylophilus 93.11
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 92.29
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 92.26
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 92.23
d1itva_195 Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 91.81
d1gena_200 Gelatinase A (MMP-2), C-terminal domain {Human (Ho 91.33
d1pjxa_ 314 Diisopropylfluorophosphatase (phosphotriesterase, 90.33
d1qksa2 432 C-terminal (heme d1) domain of cytochrome cd1-nitr 90.11
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 89.66
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 89.56
d1erja_ 388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 89.48
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 89.42
d1ri6a_ 333 Putative isomerase YbhE {Escherichia coli [TaxId: 88.94
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 88.41
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 87.76
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 87.41
d1qfma1430 Prolyl oligopeptidase, N-terminal domain {Pig (Sus 87.29
d1w6sa_ 596 Methanol dehydrogenase, heavy chain {Methylobacter 84.29
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 84.22
d1jmxb_ 346 Quinohemoprotein amine dehydrogenase B chain {Pseu 84.09
d1hxna_210 Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: 83.99
d1vyhc1 317 Platelet-activating factor acetylhydrolase IB subu 83.46
d1pbyb_ 337 Quinohemoprotein amine dehydrogenase B chain {Para 82.1
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 80.65
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: 6-bladed beta-propeller
superfamily: Kelch motif
family: Kelch motif
domain: Kelch-like ECH-associated protein 1, KEAP1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=4.1e-34  Score=215.49  Aligned_cols=195  Identities=22%  Similarity=0.388  Sum_probs=155.9

Q ss_pred             CCccccceEEEEECCEEEEEcCcCCC---CCceeeeEEEeCCCCCeEEcCCCCCCceeeeeEEECCEEEEEcCccCCCCC
Q 028925            1 MNVARYDFACAEVNGKIYAVGGYGMD---GESLSSAEVYDPDTDKWNLIESLRRPRWGCFACSFDGKLYVMGGRSSFTIG   77 (202)
Q Consensus         1 m~~~r~~~~~~~~~~~iyv~GG~~~~---~~~~~~~~~yd~~t~~W~~~~~~~~~r~~~~~~~~~~~iy~~gG~~~~~~~   77 (202)
                      ||.+|.+|++++++++|||+||....   ...+.++++||+.+++|+.+++++.+|..|+++.++++||++||.......
T Consensus        37 ~p~~R~~~~~~~~~~~iyv~GG~~~~~~~~~~~~~~~~yd~~~~~w~~~~~~p~~r~~~~~~~~~~~i~~~gg~~~~~~~  116 (288)
T d1zgka1          37 LQVPRSGLAGCVVGGLLYAVGGRNNSPDGNTDSSALDCYNPMTNQWSPCAPMSVPRNRIGVGVIDGHIYAVGGSHGCIHH  116 (288)
T ss_dssp             CSSCCBSCEEEEETTEEEEECCEEEETTEEEECCCEEEEETTTTEEEECCCCSSCCBTCEEEEETTEEEEECCEETTEEC
T ss_pred             CCCccceeEEEEECCEEEEEeCcccCCCCccccchhhhcccccccccccccccceecceeccccceeeEEecceeccccc
Confidence            78999999999999999999997522   234678999999999999999999999999999999999999986432110


Q ss_pred             ---------------------------------------------CcceEEEEeCCCCeEEecc--CccceeeeeEEECC
Q 028925           78 ---------------------------------------------NSKFVDVYNPERHTWCQMK--NGCVMVTAHAVVGK  110 (202)
Q Consensus        78 ---------------------------------------------~~~~~~~yd~~~~~W~~~~--~~~~~~~~~~~~~~  110 (202)
                                                                   ....+++||+.+++|...+  +..+..+++...++
T Consensus       117 ~~~~~~~~~~~~~~~~~~~~~~r~~~~~~~~~~~~~~~GG~~~~~~~~~~~~~d~~~~~~~~~~~~~~~~~~~~~~~~~~  196 (288)
T d1zgka1         117 NSVERYEPERDEWHLVAPMLTRRIGVGVAVLNRLLYAVGGFDGTNRLNSAECYYPERNEWRMITAMNTIRSGAGVCVLHN  196 (288)
T ss_dssp             CCEEEEETTTTEEEECCCCSSCCBSCEEEEETTEEEEECCBCSSCBCCCEEEEETTTTEEEECCCCSSCCBSCEEEEETT
T ss_pred             ceeeeeccccCccccccccccccccceeeeeeecceEecCcccccccceEEEeeccccccccccccccccccccccceee
Confidence                                                         1234566777777776665  23334455677788


Q ss_pred             EEEEEeCCC----CCeEEEEeCCCCcEEEeccCCCCCCCCCeeEEEECCeEEEEcccCCCC--ceeEEEeCCCCCCCcce
Q 028925          111 KLFCMEWKN----QRKLTIFDPEDNSWKMVPVPLTGSSSIGFRFGILDGKLLLFSLEEEPS--YSTLLYDPNAASGSEWQ  184 (202)
Q Consensus       111 ~iyv~Gg~~----~~~~~~yd~~~~~W~~~~~~~~~~~~~~~~~~~~~~~i~v~gG~~~~~--~~~~~yd~~~~~~~~W~  184 (202)
                      +|+++||..    ....+.||..+++|+.++.+  +..+..++++.++++|||+||.....  ..+++||++++   +|+
T Consensus       197 ~i~i~GG~~~~~~~~~~~~~~~~~~~~~~~~~~--p~~r~~~~~~~~~~~l~v~GG~~~~~~~~~v~~yd~~~~---~W~  271 (288)
T d1zgka1         197 CIYAAGGYDGQDQLNSVERYDVETETWTFVAPM--KHRRSALGITVHQGRIYVLGGYDGHTFLDSVECYDPDTD---TWS  271 (288)
T ss_dssp             EEEEECCBCSSSBCCCEEEEETTTTEEEECCCC--SSCCBSCEEEEETTEEEEECCBCSSCBCCEEEEEETTTT---EEE
T ss_pred             eEEEecCccccccccceeeeeecceeeecccCc--cCcccceEEEEECCEEEEEecCCCCeecceEEEEECCCC---EEE
Confidence            888888733    45789999999999999733  33588889999999999999975443  37999999999   999


Q ss_pred             eecccCCceeeeEEEe
Q 028925          185 TSKIKPSGLCLCSVTI  200 (202)
Q Consensus       185 ~~~~~p~~~~~~~~~~  200 (202)
                      .+..||.+|++++++|
T Consensus       272 ~~~~~p~~R~~~~~~~  287 (288)
T d1zgka1         272 EVTRMTSGRSGVGVAV  287 (288)
T ss_dssp             EEEECSSCCBSCEEEE
T ss_pred             ECCCCCCCcEeEEEEE
Confidence            9999999999877776
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1su3a2 b.66.1.1 (A:271-465) Collagenase (MMP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pexa_ b.66.1.1 (A:) Collagenase-3 (MMP-13), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1itva_ b.66.1.1 (A:) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1qhua1 b.66.1.1 (A:24-215) Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pexa_ b.66.1.1 (A:) Collagenase-3 (MMP-13), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1su3a2 b.66.1.1 (A:271-465) Collagenase (MMP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1qhua1 b.66.1.1 (A:24-215) Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1gena_ b.66.1.1 (A:) Gelatinase A (MMP-2), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1itva_ b.66.1.1 (A:) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gena_ b.66.1.1 (A:) Gelatinase A (MMP-2), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1qfma1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1w6sa_ b.70.1.1 (A:) Methanol dehydrogenase, heavy chain {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1hxna_ b.66.1.1 (A:) Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure