Citrus Sinensis ID: 028948

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-

MSGYYYGWKSFDEYEDRAEKPRRFGVTEMRSPHYTLSSSHNVLEDIFESMGQFVDGLKFSGGSHSLMPKPFIEEVVKRAHQHDVYVSTGDWAEHLIRNGPSAFKEYVEDCKQVGFDTIELNVGSLEIPEETLLRYVRLVKSAGLKAKPKFAVMFNKSDIPSDRDRAFGAYVARAPRSTDKLFLASNPEIEVGVGINKSRIC

ccccccccccccccccccccccccccEEEEccccccccHHHHHHHHHHHHcccccEEEEEccccccccHHHHHHHHHHHHHcccEEcccHHHHHHHHHcccHHHHHHHHHHHccccEEEEccccccccHHHHHHHHHHHHHcccEEEEEcccccccccccccHHHHHHHHHHHccccHHHHHHHHcccccccEEEcccccc

ccccEEccHHHccccccccccccccEEEEccccccccccHHHHHHHHHHHcHHccEEEEcccccccccHHHHHHHHHHHHHcccEEcccHHHHHHHHccccHHHHHHHHHHHccccEEEEccccEcccHHHHHHHHHHHHHccccEEcEEEEEcccccccccccccHHHHcccccccHcHEEEEEccccccEEEEcccccc

msgyyygwksfdeyedraekprrfgvtemrsphytlsssHNVLEDIFESMGQfvdglkfsggshslmpkpFIEEVVKRAHQHDVYVSTGDWAEHLIRNGPSAFKEYVEDCKQVGFdtielnvgsleipeETLLRYVRLVKSaglkakpkfavmfnksdipsdrdrafgayvaraprstdklflasnpeievgvginksric

msgyyygwksfdeyedRAEKPRRFGVTEMRSPHYTLSSSHNVLEDIFESMGQFVDGLKFSGGSHSLMPKPFIEEVVKRAHQHDVYVSTGDWAEHLIRNGPSAFKEYVEDCKQVGFDTIELnvgsleipeeTLLRYVRLVKsaglkakpkfavmfnksdipsdrdRAFGAYVARaprstdklflasnpeievgvginksric

***YYYGWKSFDEY*************************HNVLEDIFESMGQFVDGLKFSGGSHSLMPKPFIEEVVKRAHQHDVYVSTGDWAEHLIRNGPSAFKEYVEDCKQVGFDTIELNVGSLEIPEETLLRYVRLVKSAGLKAKPKFAVMFNKSDI*****RAFGAYVARAP***DKLFLAS***IEVGV********

****YYG*KSFDEY******PRRFGVTEMRSPHYTLSSSHNVLEDIFESMGQFVDGLKFSGGSHSLMPKPFIEEVVKRAHQHDVYVSTGDWAEHLIRNGPSAFKEYVEDCKQVGFDTIELNVGSLEIPEETLLRYVRLVKSAGLKAKPKFAVMFNKSDIPSDRDRAFGAYVARAPRSTDKLFLASNPEIEVGVGINKSRIC

**GYYYGWKSFDEYEDRAEKPRRFGVTEMRSPHYTLSSSHNVLEDIFESMGQFVDGLKFSGGSHSLMPKPFIEEVVKRAHQHDVYVSTGDWAEHLIRNGPSAFKEYVEDCKQVGFDTIELNVGSLEIPEETLLRYVRLVKSAGLKAKPKFAVMFNKSDIPSDRDRAFGAYVARAPRSTDKLFLASNPEIEVGVGINKSRIC

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

oooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		201
224116330		291	predicted protein [Populus trichocarpa]	0.880	0.608	0.758	3e-74
449454694		286	PREDICTED: uncharacterized protein LOC10	0.860	0.604	0.735	5e-72
255555077		277	furin, putative [Ricinus communis] gi\|22	0.855	0.620	0.734	3e-71
297804020		1745	hypothetical protein ARALYDRAFT_329472 [	0.860	0.099	0.72	4e-71
3402751		1736	putative protein [Arabidopsis thaliana]	0.860	0.099	0.714	2e-70
30685384		286	Aldolase-type TIM barrel family protein	0.860	0.604	0.714	6e-70
356524766		286	PREDICTED: uncharacterized protein LOC10	0.850	0.597	0.726	8e-69
255639187		197	unknown [Glycine max]	0.850	0.868	0.726	9e-69
357123468		299	PREDICTED: uncharacterized protein LOC10	0.875	0.588	0.602	2e-61
356519509		291	PREDICTED: uncharacterized protein LOC10	0.781	0.539	0.708	2e-60

>gi\|224116330\|ref\|XP_002317271.1\| predicted protein [Populus trichocarpa] gi\|222860336\|gb\|EEE97883.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

 Score =  283 bits (724), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 135/178 (75%), Positives = 152/178 (85%), Gaps = 1/178 (0%)

Query: 2   SGYYYGWKSFDEYEDRAEKPRRFGVTEMRSPHYTLSSSHNVLEDIFESMGQFVDGLKFSG 61
           S  YY WKSF+E EDR EKPRRFGVTEMR P YTL S  N+L+D+FE+MGQFVDGLKFSG
Sbjct: 4   SSVYYQWKSFEEDEDRPEKPRRFGVTEMRGPQYTLLS-QNMLQDVFETMGQFVDGLKFSG 62

Query: 62  GSHSLMPKPFIEEVVKRAHQHDVYVSTGDWAEHLIRNGPSAFKEYVEDCKQVGFDTIELN 121
           GSHSLMPK FI+EVV  AH+HDVYVSTGDWAEHL+  GP+AFKEYVE+CK +GFDTIELN
Sbjct: 63  GSHSLMPKSFIKEVVDMAHKHDVYVSTGDWAEHLLHKGPTAFKEYVEECKSMGFDTIELN 122

Query: 122 VGSLEIPEETLLRYVRLVKSAGLKAKPKFAVMFNKSDIPSDRDRAFGAYVARAPRSTD 179
           VGSL +PEETLLRYVRL+KS GLKAKP+FAV FN+SDIP    RAFGAYV   PRS++
Sbjct: 123 VGSLGVPEETLLRYVRLIKSGGLKAKPQFAVKFNRSDIPIGGHRAFGAYVPPTPRSSE 180

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|449454694\|ref\|XP_004145089.1\| PREDICTED: uncharacterized protein LOC101208408 [Cucumis sativus] gi\|449473349\|ref\|XP_004153856.1\| PREDICTED: uncharacterized protein LOC101220954 [Cucumis sativus] gi\|449488403\|ref\|XP_004158021.1\| PREDICTED: uncharacterized protein LOC101228109 [Cucumis sativus]	Back alignment and taxonomy information

>gi\|255555077\|ref\|XP_002518576.1\| furin, putative [Ricinus communis] gi\|223542421\|gb\|EEF43963.1\| furin, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|297804020\|ref\|XP_002869894.1\| hypothetical protein ARALYDRAFT_329472 [Arabidopsis lyrata subsp. lyrata] gi\|297315730\|gb\|EFH46153.1\| hypothetical protein ARALYDRAFT_329472 [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

>gi\|3402751\|emb\|CAA20197.1\| putative protein [Arabidopsis thaliana] gi\|7268928\|emb\|CAB79131.1\| putative protein [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|30685384\|ref\|NP_567623.2\| Aldolase-type TIM barrel family protein [Arabidopsis thaliana] gi\|26452567\|dbj\|BAC43368.1\| unknown protein [Arabidopsis thaliana] gi\|332659039\|gb\|AEE84439.1\| Aldolase-type TIM barrel family protein [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|356524766\|ref\|XP_003530999.1\| PREDICTED: uncharacterized protein LOC100805668 [Glycine max]	Back alignment and taxonomy information

>gi\|255639187\|gb\|ACU19892.1\| unknown [Glycine max]	Back alignment and taxonomy information

>gi\|357123468\|ref\|XP_003563432.1\| PREDICTED: uncharacterized protein LOC100846790 [Brachypodium distachyon]	Back alignment and taxonomy information

>gi\|356519509\|ref\|XP_003528415.1\| PREDICTED: uncharacterized protein LOC100781391 [Glycine max]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		201
TAIR\|locus:2141196		286	HSA32 "HEAT-STRESS-ASSOCIATED	0.860	0.604	0.714	1.5e-67
UNIPROTKB\|Q653W2		302	P0547F09.36 "Phosphosulfolacta	0.845	0.562	0.611	5.9e-57
ASPGD\|ASPL0000047680		342	AN10197 [Emericella nidulans (	0.542	0.318	0.482	6.9e-32
UNIPROTKB\|Q5BDB6		1107	AN1464.2 "Putative uncharacter	0.542	0.098	0.482	4.7e-31
UNIPROTKB\|Q83AE7		290	CBU_1954 "(2R)-phospho-3-sulfo	0.661	0.458	0.326	1.4e-18
TIGR_CMR\|CBU_1954		290	CBU_1954 "hypothetical protein	0.661	0.458	0.326	1.4e-18

TAIR\|locus:2141196 HSA32 "HEAT-STRESS-ASSOCIATED 32" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 686 (246.5 bits), Expect = 1.5e-67, P = 1.5e-67
 Identities = 125/175 (71%), Positives = 153/175 (87%)

Query:     5 YYGWKSFDEYEDRAEKPRRFGVTEMRSPHYTLSSSHNVLEDIFESMGQFVDGLKFSGGSH 64
             YY WKSF+E EDR EKPRR+GVTEMR PHY++ S  N+L++IFESMGQFVDGLKFSGGS+
Sbjct:     4 YYRWKSFEENEDRPEKPRRYGVTEMRGPHYSVLSQ-NLLQEIFESMGQFVDGLKFSGGSN 62

Query:    65 SLMPKPFIEEVVKRAHQHDVYVSTGDWAEHLIRNGPSAFKEYVEDCKQVGFDTIELNVGS 124
             SL+PK FI++ ++ AH+H VYVSTGDWAEH++R+GPSAFK+YVE+CKQ+GFDTIELN   
Sbjct:    63 SLIPKSFIKQAIEMAHEHGVYVSTGDWAEHMLRSGPSAFKDYVEECKQLGFDTIELNANL 122

Query:   125 LEIPEETLLRYVRLVKSAGLKAKPKFAVMFNKSDIPSDRDRAFGAYVARAPRSTD 179
             LE+PEETLLRYVRL+K+ GL+AKP FAV FNKSDIP  R+RAFG+YV   PRS++
Sbjct:   123 LEVPEETLLRYVRLIKNGGLRAKPMFAVKFNKSDIPG-RNRAFGSYVVPEPRSSE 176

GO:0003824 "catalytic activity" evidence=IEA

GO:0004252 "serine-type endopeptidase activity" evidence=IBA

GO:0005618 "cell wall" evidence=IBA

GO:0005634 "nucleus" evidence=ISM

GO:0008152 "metabolic process" evidence=IBA

GO:0009408 "response to heat" evidence=IEP;RCA

GO:0010286 "heat acclimation" evidence=RCA;IMP

GO:0006457 "protein folding" evidence=RCA

GO:0009644 "response to high light intensity" evidence=RCA

GO:0042542 "response to hydrogen peroxide" evidence=RCA

GO:0010608 "posttranscriptional regulation of gene expression" evidence=IMP

UNIPROTKB\|Q653W2 P0547F09.36 "Phosphosulfolactate synthase-related protein" [Oryza sativa Japonica Group (taxid:39947)]	Back alignment and assigned GO terms

ASPGD\|ASPL0000047680 AN10197 [Emericella nidulans (taxid:162425)]	Back alignment and assigned GO terms

UNIPROTKB\|Q5BDB6 AN1464.2 "Putative uncharacterized protein" [Aspergillus nidulans FGSC A4 (taxid:227321)]	Back alignment and assigned GO terms

UNIPROTKB\|Q83AE7 CBU_1954 "(2R)-phospho-3-sulfolactate synthase" [Coxiella burnetii RSA 493 (taxid:227377)]	Back alignment and assigned GO terms

TIGR_CMR\|CBU_1954 CBU_1954 "hypothetical protein" [Coxiella burnetii RSA 493 (taxid:227377)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

Prediction Level	EC number	Confidence of Prediction
4th Layer	4.4.1.19	LOW CONFIDENCE prediction!
3rd Layer	4.4.1	LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		201
pfam02679		245	pfam02679, ComA, (2R)-phospho-3-sulfolactate synth	7e-50
COG1809		258	COG1809, COG1809, (2R)-phospho-3-sulfolactate synt	5e-25
TIGR03849		237	TIGR03849, arch_ComA, phosphosulfolactate synthase	4e-08

>gnl\|CDD\|190389 pfam02679, ComA, (2R)-phospho-3-sulfolactate synthase (ComA)	Back alignment and domain information

 Score =  161 bits (410), Expect = 7e-50
 Identities = 53/136 (38%), Positives = 79/136 (58%), Gaps = 5/136 (3%)

Query: 15  EDRAEKPRRFGVTEMRSPHYTLSSSHNVLEDIFESMGQFVDGLKFSGGSHSLMPKPFIEE 74
            +R EKPRR G+T +             LED+ ES G ++D LKF  G+ +LMP+  ++E
Sbjct: 4   PERPEKPRRTGLTMVLDKGLGPRF----LEDLLESAGDYIDFLKFGWGTSALMPEDILKE 59

Query: 75  VVKRAHQHDVYVSTGDWAEHLIRNGPSAFKEYVEDCKQVGFDTIELNVGSLEIPEETLLR 134
            +  AH+H VYV TG     +  +    F EY+ +CK++GFD IE++ G++E+PEE  LR
Sbjct: 60  KIDLAHEHGVYVYTGGTLFEIAIS-QGKFDEYLRECKELGFDAIEISDGTIELPEEERLR 118

Query: 135 YVRLVKSAGLKAKPKF 150
            +R  K AG K   + 
Sbjct: 119 LIRKAKKAGFKVLSEV 134

In methanobacteria (2R)-phospho-3-sulfolactate synthase (ComA) catalyzes the first step of the biosynthesis of coenzyme M from phosphoenolpyruvate (P-enolpyruvate). This novel enzyme catalyzes the stereospecific Michael addition of sulfite to P-enolpyruvate, forming L-2-phospho-3-sulfolactate (PSL). It is suggested that the ComA-catalyzed reaction is analogous to those reactions catalyzed by beta-elimination enzymes that proceed through an enolate intermediate. Length = 245

>gnl\|CDD\|224722 COG1809, COG1809, (2R)-phospho-3-sulfolactate synthase (PSL synthase, CoM biosynthesis) [Coenzyme transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|163561 TIGR03849, arch_ComA, phosphosulfolactate synthase	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		201
PF02679		244	ComA: (2R)-phospho-3-sulfolactate synthase (ComA);	100.0
TIGR03849		237	arch_ComA phosphosulfolactate synthase. This model	100.0
COG1809		258	(2R)-phospho-3-sulfolactate synthase (PSL synthase	100.0
PRK06294		370	coproporphyrinogen III oxidase; Provisional	96.56
PRK08195		337	4-hyroxy-2-oxovalerate/4-hydroxy-2-oxopentanoic ac	96.52
PRK08446		350	coproporphyrinogen III oxidase; Provisional	96.39
TIGR03217		333	4OH_2_O_val_ald 4-hydroxy-2-oxovalerate aldolase.	96.16
cd07939		259	DRE_TIM_NifV Streptomyces rubellomurinus FrbC and	96.03
cd07943		263	DRE_TIM_HOA 4-hydroxy-2-oxovalerate aldolase, N-te	96.0
cd07937		275	DRE_TIM_PC_TC_5S Pyruvate carboxylase and Transcar	95.95
PRK05628		375	coproporphyrinogen III oxidase; Validated	95.93
cd07944		266	DRE_TIM_HOA_like 4-hydroxy-2-oxovalerate aldolase-	95.86
PRK13209		283	L-xylulose 5-phosphate 3-epimerase; Reviewed	95.68
PRK05904		353	coproporphyrinogen III oxidase; Provisional	95.31
TIGR00539		360	hemN_rel putative oxygen-independent coproporphyri	95.25
TIGR00538		455	hemN oxygen-independent coproporphyrinogen III oxi	95.21
PRK07379		400	coproporphyrinogen III oxidase; Provisional	95.19
PRK13210		284	putative L-xylulose 5-phosphate 3-epimerase; Revie	95.09
cd06547		339	GH85_ENGase Endo-beta-N-acetylglucosaminidase (ENG	95.07
COG0826		347	Collagenase and related proteases [Posttranslation	94.8
PRK13347		453	coproporphyrinogen III oxidase; Provisional	94.74
cd03174		265	DRE_TIM_metallolyase DRE-TIM metallolyase superfam	94.66
cd07941		273	DRE_TIM_LeuA3 Desulfobacterium autotrophicum LeuA3	94.63
PRK08208		430	coproporphyrinogen III oxidase; Validated	94.58
PRK05660		378	HemN family oxidoreductase; Provisional	94.55
PRK13125		244	trpA tryptophan synthase subunit alpha; Provisiona	94.45
PRK09249		453	coproporphyrinogen III oxidase; Provisional	94.4
TIGR02660		365	nifV_homocitr homocitrate synthase NifV. This fami	94.15
TIGR03551		343	F420_cofH 7,8-didemethyl-8-hydroxy-5-deazariboflav	93.99
PRK11858		378	aksA trans-homoaconitate synthase; Reviewed	93.88
cd07940		268	DRE_TIM_IPMS 2-isopropylmalate synthase (IPMS), N-	93.87
PF00682		237	HMGL-like: HMGL-like of this family is not conserv	93.83
PRK06582		390	coproporphyrinogen III oxidase; Provisional	93.82
PRK05799		374	coproporphyrinogen III oxidase; Provisional	93.69
PRK08599		377	coproporphyrinogen III oxidase; Provisional	93.64
PRK09057		380	coproporphyrinogen III oxidase; Provisional	93.59
TIGR00542		279	hxl6Piso_put hexulose-6-phosphate isomerase, putat	93.54
cd04726		202	KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxyl	93.38
PRK08207		488	coproporphyrinogen III oxidase; Provisional	93.03
COG3623		287	SgaU Putative L-xylulose-5-phosphate 3-epimerase [	93.03
PRK09282		592	pyruvate carboxylase subunit B; Validated	92.93
PRK05692		287	hydroxymethylglutaryl-CoA lyase; Provisional	92.84
PRK13111		258	trpA tryptophan synthase subunit alpha; Provisiona	92.8
cd07948		262	DRE_TIM_HCS Saccharomyces cerevisiae homocitrate s	92.73
TIGR02495		191	NrdG2 anaerobic ribonucleoside-triphosphate reduct	92.73
cd04722		200	TIM_phosphate_binding TIM barrel proteins share a	92.71
TIGR02668		302	moaA_archaeal probable molybdenum cofactor biosynt	92.67
PRK12581		468	oxaloacetate decarboxylase; Provisional	92.49
COG2896		322	MoaA Molybdenum cofactor biosynthesis enzyme [Coen	92.42
PRK14042		596	pyruvate carboxylase subunit B; Provisional	92.22
PRK12331		448	oxaloacetate decarboxylase; Provisional	92.05
smart00729		216	Elp3 Elongator protein 3, MiaB family, Radical SAM	91.82
TIGR03151		307	enACPred_II putative enoyl-(acyl-carrier-protein)	91.75
PRK09856		275	fructoselysine 3-epimerase; Provisional	91.72
COG0159		265	TrpA Tryptophan synthase alpha chain [Amino acid t	91.66
PLN02591		250	tryptophan synthase	91.6
TIGR01108		582	oadA oxaloacetate decarboxylase alpha subunit. Thi	91.36
TIGR02090		363	LEU1_arch isopropylmalate/citramalate/homocitrate	91.26
TIGR02666		334	moaA molybdenum cofactor biosynthesis protein A, b	91.23
TIGR03128		206	RuMP_HxlA 3-hexulose-6-phosphate synthase. at the	91.14
PF00215		226	OMPdecase: Orotidine 5'-phosphate decarboxylase /	91.08
PRK00164		331	moaA molybdenum cofactor biosynthesis protein A; R	91.05
PRK12344		524	putative alpha-isopropylmalate/homocitrate synthas	90.93
PF04055		166	Radical_SAM: Radical SAM superfamily; InterPro: IP	90.93
PRK14041		467	oxaloacetate decarboxylase; Provisional	90.9
PRK09989		258	hypothetical protein; Provisional	90.86
PRK07094		323	biotin synthase; Provisional	90.84
TIGR01212		302	radical SAM protein, TIGR01212 family. This unchar	90.81
PRK14040		593	oxaloacetate decarboxylase; Provisional	90.69
cd04724		242	Tryptophan_synthase_alpha Ttryptophan synthase (TR	90.39
TIGR03699		340	mena_SCO4550 menaquinone biosynthesis protein, SCO	90.27
PRK09058		449	coproporphyrinogen III oxidase; Provisional	90.25
cd07945		280	DRE_TIM_CMS Leptospira interrogans citramalate syn	90.22
PRK01060		281	endonuclease IV; Provisional	90.01
TIGR02109		358	PQQ_syn_pqqE coenzyme PQQ biosynthesis protein E.	89.98
TIGR03234		254	OH-pyruv-isom hydroxypyruvate isomerase. This enzy	89.92
PRK05301		378	pyrroloquinoline quinone biosynthesis protein PqqE	89.72
TIGR01211		522	ELP3 histone acetyltransferase, ELP3 family. The S	89.71
PRK13361		329	molybdenum cofactor biosynthesis protein A; Provis	89.67
CHL00200		263	trpA tryptophan synthase alpha subunit; Provisiona	89.62
PRK09997		258	hydroxypyruvate isomerase; Provisional	89.42
smart00642		166	Aamy Alpha-amylase domain.	89.3
TIGR03470		318	HpnH hopanoid biosynthesis associated radical SAM	88.9
cd04743		320	NPD_PKS 2-Nitropropane dioxygenase (NPD)-like doma	88.46
TIGR00736		231	nifR3_rel_arch TIM-barrel protein, putative. Membe	88.32
PF00290		259	Trp_syntA: Tryptophan synthase alpha chain; InterP	88.27
PRK12330		499	oxaloacetate decarboxylase; Provisional	88.23
TIGR00262		256	trpA tryptophan synthase, alpha subunit. Tryptopha	88.17
PF03060		330	NMO: Nitronate monooxygenase; InterPro: IPR004136	87.99
PRK13813		215	orotidine 5'-phosphate decarboxylase; Provisional	87.76
COG1082		274	IolE Sugar phosphate isomerases/epimerases [Carboh	87.55
PRK08446		350	coproporphyrinogen III oxidase; Provisional	87.3
cd02874		313	GH18_CFLE_spore_hydrolase Cortical fragment-lytic	87.11
smart00481		67	POLIIIAc DNA polymerase alpha chain like domain. D	86.99
cd03174		265	DRE_TIM_metallolyase DRE-TIM metallolyase superfam	86.92
PF01212		290	Beta_elim_lyase: Beta-eliminating lyase; InterPro:	86.44
TIGR00423		309	radical SAM domain protein, CofH subfamily. This p	86.32
PRK13347		453	coproporphyrinogen III oxidase; Provisional	86.28
PF01301		319	Glyco_hydro_35: Glycosyl hydrolases family 35; Int	85.72
PRK05660		378	HemN family oxidoreductase; Provisional	85.62
COG1105		310	FruK Fructose-1-phosphate kinase and related fruct	85.55
PF01261		213	AP_endonuc_2: Xylose isomerase-like TIM barrel; In	85.33
cd01335		204	Radical_SAM Radical SAM superfamily. Enzymes of th	85.32
PRK08445		348	hypothetical protein; Provisional	85.27
PRK07379		400	coproporphyrinogen III oxidase; Provisional	85.05
PRK12999		1146	pyruvate carboxylase; Reviewed	85.02
cd07938		274	DRE_TIM_HMGL 3-hydroxy-3-methylglutaryl-CoA lyase,	85.01
cd06543		294	GH18_PF-ChiA-like PF-ChiA is an uncharacterized ch	84.84
PRK05926		370	hypothetical protein; Provisional	84.76
PLN02746		347	hydroxymethylglutaryl-CoA lyase	84.52
PF04476		235	DUF556: Protein of unknown function (DUF556); Inte	84.4
PRK05904		353	coproporphyrinogen III oxidase; Provisional	84.2
PRK00125		278	pyrF orotidine 5'-phosphate decarboxylase; Reviewe	83.98
PLN02951		373	Molybderin biosynthesis protein CNX2	83.78
cd02875		358	GH18_chitobiase Chitobiase (also known as di-N-ace	83.75
TIGR00539		360	hemN_rel putative oxygen-independent coproporphyri	83.5
cd07937		275	DRE_TIM_PC_TC_5S Pyruvate carboxylase and Transcar	82.56
PF01261		213	AP_endonuc_2: Xylose isomerase-like TIM barrel; In	82.56
PRK08898		394	coproporphyrinogen III oxidase; Provisional	82.18
cd04730		236	NPD_like 2-Nitropropane dioxygenase (NPD), one of	82.03
PF00128		316	Alpha-amylase: Alpha amylase, catalytic domain; In	82.0
TIGR01235		1143	pyruv_carbox pyruvate carboxylase. This enzyme pla	81.87
cd00019		279	AP2Ec AP endonuclease family 2; These endonuclease	81.79
PF10566		273	Glyco_hydro_97: Glycoside hydrolase 97 ; InterPro:	81.73
PRK05628		375	coproporphyrinogen III oxidase; Validated	81.43
PRK09249		453	coproporphyrinogen III oxidase; Provisional	81.38
PRK09061		509	D-glutamate deacylase; Validated	81.21
PRK08323		459	phenylhydantoinase; Validated	81.13
cd06545		253	GH18_3CO4_chitinase The Bacteroides thetaiotaomicr	81.1
PRK04302		223	triosephosphate isomerase; Provisional	80.43
TIGR01740		213	pyrF orotidine 5'-phosphate decarboxylase, subfami	80.41
PRK08208		430	coproporphyrinogen III oxidase; Validated	80.4

>PF02679 ComA: (2R)-phospho-3-sulfolactate synthase (ComA); InterPro: IPR003830 Methanogenic archaea produce methane via the anaerobic reduction of acetate or single carbon compounds []	Back alignment and domain information

Probab=100.00  E-value=6e-63  Score=430.50  Aligned_cols=164  Identities=35%  Similarity=0.577  Sum_probs=136.3

Q ss_pred             CCCCCCCCCCCCCceeEecCCCCCCcchhHHHHHHHhhcccccEEEeeCccccccChhHHHHHHHHHHhCCceecCc-cH
Q 028948           13 EYEDRAEKPRRFGVTEMRSPHYTLSSSHNVLEDIFESMGQFVDGLKFSGGSHSLMPKPFIEEVVKRAHQHDVYVSTG-DW   91 (201)
Q Consensus        13 ~~~~R~~KPR~~GlTmV~DkG~s~~~g~~~l~DlLe~ag~yID~lKfg~GTs~l~p~~~L~eKI~l~~~~gV~v~~G-tl   91 (201)
                      ++|+|++|||++|+|||+|||+    |+++++|+|++||+|||++|||||||+|||+++|++||++||+|||+|||| |+
T Consensus         1 ~~~~R~~KPR~~GlT~v~Dkgl----g~~~~~dlLe~ag~yID~~K~g~Gt~~l~~~~~l~eki~l~~~~gV~v~~GGtl   76 (244)
T PF02679_consen    1 NLPERPEKPRSRGLTMVIDKGL----GLRYLEDLLESAGDYIDFLKFGWGTSALYPEEILKEKIDLAHSHGVYVYPGGTL   76 (244)
T ss_dssp             -TTGGG-SS-SSS-EEEEESS------HHHHHHHHHHHGGG-SEEEE-TTGGGGSTCHHHHHHHHHHHCTT-EEEE-HHH
T ss_pred             CCCCCCCCCCCCCcEEEecCCC----CHHHHHHHHHHhhhhccEEEecCceeeecCHHHHHHHHHHHHHcCCeEeCCcHH
Confidence            4789999999999999999998    888999999999999999999999999999999999999999999999997 79


Q ss_pred             HHHHHHhCCchHHHHHHHHHHcCCCEEEecCCcccCChhHHHHHHHHHHHCCCeEccccccccCC---------------
Q 028948           92 AEHLIRNGPSAFKEYVEDCKQVGFDTIELNVGSLEIPEETLLRYVRLVKSAGLKAKPKFAVMFNK---------------  156 (201)
Q Consensus        92 fE~al~qg~~~~~eyl~~~k~lGFd~IEISdGti~i~~~~r~~lI~~~~~~Gf~v~pE~g~k~~~---------------  156 (201)
                      ||+|++|+  ++++|+++||+|||++|||||||++||+++|+++|++++++||+|+||+|+|...               
T Consensus        77 ~E~a~~q~--~~~~yl~~~k~lGf~~IEiSdGti~l~~~~r~~~I~~~~~~Gf~v~~EvG~K~~~~~~~~~~~~~i~~~~  154 (244)
T PF02679_consen   77 FEVAYQQG--KFDEYLEECKELGFDAIEISDGTIDLPEEERLRLIRKAKEEGFKVLSEVGKKDPESDFSLDPEELIEQAK  154 (244)
T ss_dssp             HHHHHHTT---HHHHHHHHHHCT-SEEEE--SSS---HHHHHHHHHHHCCTTSEEEEEES-SSHHHHTT--CCHHHHHHH
T ss_pred             HHHHHhcC--hHHHHHHHHHHcCCCEEEecCCceeCCHHHHHHHHHHHHHCCCEEeecccCCCchhcccCCHHHHHHHHH
Confidence            99999999  9999999999999999999999999999999999999999999999999999864               


Q ss_pred             CCcccccccccccEEEecccCcCeeccccCC
Q 028948          157 SDIPSDRDRAFGAYVARAPRSTDKLFLASNP  187 (201)
Q Consensus       157 ~dl~ag~~~a~g~~Vi~E~Res~~v~~~~~~  187 (201)
                      .|++|||+     +||+|+||||+.|+++|-
T Consensus       155 ~dLeAGA~-----~ViiEarEsG~~Gi~~~~  180 (244)
T PF02679_consen  155 RDLEAGAD-----KVIIEARESGKGGIYDND  180 (244)
T ss_dssp             HHHHHTEC-----EEEE--TTT--STTB-TT
T ss_pred             HHHHCCCC-----EEEEeeeccCCCCccCCC
Confidence            56888888     999999999999999874

Coenzyme M (CoM; 2-mercaptoethanesulphonic acid) serves as the terminal methyl carrier for this process. Previously thought to be unique to methanogenic archaea, CoM has also been found in methylotrophic bacteria. Biosynthesis of CoM begins with the Michael addition of sulphite to phosphoenolpyruvate, forming 2-phospho-3-sulpholactate (PSL). This reaction is catalyzed by members of this family, PSL synthase (ComA) []. Subsequently, PSL is dephosphorylated by phosphosulpholactate phosphatase (ComB) to form 3-sulpholactate [], which is then converted to 3-sulphopyruvate by L-sulpholactate dehydrogenase (ComC; 1.1.1.272 from EC) []. Sulphopyruvate decarboxylase (ComDE; 4.1.1.79 from EC) converts 3-sulphopyruvate to sulphoacetaldehyde []. Reductive thiolation of sulphoacetaldehyde is the final step.; GO: 0019295 coenzyme M biosynthetic process; PDB: 1U83_A 1QWG_A.

>TIGR03849 arch_ComA phosphosulfolactate synthase	Back alignment and domain information

>COG1809 (2R)-phospho-3-sulfolactate synthase (PSL synthase, CoM biosynthesis) [Coenzyme transport and metabolism]	Back alignment and domain information

>PRK06294 coproporphyrinogen III oxidase; Provisional	Back alignment and domain information

>PRK08195 4-hyroxy-2-oxovalerate/4-hydroxy-2-oxopentanoic acid aldolase,; Validated	Back alignment and domain information

>PRK08446 coproporphyrinogen III oxidase; Provisional	Back alignment and domain information

>TIGR03217 4OH_2_O_val_ald 4-hydroxy-2-oxovalerate aldolase	Back alignment and domain information

>cd07939 DRE_TIM_NifV Streptomyces rubellomurinus FrbC and related proteins, catalytic TIM barrel domain	Back alignment and domain information

>cd07943 DRE_TIM_HOA 4-hydroxy-2-oxovalerate aldolase, N-terminal catalytic TIM barrel domain	Back alignment and domain information

>cd07937 DRE_TIM_PC_TC_5S Pyruvate carboxylase and Transcarboxylase 5S, carboxyltransferase domain	Back alignment and domain information

>PRK05628 coproporphyrinogen III oxidase; Validated	Back alignment and domain information

>cd07944 DRE_TIM_HOA_like 4-hydroxy-2-oxovalerate aldolase-like, N-terminal catalytic TIM barrel domain	Back alignment and domain information

>PRK13209 L-xylulose 5-phosphate 3-epimerase; Reviewed	Back alignment and domain information

>PRK05904 coproporphyrinogen III oxidase; Provisional	Back alignment and domain information

>TIGR00539 hemN_rel putative oxygen-independent coproporphyrinogen III oxidase	Back alignment and domain information

>TIGR00538 hemN oxygen-independent coproporphyrinogen III oxidase	Back alignment and domain information

>PRK07379 coproporphyrinogen III oxidase; Provisional	Back alignment and domain information

>PRK13210 putative L-xylulose 5-phosphate 3-epimerase; Reviewed	Back alignment and domain information

>cd06547 GH85_ENGase Endo-beta-N-acetylglucosaminidase (ENGase) hydrolyzes the N-N'-diacetylchitobiosyl core of N-glycosylproteins	Back alignment and domain information

>COG0826 Collagenase and related proteases [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK13347 coproporphyrinogen III oxidase; Provisional	Back alignment and domain information

>cd03174 DRE_TIM_metallolyase DRE-TIM metallolyase superfamily	Back alignment and domain information

>cd07941 DRE_TIM_LeuA3 Desulfobacterium autotrophicum LeuA3 and related proteins, N-terminal catalytic TIM barrel domain	Back alignment and domain information

>PRK08208 coproporphyrinogen III oxidase; Validated	Back alignment and domain information

>PRK05660 HemN family oxidoreductase; Provisional	Back alignment and domain information

>PRK13125 trpA tryptophan synthase subunit alpha; Provisional	Back alignment and domain information

>PRK09249 coproporphyrinogen III oxidase; Provisional	Back alignment and domain information

>TIGR02660 nifV_homocitr homocitrate synthase NifV	Back alignment and domain information

>TIGR03551 F420_cofH 7,8-didemethyl-8-hydroxy-5-deazariboflavin synthase, CofH subunit	Back alignment and domain information

>PRK11858 aksA trans-homoaconitate synthase; Reviewed	Back alignment and domain information

>cd07940 DRE_TIM_IPMS 2-isopropylmalate synthase (IPMS), N-terminal catalytic TIM barrel domain	Back alignment and domain information

>PF00682 HMGL-like: HMGL-like of this family is not conserved in other members	Back alignment and domain information

>PRK06582 coproporphyrinogen III oxidase; Provisional	Back alignment and domain information

>PRK05799 coproporphyrinogen III oxidase; Provisional	Back alignment and domain information

>PRK08599 coproporphyrinogen III oxidase; Provisional	Back alignment and domain information

>PRK09057 coproporphyrinogen III oxidase; Provisional	Back alignment and domain information

>TIGR00542 hxl6Piso_put hexulose-6-phosphate isomerase, putative	Back alignment and domain information

>cd04726 KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxylase (KGPDC) and D-arabino-3-hexulose-6-phosphate synthase (HPS)	Back alignment and domain information

>PRK08207 coproporphyrinogen III oxidase; Provisional	Back alignment and domain information

>COG3623 SgaU Putative L-xylulose-5-phosphate 3-epimerase [Carbohydrate transport and metabolism]	Back alignment and domain information

>PRK09282 pyruvate carboxylase subunit B; Validated	Back alignment and domain information

>PRK05692 hydroxymethylglutaryl-CoA lyase; Provisional	Back alignment and domain information

>PRK13111 trpA tryptophan synthase subunit alpha; Provisional	Back alignment and domain information

>cd07948 DRE_TIM_HCS Saccharomyces cerevisiae homocitrate synthase and related proteins, catalytic TIM barrel domain	Back alignment and domain information

>TIGR02495 NrdG2 anaerobic ribonucleoside-triphosphate reductase activating protein	Back alignment and domain information

>cd04722 TIM_phosphate_binding TIM barrel proteins share a structurally conserved phosphate binding motif and in general share an eight beta/alpha closed barrel structure	Back alignment and domain information

>TIGR02668 moaA_archaeal probable molybdenum cofactor biosynthesis protein A, archaeal	Back alignment and domain information

>PRK12581 oxaloacetate decarboxylase; Provisional	Back alignment and domain information

>COG2896 MoaA Molybdenum cofactor biosynthesis enzyme [Coenzyme metabolism]	Back alignment and domain information

>PRK14042 pyruvate carboxylase subunit B; Provisional	Back alignment and domain information

>PRK12331 oxaloacetate decarboxylase; Provisional	Back alignment and domain information

>smart00729 Elp3 Elongator protein 3, MiaB family, Radical SAM	Back alignment and domain information

>TIGR03151 enACPred_II putative enoyl-(acyl-carrier-protein) reductase II	Back alignment and domain information

>PRK09856 fructoselysine 3-epimerase; Provisional	Back alignment and domain information

>COG0159 TrpA Tryptophan synthase alpha chain [Amino acid transport and metabolism]	Back alignment and domain information

>PLN02591 tryptophan synthase	Back alignment and domain information

>TIGR01108 oadA oxaloacetate decarboxylase alpha subunit	Back alignment and domain information

>TIGR02090 LEU1_arch isopropylmalate/citramalate/homocitrate synthases	Back alignment and domain information

>TIGR02666 moaA molybdenum cofactor biosynthesis protein A, bacterial	Back alignment and domain information

>TIGR03128 RuMP_HxlA 3-hexulose-6-phosphate synthase	Back alignment and domain information

>PF00215 OMPdecase: Orotidine 5'-phosphate decarboxylase / HUMPS family; InterPro: IPR001754 Orotidine 5'-phosphate decarboxylase (OMPdecase) [, ] catalyses the last step in the de novo biosynthesis of pyrimidines, the decarboxylation of OMP into UMP	Back alignment and domain information

>PRK00164 moaA molybdenum cofactor biosynthesis protein A; Reviewed	Back alignment and domain information

>PRK12344 putative alpha-isopropylmalate/homocitrate synthase family transferase; Provisional	Back alignment and domain information

>PF04055 Radical_SAM: Radical SAM superfamily; InterPro: IPR007197 Radical SAM proteins catalyze diverse reactions, including unusual methylations, isomerization, sulphur insertion, ring formation, anaerobic oxidation and protein radical formation	Back alignment and domain information

>PRK14041 oxaloacetate decarboxylase; Provisional	Back alignment and domain information

>PRK09989 hypothetical protein; Provisional	Back alignment and domain information

>PRK07094 biotin synthase; Provisional	Back alignment and domain information

>TIGR01212 radical SAM protein, TIGR01212 family	Back alignment and domain information

>PRK14040 oxaloacetate decarboxylase; Provisional	Back alignment and domain information

>cd04724 Tryptophan_synthase_alpha Ttryptophan synthase (TRPS) alpha subunit (TSA)	Back alignment and domain information

>TIGR03699 mena_SCO4550 menaquinone biosynthesis protein, SCO4550 family	Back alignment and domain information

>PRK09058 coproporphyrinogen III oxidase; Provisional	Back alignment and domain information

>cd07945 DRE_TIM_CMS Leptospira interrogans citramalate synthase (CMS) and related proteins, N-terminal catalytic TIM barrel domain	Back alignment and domain information

>PRK01060 endonuclease IV; Provisional	Back alignment and domain information

>TIGR02109 PQQ_syn_pqqE coenzyme PQQ biosynthesis protein E	Back alignment and domain information

>TIGR03234 OH-pyruv-isom hydroxypyruvate isomerase	Back alignment and domain information

>PRK05301 pyrroloquinoline quinone biosynthesis protein PqqE; Provisional	Back alignment and domain information

>TIGR01211 ELP3 histone acetyltransferase, ELP3 family	Back alignment and domain information

>PRK13361 molybdenum cofactor biosynthesis protein A; Provisional	Back alignment and domain information

>CHL00200 trpA tryptophan synthase alpha subunit; Provisional	Back alignment and domain information

>PRK09997 hydroxypyruvate isomerase; Provisional	Back alignment and domain information

>smart00642 Aamy Alpha-amylase domain	Back alignment and domain information

>TIGR03470 HpnH hopanoid biosynthesis associated radical SAM protein HpnH	Back alignment and domain information

>cd04743 NPD_PKS 2-Nitropropane dioxygenase (NPD)-like domain, associated with polyketide synthases (PKS)	Back alignment and domain information

>TIGR00736 nifR3_rel_arch TIM-barrel protein, putative	Back alignment and domain information

>PF00290 Trp_syntA: Tryptophan synthase alpha chain; InterPro: IPR002028 Tryptophan synthase (4	Back alignment and domain information

>PRK12330 oxaloacetate decarboxylase; Provisional	Back alignment and domain information

>TIGR00262 trpA tryptophan synthase, alpha subunit	Back alignment and domain information

>PF03060 NMO: Nitronate monooxygenase; InterPro: IPR004136 2-Nitropropane dioxygenase (1	Back alignment and domain information

>PRK13813 orotidine 5'-phosphate decarboxylase; Provisional	Back alignment and domain information

>COG1082 IolE Sugar phosphate isomerases/epimerases [Carbohydrate transport and metabolism]	Back alignment and domain information

>PRK08446 coproporphyrinogen III oxidase; Provisional	Back alignment and domain information

>cd02874 GH18_CFLE_spore_hydrolase Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination	Back alignment and domain information

>smart00481 POLIIIAc DNA polymerase alpha chain like domain	Back alignment and domain information

>cd03174 DRE_TIM_metallolyase DRE-TIM metallolyase superfamily	Back alignment and domain information

>PF01212 Beta_elim_lyase: Beta-eliminating lyase; InterPro: IPR001597 This domain is found in many tryptophanases (tryptophan indole-lyase, TNase), tyrosine phenol-lyases (TPL) and threonine aldolases	Back alignment and domain information

>TIGR00423 radical SAM domain protein, CofH subfamily	Back alignment and domain information

>PRK13347 coproporphyrinogen III oxidase; Provisional	Back alignment and domain information

>PF01301 Glyco_hydro_35: Glycosyl hydrolases family 35; InterPro: IPR001944 O-Glycosyl hydrolases 3	Back alignment and domain information

>PRK05660 HemN family oxidoreductase; Provisional	Back alignment and domain information

>COG1105 FruK Fructose-1-phosphate kinase and related fructose-6-phosphate kinase (PfkB) [Carbohydrate transport and metabolism]	Back alignment and domain information

>PF01261 AP_endonuc_2: Xylose isomerase-like TIM barrel; InterPro: IPR012307 This TIM alpha/beta barrel structure is found in xylose isomerase (P19148 from SWISSPROT) and in endonuclease IV (P12638 from SWISSPROT, 3	Back alignment and domain information

>cd01335 Radical_SAM Radical SAM superfamily	Back alignment and domain information

>PRK08445 hypothetical protein; Provisional	Back alignment and domain information

>PRK07379 coproporphyrinogen III oxidase; Provisional	Back alignment and domain information

>PRK12999 pyruvate carboxylase; Reviewed	Back alignment and domain information

>cd07938 DRE_TIM_HMGL 3-hydroxy-3-methylglutaryl-CoA lyase, catalytic TIM barrel domain	Back alignment and domain information

>cd06543 GH18_PF-ChiA-like PF-ChiA is an uncharacterized chitinase found in the hyperthermophilic archaeon Pyrococcus furiosus with a glycosyl hydrolase family 18 (GH18) catalytic domain as well as a cellulose-binding domain	Back alignment and domain information

>PRK05926 hypothetical protein; Provisional	Back alignment and domain information

>PLN02746 hydroxymethylglutaryl-CoA lyase	Back alignment and domain information

>PF04476 DUF556: Protein of unknown function (DUF556); InterPro: IPR007565 The proteins in this entry are functionally uncharacterised	Back alignment and domain information

>PRK05904 coproporphyrinogen III oxidase; Provisional	Back alignment and domain information

>PRK00125 pyrF orotidine 5'-phosphate decarboxylase; Reviewed	Back alignment and domain information

>PLN02951 Molybderin biosynthesis protein CNX2	Back alignment and domain information

>cd02875 GH18_chitobiase Chitobiase (also known as di-N-acetylchitobiase) is a lysosomal glycosidase that hydrolyzes the reducing-end N-acetylglucosamine from the chitobiose core of oligosaccharides during the ordered degradation of asparagine-linked glycoproteins in eukaryotes	Back alignment and domain information

>TIGR00539 hemN_rel putative oxygen-independent coproporphyrinogen III oxidase	Back alignment and domain information

>cd07937 DRE_TIM_PC_TC_5S Pyruvate carboxylase and Transcarboxylase 5S, carboxyltransferase domain	Back alignment and domain information

>PF01261 AP_endonuc_2: Xylose isomerase-like TIM barrel; InterPro: IPR012307 This TIM alpha/beta barrel structure is found in xylose isomerase (P19148 from SWISSPROT) and in endonuclease IV (P12638 from SWISSPROT, 3	Back alignment and domain information

>PRK08898 coproporphyrinogen III oxidase; Provisional	Back alignment and domain information

>cd04730 NPD_like 2-Nitropropane dioxygenase (NPD), one of the nitroalkane oxidizing enzyme families, catalyzes oxidative denitrification of nitroalkanes to their corresponding carbonyl compounds and nitrites	Back alignment and domain information

>PF00128 Alpha-amylase: Alpha amylase, catalytic domain; InterPro: IPR006047 O-Glycosyl hydrolases 3	Back alignment and domain information

>TIGR01235 pyruv_carbox pyruvate carboxylase	Back alignment and domain information

>cd00019 AP2Ec AP endonuclease family 2; These endonucleases play a role in DNA repair	Back alignment and domain information

>PF10566 Glyco_hydro_97: Glycoside hydrolase 97 ; InterPro: IPR019563 O-Glycosyl hydrolases 3	Back alignment and domain information

>PRK05628 coproporphyrinogen III oxidase; Validated	Back alignment and domain information

>PRK09249 coproporphyrinogen III oxidase; Provisional	Back alignment and domain information

>PRK09061 D-glutamate deacylase; Validated	Back alignment and domain information

>PRK08323 phenylhydantoinase; Validated	Back alignment and domain information

>cd06545 GH18_3CO4_chitinase The Bacteroides thetaiotaomicron protein represented by pdb structure 3CO4 is an uncharacterized bacterial member of the family 18 glycosyl hydrolases with homologs found in Flavobacterium, Stigmatella, and Pseudomonas	Back alignment and domain information

>PRK04302 triosephosphate isomerase; Provisional	Back alignment and domain information

>TIGR01740 pyrF orotidine 5'-phosphate decarboxylase, subfamily 1	Back alignment and domain information

>PRK08208 coproporphyrinogen III oxidase; Validated	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		201
1qwg_A		251	PSL synthase;, (2R)-phospho-3-sulfolactate synthas	3e-43
1u83_A		276	Phosphosulfolactate synthase; structural genomics,	7e-35

>1qwg_A PSL synthase;, (2R)-phospho-3-sulfolactate synthase; beta-alpha-barrel, lyase; 1.60A {Methanocaldococcus jannaschii} SCOP: c.1.27.1 Length = 251	Back alignment and structure

 Score =  144 bits (365), Expect = 3e-43
 Identities = 28/151 (18%), Positives = 62/151 (41%), Gaps = 7/151 (4%)

Query: 16  DRAEKPRRFGVTEMRSPHYTLSSSHNVLEDIFESMGQFVDGLKFSGGSHSLMPKPFIEEV 75
           +   +  + G+T +             +ED  +  G ++D +KF  G+ +++ +  ++E 
Sbjct: 5   EFLYEDFQRGLTVVLDKGLPPKF----VEDYLKVCGDYIDFVKFGWGTSAVIDRDVVKEK 60

Query: 76  VKRAHQHDVYVST-GDWAEHLIRNGPSAFKEYVEDCKQVGFDTIELNVGSLEIPEETLLR 134
           +       + V   G   E+    G   F E++ +C+++GF+ +E++ GS +I  E    
Sbjct: 61  INYYKDWGIKVYPGGTLFEYAYSKG--KFDEFLNECEKLGFEAVEISDGSSDISLEERNN 118

Query: 135 YVRLVKSAGLKAKPKFAVMFNKSDIPSDRDR 165
            ++  K  G     +        D     D 
Sbjct: 119 AIKRAKDNGFMVLTEVGKKMPDKDKQLTIDD 149

PyMOL of 1qwg

>1u83_A Phosphosulfolactate synthase; structural genomics, phosphosulfolactate PSI, protein structure initiative, midwest center for struc genomics; 2.20A {Bacillus subtilis} SCOP: c.1.27.1 Length = 276	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		201
1u83_A		276	Phosphosulfolactate synthase; structural genomics,	100.0
1qwg_A		251	PSL synthase;, (2R)-phospho-3-sulfolactate synthas	100.0
3p6l_A		262	Sugar phosphate isomerase/epimerase; TIM barrel, s	95.44
3lmz_A		257	Putative sugar isomerase; structural genomics, joi	94.66
3p6l_A		262	Sugar phosphate isomerase/epimerase; TIM barrel, s	94.41
2ekc_A		262	AQ_1548, tryptophan synthase alpha chain; structur	93.82
1olt_A		457	Oxygen-independent coproporphyrinogen III oxidase;	93.73
3vni_A		294	Xylose isomerase domain protein TIM barrel; D-psic	93.65
3lmz_A		257	Putative sugar isomerase; structural genomics, joi	93.42
1r30_A		369	Biotin synthase; SAM radical protein, TIM barrel,	93.39
3cqj_A		295	L-ribulose-5-phosphate 3-epimerase ULAE; TIM-barre	93.27
3tva_A		290	Xylose isomerase domain protein TIM barrel; struct	93.0
3iix_A		348	Biotin synthetase, putative; adoMet radical, SAM r	92.48
1tv8_A		340	MOAA, molybdenum cofactor biosynthesis protein A;	92.48
1qtw_A		285	Endonuclease IV; DNA repair enzyme, TIM barrel, tr	92.21
2q02_A		272	Putative cytoplasmic protein; structural genomics,	92.14
2qul_A		290	D-tagatose 3-epimerase; beta/alpha barrel, isomera	92.08
3kws_A		287	Putative sugar isomerase; structural genomics, joi	91.84
3vnd_A		267	TSA, tryptophan synthase alpha chain; psychrophili	91.69
3tva_A		290	Xylose isomerase domain protein TIM barrel; struct	91.46
2zds_A		340	Putative DNA-binding protein; TIM-barrel fold, str	91.36
3bw2_A		369	2-nitropropane dioxygenase; TIM barrel, oxidoreduc	91.26
1yx1_A		264	Hypothetical protein PA2260; structural genomics,	90.89
3ble_A		337	Citramalate synthase from leptospira interrogans;	90.89
3qc0_A		275	Sugar isomerase; TIM barrel, structural genomics,	90.85
1i60_A		278	IOLI protein; beta barrel, structural genomics, PS	90.83
3ktc_A		333	Xylose isomerase; putative sugar isomerase, struct	90.75
2x7v_A		287	Probable endonuclease 4; DNA repair protein, metal	90.73
3cny_A		301	Inositol catabolism protein IOLE; xylose isomerase	90.72
3f4w_A		211	Putative hexulose 6 phosphate synthase; humps, mal	90.69
3kws_A		287	Putative sugar isomerase; structural genomics, joi	90.55
2qw5_A		335	Xylose isomerase-like TIM barrel; putative sugar p	90.42
3obe_A		305	Sugar phosphate isomerase/epimerase; structural ge	90.29
3tha_A		252	Tryptophan synthase alpha chain; structural genomi	90.07
3ajx_A		207	3-hexulose-6-phosphate synthase; HPS, OMPDC supraf	90.0
3ngf_A		269	AP endonuclease, family 2; structural genomics, se	89.52
3c8f_A		245	Pyruvate formate-lyase 1-activating enzyme; adoMet	89.34
2zvr_A		290	Uncharacterized protein TM_0416; hyperthermophIle,	89.34
2hk0_A		309	D-psicose 3-epimerase; TIM-barrel, isomerase; 2.00	89.32
3nav_A		271	Tryptophan synthase alpha chain; alpha subunit, st	89.28
1q6o_A		216	Humps, 3-keto-L-gulonate 6-phosphate decarboxylase	88.83
3aam_A		270	Endonuclease IV, endoiv; DNA repair, base excision	88.7
2vtf_A		626	Endo-beta-N-acetylglucosaminidase; hydrolase, fami	88.44
3l23_A		303	Sugar phosphate isomerase/epimerase; structural ge	88.39
3eeg_A		325	2-isopropylmalate synthase; 11106D, beta barrel, P	88.24
3dx5_A		286	Uncharacterized protein ASBF; beta-alpha barrel, p	88.06
1ydn_A		295	Hydroxymethylglutaryl-COA lyase; TIM-barrel protei	88.03
3vni_A		294	Xylose isomerase domain protein TIM barrel; D-psic	87.58
3u0h_A		281	Xylose isomerase domain protein; structural genomi	87.43
3cqj_A		295	L-ribulose-5-phosphate 3-epimerase ULAE; TIM-barre	87.1
2z1k_A		475	(NEO)pullulanase; hydrolase, structural genomics,	87.09
2ftp_A		302	Hydroxymethylglutaryl-COA lyase; structural genomi	87.03
3m47_A		228	Orotidine 5'-phosphate decarboxylase; orotidine 5'	86.85
1nvm_A		345	HOA, 4-hydroxy-2-oxovalerate aldolase; sequestered	86.75
4gqr_A		496	Pancreatic alpha-amylase; glycosyl hydrolase, diab	86.51
3aal_A		303	Probable endonuclease 4; endoiv, DNA repair, base	86.5
3qxb_A		316	Putative xylose isomerase; structural genomics, jo	86.48
1qop_A		268	Tryptophan synthase alpha chain; lyase, carbon-oxy	86.37
1k77_A		260	EC1530, hypothetical protein YGBM; TIM barrel, str	86.13
2nx9_A		464	Oxaloacetate decarboxylase 2, subunit alpha; carbo	85.93
4aie_A		549	Glucan 1,6-alpha-glucosidase; hydrolase, glycoside	85.81
3ivs_A		423	Homocitrate synthase, mitochondrial; TIM barrel, m	85.8
1gcy_A		527	Glucan 1,4-alpha-maltotetrahydrolase; beta-alpha-b	85.28
2g0w_A		296	LMO2234 protein; putative sugar isomerase, structu	84.92
1g94_A		448	Alpha-amylase; beta-alpha-8-barrel, 3 domain struc	84.91
3aam_A		270	Endonuclease IV, endoiv; DNA repair, base excision	84.9
2hk0_A		309	D-psicose 3-epimerase; TIM-barrel, isomerase; 2.00	84.75
2wc7_A		488	Alpha amylase, catalytic region; CD/PUL-hydrolyzin	84.71
2dh2_A		424	4F2 cell-surface antigen heavy chain; TIM-barrel,	84.63
1geq_A		248	Tryptophan synthase alpha-subunit; hyperthermophIl	84.59
1ht6_A		405	AMY1, alpha-amylase isozyme 1; barley, beta-alpha-	84.5
1j0h_A		588	Neopullulanase; beta-alpha-barrels, hydrolase; 1.9	84.5
3dhu_A		449	Alpha-amylase; structural genomics, hydrolase, gly	83.95
2aaa_A		484	Alpha-amylase; glycosidase; 2.10A {Aspergillus nig	83.6
2guy_A		478	Alpha-amylase A; (beta-alpha) 8 barrel, hydrolase;	83.58
3ngf_A		269	AP endonuclease, family 2; structural genomics, se	83.49
2zds_A		340	Putative DNA-binding protein; TIM-barrel fold, str	83.36
4aio_A		884	Limit dextrinase; hydrolase, pullulanase, glycosid	83.24
2qul_A		290	D-tagatose 3-epimerase; beta/alpha barrel, isomera	83.23
3bh4_A		483	Alpha-amylase; calcium, carbohydrate metabolism, g	82.98
1hvx_A		515	Alpha-amylase; hydrolase, glycosyltransferase, the	82.9
1wpc_A		485	Glucan 1,4-alpha-maltohexaosidase; maltohexaose-pr	82.81
2yb1_A		292	Amidohydrolase; HET: AMP; 1.90A {Chromobacterium v	82.75
1xim_A		393	D-xylose isomerase; isomerase(intramolecular oxido	82.7
1ud2_A		480	Amylase, alpha-amylase; calcium-free, alkaline, hy	82.65
1ea9_C		583	Cyclomaltodextrinase; hydrolase, glycosidase; 3.2A	82.61
1x7f_A		385	Outer surface protein; structural genomics, unknow	82.57
1ep3_A		311	Dihydroorotate dehydrogenase B (PYRD subunit); het	82.51
3ewb_X		293	2-isopropylmalate synthase; LEUA, structural genom	82.34
2z6i_A		332	Trans-2-enoyl-ACP reductase II; fatty acid synthes	82.3
3qc0_A		275	Sugar isomerase; TIM barrel, structural genomics,	82.12
3d3a_A		612	Beta-galactosidase; protein structure initiative I	82.02
1bxb_A		387	Xylose isomerase; xylose metabolism; 2.20A {Thermu	81.63
1i60_A		278	IOLI protein; beta barrel, structural genomics, PS	81.42
1lwj_A		441	4-alpha-glucanotransferase; alpha-amylase family,	81.41
3t7v_A		350	Methylornithine synthase PYLB; TIM-barrel fold, mu	81.17
4aef_A		645	Neopullulanase (alpha-amylase II); hydrolase, ther	81.16
3bg3_A		718	Pyruvate carboxylase, mitochondrial; TIM barrel, A	80.91
1wzl_A		585	Alpha-amylase II; pullulan, GH-13, alpha-amylase f	80.83
2cw6_A		298	Hydroxymethylglutaryl-COA lyase, mitochondrial; HM	80.7
3gdb_A		937	Endo-D, putative uncharacterized protein SPR0440;	80.43
2fty_A		559	Dihydropyrimidinase; alpha/beta barrel, beta-sandw	80.23
3bo9_A		326	Putative nitroalkan dioxygenase; TM0800, structura	80.11
3vup_A		351	Beta-1,4-mannanase; TIM barrel, digestive fluid, H	80.11
2p0o_A		372	Hypothetical protein DUF871; structural genomics,	80.11
1f6y_A		262	5-methyltetrahydrofolate corrinoid/iron sulfur PR	80.07

>1u83_A Phosphosulfolactate synthase; structural genomics, phosphosulfolactate PSI, protein structure initiative, midwest center for struc genomics; 2.20A {Bacillus subtilis} SCOP: c.1.27.1	Back alignment and structure

Probab=100.00  E-value=1.7e-61  Score=425.87  Aligned_cols=165  Identities=19%  Similarity=0.327  Sum_probs=143.5

Q ss_pred             ccCC-CCCCCCCCCCCCCceeEecCCCCCCcchhHHHHHHHhhcccccEEEeeCccccccChhHHHHHHHHHHhCCceec
Q 028948            9 KSFD-EYEDRAEKPRRFGVTEMRSPHYTLSSSHNVLEDIFESMGQFVDGLKFSGGSHSLMPKPFIEEVVKRAHQHDVYVS   87 (201)
Q Consensus         9 ~~f~-~~~~R~~KPR~~GlTmV~DkG~s~~~g~~~l~DlLe~ag~yID~lKfg~GTs~l~p~~~L~eKI~l~~~~gV~v~   87 (201)
                      +.|. ++|.|++|||.+|+|||+|||+    |+++++|+|++||+|||++||||||++|||+  |++||++||+|||+||
T Consensus        24 ~~~~f~~~~R~~KPR~~GlT~v~Dkgl----g~~~~~DlLe~ag~yID~lKfg~GTs~l~~~--l~ekI~l~~~~gV~v~   97 (276)
T 1u83_A           24 NDFSLELPVRTNKPRETGQSILIDNGY----PLQFFKDAIAGASDYIDFVKFGWGTSLLTKD--LEEKISTLKEHDITFF   97 (276)
T ss_dssp             -CCCCCCCCCCCSSCSSSCEEEEESSC----CHHHHHHHHHHHGGGCCEEEECTTGGGGCTT--HHHHHHHHHHTTCEEE
T ss_pred             ccccCCCCCcCCCCcccCceEEecCCC----CHHHHHHHHHHhhhhcceEEecCcchhhhHH--HHHHHHHHHHcCCeEe
Confidence            3444 3699999999999999999998    8889999999999999999999999999999  9999999999999999


Q ss_pred             Cc-cHHHHHHHhCCchHHHHHHHHHHcCCCEEEecCCcccCChhHHHHHHHHHHHCCCeEccccccccCC----------
Q 028948           88 TG-DWAEHLIRNGPSAFKEYVEDCKQVGFDTIELNVGSLEIPEETLLRYVRLVKSAGLKAKPKFAVMFNK----------  156 (201)
Q Consensus        88 ~G-tlfE~al~qg~~~~~eyl~~~k~lGFd~IEISdGti~i~~~~r~~lI~~~~~~Gf~v~pE~g~k~~~----------  156 (201)
                      || ||||+|++||  ++++|+++||++||++|||||||++||+++|+++|++++++ |+|++|+|+|++.          
T Consensus        98 ~GGTlfE~~l~qg--~~~~yl~~~k~lGF~~IEISdGti~l~~~~~~~lI~~a~~~-f~Vl~EvG~K~~~~~~~~~~~~~  174 (276)
T 1u83_A           98 FGGTLFEKYVSQK--KVNEFHRYCTYFGCEYIEISNGTLPMTNKEKAAYIADFSDE-FLVLSEVGSKDAELASRQSSEEW  174 (276)
T ss_dssp             ECHHHHHHHHHTT--CHHHHHHHHHHTTCSEEEECCSSSCCCHHHHHHHHHHHTTT-SEEEEECSCCC------CCSTHH
T ss_pred             CCcHHHHHHHHcC--cHHHHHHHHHHcCCCEEEECCCcccCCHHHHHHHHHHHHhh-cEEeeeccccCccccCCCCHHHH
Confidence            98 5999999999  99999999999999999999999999999999999999999 9999999999982          


Q ss_pred             -----CCcccccccccccEEEecccCcCeeccccCC
Q 028948          157 -----SDIPSDRDRAFGAYVARAPRSTDKLFLASNP  187 (201)
Q Consensus       157 -----~dl~ag~~~a~g~~Vi~E~Res~~v~~~~~~  187 (201)
                           .||+|||+     +||+|+||||+.|+++|-
T Consensus       175 I~~~~~dLeAGA~-----~ViiEaRESG~~Gi~~~~  205 (276)
T 1u83_A          175 LEYIVEDMEAGAE-----KVITEARESGTGGICSSS  205 (276)
T ss_dssp             HHHHHHHHHHTEE-----EEEEC-------------
T ss_pred             HHHHHHHHHCCCc-----EEEEeeeccCCCCccCCC
Confidence                 57889999     999999999999999874

PyMOL of 1u83

>1qwg_A PSL synthase;, (2R)-phospho-3-sulfolactate synthase; beta-alpha-barrel, lyase; 1.60A {Methanocaldococcus jannaschii} SCOP: c.1.27.1	Back alignment and structure

>3p6l_A Sugar phosphate isomerase/epimerase; TIM barrel, structural genomics, joint center for structural genomics, JCSG; HET: CIT; 1.85A {Parabacteroides distasonis}	Back alignment and structure

>3lmz_A Putative sugar isomerase; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS isomerase; HET: MSE CIT PGE; 1.44A {Parabacteroides distasonis}	Back alignment and structure

>3p6l_A Sugar phosphate isomerase/epimerase; TIM barrel, structural genomics, joint center for structural genomics, JCSG; HET: CIT; 1.85A {Parabacteroides distasonis}	Back alignment and structure

>2ekc_A AQ_1548, tryptophan synthase alpha chain; structural genomics, lyase, NPPSFA, national project on PROT structural and functional analyses; 2.00A {Aquifex aeolicus}	Back alignment and structure

>1olt_A Oxygen-independent coproporphyrinogen III oxidase; heme biosynthesis, decarboxylase, radical SAM enzyme, 4Fe- 4 cluster; HET: SAM; 2.07A {Escherichia coli} SCOP: c.1.28.2	Back alignment and structure

>3vni_A Xylose isomerase domain protein TIM barrel; D-psicose 3-epimerase, ketohexose; 1.98A {Clostridium cellulolyticum} PDB: 3vnj_A* 3vnl_A* 3vnk_A* 3vnm_A*	Back alignment and structure

>3lmz_A Putative sugar isomerase; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS isomerase; HET: MSE CIT PGE; 1.44A {Parabacteroides distasonis}	Back alignment and structure

>1r30_A Biotin synthase; SAM radical protein, TIM barrel, FES cluster, transferase; HET: SAM DTB; 3.40A {Escherichia coli} SCOP: c.1.28.1	Back alignment and structure

>3cqj_A L-ribulose-5-phosphate 3-epimerase ULAE; TIM-barrel, isomerase, phosphate-binding motif; 2.04A {Escherichia coli} PDB: 3cqi_A 3cqh_A 3cqk_A	Back alignment and structure

>3tva_A Xylose isomerase domain protein TIM barrel; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE; 2.15A {Planctomyces limnophilus}	Back alignment and structure

>3iix_A Biotin synthetase, putative; adoMet radical, SAM radical, adoMet cleavage, Fe4S4 cluster, HYDE, hydrogenase, maturation, beta barrel; HET: OTY CSO 5AD CPS; 1.25A {Thermotoga maritima} PDB: 3ciw_A* 3iiz_A* 3cix_A*	Back alignment and structure

>1tv8_A MOAA, molybdenum cofactor biosynthesis protein A; TIM barrel, ligand binding protein; HET: SAM; 2.20A {Staphylococcus aureus} SCOP: c.1.28.3 PDB: 1tv7_A* 2fb3_A* 2fb2_A*	Back alignment and structure

>1qtw_A Endonuclease IV; DNA repair enzyme, TIM barrel, trinuclear Zn cluster, hydrolase; 1.02A {Escherichia coli} SCOP: c.1.15.1 PDB: 1qum_A* 2nqh_A 2nqj_A* 2nq9_A*	Back alignment and structure

>2q02_A Putative cytoplasmic protein; structural genomics, joint CEN structural genomics, JCSG, protein structure initiative; 2.40A {Salmonella typhimurium LT2} SCOP: c.1.15.4	Back alignment and structure

>2qul_A D-tagatose 3-epimerase; beta/alpha barrel, isomerase; 1.79A {Pseudomonas cichorii} PDB: 2ou4_A 2qum_A* 2qun_A*	Back alignment and structure

>3kws_A Putative sugar isomerase; structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 1.68A {Parabacteroides distasonis atcc 8503}	Back alignment and structure

>3vnd_A TSA, tryptophan synthase alpha chain; psychrophilic enzyme, cold adaptation; HET: PE8; 2.60A {Shewanella frigidimarina}	Back alignment and structure

>3tva_A Xylose isomerase domain protein TIM barrel; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE; 2.15A {Planctomyces limnophilus}	Back alignment and structure

>2zds_A Putative DNA-binding protein; TIM-barrel fold, structural genomics, NPPSFA; 2.30A {Streptomyces coelicolor}	Back alignment and structure

>3bw2_A 2-nitropropane dioxygenase; TIM barrel, oxidoreductase; HET: FMN; 2.10A {Streptomyces ansochromogenes} PDB: 3bw4_A* 3bw3_A*	Back alignment and structure

>1yx1_A Hypothetical protein PA2260; structural genomics, PSI, PROT structure initiative; HET: MSE; 1.80A {Pseudomonas aeruginosa PAO1} SCOP: c.1.15.7	Back alignment and structure

>3ble_A Citramalate synthase from leptospira interrogans; TIM barrel, licmsn, substrate specificity, acyltransferase, amino-acid biosynthesis; 2.00A {Leptospira interrogans} PDB: 3blf_A 3bli_A*	Back alignment and structure

>3qc0_A Sugar isomerase; TIM barrel, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-biology,; HET: UNL PG4; 1.45A {Sinorhizobium meliloti} PDB: 3ju2_A	Back alignment and structure

>1i60_A IOLI protein; beta barrel, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.60A {Bacillus subtilis} SCOP: c.1.15.4 PDB: 1i6n_A	Back alignment and structure

>3ktc_A Xylose isomerase; putative sugar isomerase, structural genomics, joint center structural genomics, JCSG; HET: MSE; 1.54A {Pectobacterium atrosepticum SCRI1043}	Back alignment and structure

>2x7v_A Probable endonuclease 4; DNA repair protein, metal-binding, hydrolase, DNA damage, DN; 2.30A {Thermotoga maritima MSB8} PDB: 2x7w_A*	Back alignment and structure

>3cny_A Inositol catabolism protein IOLE; xylose isomerase-like TIM barrel, structural genomics, joint for structural genomics, JCSG; 1.85A {Lactobacillus plantarum WCFS1}	Back alignment and structure

>3f4w_A Putative hexulose 6 phosphate synthase; humps, malonate, lyase; 1.65A {Salmonella typhimurium} SCOP: c.1.2.0	Back alignment and structure

>3kws_A Putative sugar isomerase; structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 1.68A {Parabacteroides distasonis atcc 8503}	Back alignment and structure

>2qw5_A Xylose isomerase-like TIM barrel; putative sugar phosphate isomerase/epimerase; 1.78A {Anabaena variabilis atcc 29413}	Back alignment and structure

>3obe_A Sugar phosphate isomerase/epimerase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 1.70A {Parabacteroides distasonis}	Back alignment and structure

>3tha_A Tryptophan synthase alpha chain; structural genomics, center for structural genomics of infec diseases, csgid, lyase; 2.37A {Campylobacter jejuni}	Back alignment and structure

>3ajx_A 3-hexulose-6-phosphate synthase; HPS, OMPDC suprafamily, LYA; 1.60A {Mycobacterium gastri}	Back alignment and structure

>3ngf_A AP endonuclease, family 2; structural genomics, seattle structural genomics center for infectious disease, ssgcid, TIM barrel; 1.80A {Brucella melitensis biovar abortus} SCOP: c.1.15.0	Back alignment and structure

>3c8f_A Pyruvate formate-lyase 1-activating enzyme; adoMet radical, SAM radical, activase, glycyl radical, 4Fe- 4S, carbohydrate metabolism, cytoplasm; HET: MT2 PGE; 2.25A {Escherichia coli} PDB: 3cb8_A*	Back alignment and structure

>2zvr_A Uncharacterized protein TM_0416; hyperthermophIle, ketohexose 3-epimeras tagatose 3-epimerase, isomerase; 2.20A {Thermotoga maritima}	Back alignment and structure

>2hk0_A D-psicose 3-epimerase; TIM-barrel, isomerase; 2.00A {Agrobacterium tumefaciens} PDB: 2hk1_A*	Back alignment and structure

>3nav_A Tryptophan synthase alpha chain; alpha subunit, structural genomics, CSG center for structural genomics of infectious diseases; 2.10A {Vibrio cholerae o1 biovar el tor} SCOP: c.1.2.4	Back alignment and structure

>1q6o_A Humps, 3-keto-L-gulonate 6-phosphate decarboxylase, D-; beta barrel, lyase; HET: LG6; 1.20A {Escherichia coli} SCOP: c.1.2.3 PDB: 1kw1_A* 1q6l_A* 1kv8_A* 1q6q_A* 1q6r_A* 1xbv_A* 1so5_A* 1so4_A* 1xby_A* 1so3_A* 1so6_A* 1xbz_A* 1xbx_A*	Back alignment and structure

>3aam_A Endonuclease IV, endoiv; DNA repair, base excision repair, BER, TIM barrel, endonucle hydrolase, structural genomics, NPPSFA; 1.58A {Thermus thermophilus}	Back alignment and structure

>2vtf_A Endo-beta-N-acetylglucosaminidase; hydrolase, family 85, glycosidase, carbohydrat binding; HET: B3P PGE; 1.79A {Arthrobacter protophormiae} PDB: 3fhq_A* 3fha_A*	Back alignment and structure

>3l23_A Sugar phosphate isomerase/epimerase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.70A {Parabacteroides distasonis}	Back alignment and structure

>3eeg_A 2-isopropylmalate synthase; 11106D, beta barrel, PSI-II, structural genomics, protein structure initiative; 2.78A {Cytophaga hutchinsonii atcc 33406}	Back alignment and structure

>3dx5_A Uncharacterized protein ASBF; beta-alpha barrel, petrobactin synthesis, ASB locus, structu genomics, PSI-2, protein structure initiative; HET: MSE DHB TRS; 2.12A {Bacillus anthracis}	Back alignment and structure

>1ydn_A Hydroxymethylglutaryl-COA lyase; TIM-barrel protein, structural genomics, PSI, protein struct initiative; 2.30A {Brucella melitensis}	Back alignment and structure

>3vni_A Xylose isomerase domain protein TIM barrel; D-psicose 3-epimerase, ketohexose; 1.98A {Clostridium cellulolyticum} PDB: 3vnj_A* 3vnl_A* 3vnk_A* 3vnm_A*	Back alignment and structure

>3u0h_A Xylose isomerase domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, TIM barrel; 2.30A {Alicyclobacillus acidocaldarius subsp}	Back alignment and structure

>3cqj_A L-ribulose-5-phosphate 3-epimerase ULAE; TIM-barrel, isomerase, phosphate-binding motif; 2.04A {Escherichia coli} PDB: 3cqi_A 3cqh_A 3cqk_A	Back alignment and structure

>2z1k_A (NEO)pullulanase; hydrolase, structural genomics, NPPSFA, national project on structural and functional analyses; HET: GLC; 2.30A {Thermus thermophilus}	Back alignment and structure

>2ftp_A Hydroxymethylglutaryl-COA lyase; structural genomics, PSI, protein structure initiativ midwest center for structural genomics, MCSG; 2.40A {Pseudomonas aeruginosa}	Back alignment and structure

>3m47_A Orotidine 5'-phosphate decarboxylase; orotidine 5'-monophosphate decarboxylase, mutant I218A, LYAS; 1.20A {Methanothermobacter thermautotrophicusdelta H} SCOP: c.1.2.3 PDB: 3li1_A 3m5z_A 3lty_A 3ltp_A* 3g18_A* 3g1d_A* 3g1f_A* 3g1h_A* 3g1a_A* 3lv6_A* 1klz_A* 3g1y_A 3g22_A* 3g24_A* 3p5z_A* 3siz_A* 3sy5_A* 1loq_A* 1lor_A* 1kly_A* ...	Back alignment and structure

>1nvm_A HOA, 4-hydroxy-2-oxovalerate aldolase; sequestered tunnel, substrate channeling; HET: NAD; 1.70A {Pseudomonas SP} SCOP: a.5.7.1 c.1.10.5	Back alignment and structure

>4gqr_A Pancreatic alpha-amylase; glycosyl hydrolase, diabetes, obesity, digestion, glycosidas inhibition, flavonol, drug design; HET: NAG MYC; 1.20A {Homo sapiens} PDB: 1cpu_A* 1bsi_A 1u2y_A* 1u30_A* 1u33_A* 1xcw_A* 1xcx_A* 1xd0_A* 1xd1_A* 2qmk_A* 2qv4_A* 3bai_A* 3baj_A* 3baw_A* 3ij7_A* 1hny_A* 3ij9_A* 3ij8_A* 4gqq_A* 1kgw_A* ...	Back alignment and structure

>3aal_A Probable endonuclease 4; endoiv, DNA repair, base excision repair, TIM barrel, DNA DA endonuclease, hydrolase, metal-binding; 1.60A {Geobacillus kaustophilus} PDB: 1xp3_A	Back alignment and structure

>3qxb_A Putative xylose isomerase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology; 1.90A {Rhodospirillum rubrum}	Back alignment and structure

>1qop_A Tryptophan synthase alpha chain; lyase, carbon-oxygen lyase, tryptophan biosynthesis, pyridoxal phosphate; HET: IPL PLP; 1.4A {Salmonella typhimurium} SCOP: c.1.2.4 PDB: 1k8x_A* 1wbj_A* 2clk_A* 2j9z_A* 3cep_A* 1k8y_A* 1a5s_A* 1a50_A* 1c29_A* 1c8v_A* 1c9d_A* 1bks_A* 1cx9_A* 1fuy_A* 1cw2_A* 1k7e_A* 1k7f_A* 1k7x_A* 1k3u_A* 1k8z_A* ...	Back alignment and structure

>1k77_A EC1530, hypothetical protein YGBM; TIM barrel, structural genomics, PSI, structure initiative; 1.63A {Escherichia coli} SCOP: c.1.15.5	Back alignment and structure

>2nx9_A Oxaloacetate decarboxylase 2, subunit alpha; carboxyltransferase structure, B enzymes, Zn2+ binding site, TIM-barrel fold, lyase; 1.70A {Vibrio cholerae}	Back alignment and structure

>4aie_A Glucan 1,6-alpha-glucosidase; hydrolase, glycoside hydrolase 13; HET: MES GOL; 2.05A {Lactobacillus acidophilus ncfm}	Back alignment and structure

>3ivs_A Homocitrate synthase, mitochondrial; TIM barrel, metalloprotein, transferase, claisen condensatio acid biosynthesis; 2.24A {Schizosaccharomyces pombe} PDB: 3ivt_A* 3ivu_A* 3mi3_A*	Back alignment and structure

>1gcy_A Glucan 1,4-alpha-maltotetrahydrolase; beta-alpha-barrel, beta sheet; 1.60A {Pseudomonas stutzeri} SCOP: b.71.1.1 c.1.8.1 PDB: 1jdc_A* 1jda_A* 1jdd_A* 1qi5_A* 1qi3_A* 1qi4_A* 2amg_A 1qpk_A*	Back alignment and structure

>2g0w_A LMO2234 protein; putative sugar isomerase, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE PG4; 1.70A {Listeria monocytogenes} SCOP: c.1.15.4	Back alignment and structure

>1g94_A Alpha-amylase; beta-alpha-8-barrel, 3 domain structure, hydrolase; HET: DAF GLC; 1.74A {Pseudoalteromonas haloplanktis} SCOP: b.71.1.1 c.1.8.1 PDB: 1g9h_A* 1l0p_A 1aqm_A* 1aqh_A* 1b0i_A 1jd7_A 1jd9_A 1kxh_A*	Back alignment and structure

>3aam_A Endonuclease IV, endoiv; DNA repair, base excision repair, BER, TIM barrel, endonucle hydrolase, structural genomics, NPPSFA; 1.58A {Thermus thermophilus}	Back alignment and structure

>2hk0_A D-psicose 3-epimerase; TIM-barrel, isomerase; 2.00A {Agrobacterium tumefaciens} PDB: 2hk1_A*	Back alignment and structure

>2wc7_A Alpha amylase, catalytic region; CD/PUL-hydrolyzing enzymes, hydrolase, glycosidase, neopullu; 2.37A {Nostoc punctiforme} PDB: 2wcs_A 2wkg_A	Back alignment and structure

>2dh2_A 4F2 cell-surface antigen heavy chain; TIM-barrel, glycosidase like, antiparallel beta-sheet, greek terminal domain, extracellular domain; 2.10A {Homo sapiens} PDB: 2dh3_A	Back alignment and structure

>1geq_A Tryptophan synthase alpha-subunit; hyperthermophIle, pyrococ furiosus, X-RAY analysis, stability, calorimetry, lyase; 2.00A {Pyrococcus furiosus} SCOP: c.1.2.4 PDB: 1wdw_A* 2dzu_A 2dzp_A 2e09_A 2dzw_A 2dzs_A 2dzv_A 2dzt_A 2dzx_A	Back alignment and structure

>1ht6_A AMY1, alpha-amylase isozyme 1; barley, beta-alpha-barrel, hydrolase; 1.50A {Hordeum vulgare} SCOP: b.71.1.1 c.1.8.1 PDB: 1p6w_A* 1rpk_A* 3bsg_A 2qpu_A* 1rp8_A* 1rp9_A* 2qps_A 3bsh_A* 1ava_A 1amy_A 1bg9_A*	Back alignment and structure

>1j0h_A Neopullulanase; beta-alpha-barrels, hydrolase; 1.90A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1j0i_A* 1j0j_A* 1j0k_A* 1sma_A 1gvi_A*	Back alignment and structure

>3dhu_A Alpha-amylase; structural genomics, hydrolase, glycosidase, PSI-2, protein structure initiative; 2.00A {Lactobacillus plantarum}	Back alignment and structure

>2aaa_A Alpha-amylase; glycosidase; 2.10A {Aspergillus niger} SCOP: b.71.1.1 c.1.8.1	Back alignment and structure

>2guy_A Alpha-amylase A; (beta-alpha) 8 barrel, hydrolase; HET: NAG BMA; 1.59A {Aspergillus oryzae} SCOP: b.71.1.1 c.1.8.1 PDB: 2gvy_A* 3kwx_A* 6taa_A 7taa_A* 2taa_A	Back alignment and structure

>3ngf_A AP endonuclease, family 2; structural genomics, seattle structural genomics center for infectious disease, ssgcid, TIM barrel; 1.80A {Brucella melitensis biovar abortus} SCOP: c.1.15.0	Back alignment and structure

>2zds_A Putative DNA-binding protein; TIM-barrel fold, structural genomics, NPPSFA; 2.30A {Streptomyces coelicolor}	Back alignment and structure

>4aio_A Limit dextrinase; hydrolase, pullulanase, glycoside hydrolase family 13; 1.90A {Hordeum vulgare} PDB: 2x4c_A* 2y4s_A* 2y5e_A* 2x4b_A	Back alignment and structure

>2qul_A D-tagatose 3-epimerase; beta/alpha barrel, isomerase; 1.79A {Pseudomonas cichorii} PDB: 2ou4_A 2qum_A* 2qun_A*	Back alignment and structure

>3bh4_A Alpha-amylase; calcium, carbohydrate metabolism, glycosidase, hydrolase, metal-binding, secreted; 1.40A {Bacillus amyloliquefaciens} PDB: 1e43_A 1e3z_A* 1e40_A* 1e3x_A 1vjs_A 1ob0_A 1bli_A 1bpl_B 1bpl_A	Back alignment and structure

>1hvx_A Alpha-amylase; hydrolase, glycosyltransferase, thermostability; 2.00A {Geobacillus stearothermophilus} SCOP: b.71.1.1 c.1.8.1	Back alignment and structure

>1wpc_A Glucan 1,4-alpha-maltohexaosidase; maltohexaose-producing amylase, alpha-amylase, acarbose, HYD; HET: ACI GLC GAL; 1.90A {Bacillus SP} SCOP: b.71.1.1 c.1.8.1 PDB: 1wp6_A* 2d3l_A* 2d3n_A* 2die_A 2gjp_A* 2gjr_A 1w9x_A*	Back alignment and structure

>2yb1_A Amidohydrolase; HET: AMP; 1.90A {Chromobacterium violaceum} PDB: 2yb4_A	Back alignment and structure

>1xim_A D-xylose isomerase; isomerase(intramolecular oxidoreductse); HET: XYL; 2.20A {Actinoplanes missouriensis} SCOP: c.1.15.3 PDB: 4xim_A 5xim_A* 6xim_A* 7xim_A 8xim_A* 9xim_A* 3xin_A 2xim_A* 5xin_A* 1xin_A* 1bhw_A* 2xin_A* 3xim_A*	Back alignment and structure

>1ud2_A Amylase, alpha-amylase; calcium-free, alkaline, hydrolase; 2.13A {Bacillus SP} SCOP: b.71.1.1 c.1.8.1 PDB: 1ud4_A 1ud5_A 1ud6_A 1ud8_A 1ud3_A	Back alignment and structure

>1ea9_C Cyclomaltodextrinase; hydrolase, glycosidase; 3.2A {Bacillus SP} SCOP: b.1.18.2 b.71.1.1 c.1.8.1	Back alignment and structure

>1x7f_A Outer surface protein; structural genomics, unknown function, MCSG, PSI, midwest center for struct genomics; 2.30A {Bacillus cereus atcc 14579} SCOP: b.62.1.2 c.1.8.12	Back alignment and structure

>1ep3_A Dihydroorotate dehydrogenase B (PYRD subunit); heterotetramer, alpha-beta barrel, beta sandwich, FAD domain alpha/beta NADP domain; HET: FMN FAD; 2.10A {Lactococcus lactis} SCOP: c.1.4.1 PDB: 1ep2_A* 1ep1_A*	Back alignment and structure

>3ewb_X 2-isopropylmalate synthase; LEUA, structural genomics, unknown function, amino-acid biosynthesis; 2.10A {Listeria monocytogenes str}	Back alignment and structure

>2z6i_A Trans-2-enoyl-ACP reductase II; fatty acid synthesis, antibiotics, oxidoreductase, flavoprotein; HET: FMN; 1.70A {Streptococcus pneumoniae} PDB: 2z6j_A*	Back alignment and structure

>3qc0_A Sugar isomerase; TIM barrel, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-biology,; HET: UNL PG4; 1.45A {Sinorhizobium meliloti} PDB: 3ju2_A	Back alignment and structure

>3d3a_A Beta-galactosidase; protein structure initiative II, PSI II, NYSGXRC, 11092F, structural genomics; 2.15A {Bacteroides thetaiotaomicron vpi-5482}	Back alignment and structure

>1bxb_A Xylose isomerase; xylose metabolism; 2.20A {Thermus thermophilus} SCOP: c.1.15.3 PDB: 1bxc_A	Back alignment and structure

>1i60_A IOLI protein; beta barrel, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.60A {Bacillus subtilis} SCOP: c.1.15.4 PDB: 1i6n_A	Back alignment and structure

>1lwj_A 4-alpha-glucanotransferase; alpha-amylase family, acarbose, (beta/alpha)8 barrel; HET: ACG; 2.50A {Thermotoga maritima} SCOP: b.71.1.1 c.1.8.1 PDB: 1lwh_A*	Back alignment and structure

>3t7v_A Methylornithine synthase PYLB; TIM-barrel fold, mutase, [4Fe-4S]-cluster, SAM, lysine, transferase; HET: SAM MD0; 1.50A {Methanosarcina barkeri}	Back alignment and structure

>4aef_A Neopullulanase (alpha-amylase II); hydrolase, thermostability, high temperature; 2.34A {Pyrococcus furiosus}	Back alignment and structure

>3bg3_A Pyruvate carboxylase, mitochondrial; TIM barrel, ATP-binding, biotin, disease mutation, gluconeogenesis, ligase, lipid synthesis, manganese; HET: KCX BTI; 2.80A {Homo sapiens} PDB: 3bg9_A	Back alignment and structure

>1wzl_A Alpha-amylase II; pullulan, GH-13, alpha-amylase family, hydrolase; 2.00A {Thermoactinomyces vulgaris} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1ji2_A 1bvz_A 1vfk_A* 3a6o_A* 1wzm_A 1jf6_A 1wzk_A 2d2o_A* 1jib_A* 1jl8_A* 1vb9_A* 1g1y_A* 1vfo_A* 1vfm_A* 1vfu_A* 1jf5_A	Back alignment and structure

>2cw6_A Hydroxymethylglutaryl-COA lyase, mitochondrial; HMG-COA lyase, ketogenic enzyme; HET: 3HG; 2.10A {Homo sapiens} PDB: 3mp3_A* 3mp4_A 3mp5_A*	Back alignment and structure

>3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A	Back alignment and structure

>2fty_A Dihydropyrimidinase; alpha/beta barrel, beta-sandwich, hydrolase; HET: KCX; 2.40A {Lachancea kluyveri} SCOP: b.92.1.3 c.1.9.6 PDB: 2fvk_A* 2fvm_A*	Back alignment and structure

>3bo9_A Putative nitroalkan dioxygenase; TM0800, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE 2PE; 2.71A {Thermotoga maritima MSB8}	Back alignment and structure

>3vup_A Beta-1,4-mannanase; TIM barrel, digestive fluid, HYD; 1.05A {Aplysia kurodai}	Back alignment and structure

>2p0o_A Hypothetical protein DUF871; structural genomics, TIM barrel, PF05 2, protein structure initiative, midwest center for structu genomics; 2.15A {Enterococcus faecalis}	Back alignment and structure

>1f6y_A 5-methyltetrahydrofolate corrinoid/iron sulfur PR methyltransferase; carbon dioxide fixation, cobalamin, methyltatrahydrofolate; 2.20A {Moorella thermoacetica} SCOP: c.1.21.2 PDB: 2e7f_A* 4djd_A* 4dje_A* 4djf_A* 2ogy_A*	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		201
d1qwga_		251	c.1.27.1 (A:) (2r)-phospho-3-sulfolactate synthase	2e-39
d1u83a_		249	c.1.27.1 (A:) (2r)-phospho-3-sulfolactate synthase	5e-34

>d1qwga_ c.1.27.1 (A:) (2r)-phospho-3-sulfolactate synthase ComA {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 251	Back information, alignment and structure


class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: (2r)-phospho-3-sulfolactate synthase ComA
family: (2r)-phospho-3-sulfolactate synthase ComA
domain: (2r)-phospho-3-sulfolactate synthase ComA
species: Archaeon Methanococcus jannaschii [TaxId: 2190]

 Score =  133 bits (336), Expect = 2e-39
 Identities = 28/148 (18%), Positives = 61/148 (41%), Gaps = 7/148 (4%)

Query: 20  KPRRFGVTEMRSPHYTLSSSHNVLEDIFESMGQFVDGLKFSGGSHSLMPKPFIEEVVKRA 79
           +  + G+T +             +ED  +  G ++D +KF  G+ +++ +  ++E +   
Sbjct: 9   EDFQRGLTVVLDKGLPPKF----VEDYLKVCGDYIDFVKFGWGTSAVIDRDVVKEKINYY 64

Query: 80  HQHDVYVSTG-DWAEHLIRNGPSAFKEYVEDCKQVGFDTIELNVGSLEIPEETLLRYVRL 138
               + V  G    E+    G   F E++ +C+++GF+ +E++ GS +I  E     ++ 
Sbjct: 65  KDWGIKVYPGGTLFEYAYSKGK--FDEFLNECEKLGFEAVEISDGSSDISLEERNNAIKR 122

Query: 139 VKSAGLKAKPKFAVMFNKSDIPSDRDRA 166
            K  G     +        D     D  
Sbjct: 123 AKDNGFMVLTEVGKKMPDKDKQLTIDDR 150

PyMOL of d1qwga_

>d1u83a_ c.1.27.1 (A:) (2r)-phospho-3-sulfolactate synthase ComA {Bacillus subtilis [TaxId: 1423]} Length = 249	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		201
d1u83a_		249	(2r)-phospho-3-sulfolactate synthase ComA {Bacillu	100.0
d1qwga_		251	(2r)-phospho-3-sulfolactate synthase ComA {Archaeo	100.0
d1nvma2		289	4-hydroxy-2-oxovalerate aldolase DmpG, catalytic d	94.25
d1e43a2		393	Bacterial alpha-amylase {Chimera (Bacillus amyloli	93.52
d1gcya2		357	G4-amylase (1,4-alpha-D-glucan maltotetrahydrolase	93.2
d1ht6a2		347	Plant alpha-amylase {Barley (Hordeum vulgare), AMY	92.69
d2d3na2		394	Bacterial alpha-amylase {Bacillus sp. 707 [TaxId:	92.68
d1g94a2		354	Bacterial alpha-amylase {Pseudoalteromonas halopla	92.65
d1ujpa_		271	Trp synthase alpha-subunit {Thermus thermophilus [	92.37
d2q02a1		271	Putative cytoplasmic protein STM4435 {Salmonella t	91.99
d1geqa_		248	Trp synthase alpha-subunit {Archaeon Pyrococcus fu	91.82
d1yx1a1		250	Hypothetical protein PA2260 {Pseudomonas aeruginos	91.62
d1mxga2		361	Bacterial alpha-amylase {Archaeon Pyrococcus woese	91.27
d1hvxa2		393	Bacterial alpha-amylase {Bacillus stearothermophil	91.12
d1qopa_		267	Trp synthase alpha-subunit {Salmonella typhimurium	90.93
d1q6oa_		213	3-keto-L-gulonate 6-phosphate decarboxylase {Esche	90.82
d1ud2a2		390	Bacterial alpha-amylase {Bacillus sp., ksm-k38 [Ta	90.59
d1k77a_		260	Hypothetical protein YgbM (EC1530) {Escherichia co	90.58
d1i60a_		278	Hypothetical protein IolI {Bacillus subtilis [TaxI	90.56
d1bf2a3		475	Isoamylase, central domain {Pseudomonas amyloderam	90.18
d1j0ha3		382	Neopullulanase, central domain {Bacillus stearothe	90.17
d1wzla3		382	Maltogenic amylase, central domain {Thermoactinomy	90.14
d1i60a_		278	Hypothetical protein IolI {Bacillus subtilis [TaxI	90.04
d1x7fa2		244	Outer surface protein, N-terminal domain {Bacillus	90.02
d1hx0a2		403	Animal alpha-amylase {Pig (Sus scrofa) [TaxId: 982	89.63
d1km4a_		212	Orotidine 5'-monophosphate decarboxylase (OMP deca	88.9
d1gjwa2		572	Maltosyltransferase {Thermotoga maritima [TaxId: 2	88.45
d1m7xa3		396	1,4-alpha-glucan branching enzyme, central domain	88.45
d1kwga2		393	A4 beta-galactosidase {Thermus thermophilus [TaxId	88.32
d1rh9a1		370	Beta-mannanase {Tomato (Lycopersicon esculentum) [	88.2
d1qhoa4		407	Cyclodextrin glycosyltransferase {Bacillus stearot	88.06
d1qtwa_		285	Endonuclease IV {Escherichia coli [TaxId: 562]}	87.82
d1ea9c3		382	Maltogenic amylase, central domain {Bacillus sp.,	87.66
d1olta_		441	Oxygen-independent coproporphyrinogen III oxidase	87.62
d2g0wa1		275	Hypothetical protein Lmo2234 {Listeria monocytogen	87.6
d1m53a2		478	Isomaltulose synthase PalI {Klebsiella sp., lx3 [T	87.39
d1yx1a1		250	Hypothetical protein PA2260 {Pseudomonas aeruginos	86.83
d1tg7a5		354	Beta-galactosidase LacA, N-terminal domain {Penici	86.79
d2fhfa5		563	Pullulanase PulA {Klebsiella pneumoniae [TaxId: 57	86.16
d1jaea2		378	Animal alpha-amylase {Yellow mealworm (Tenebrio mo	85.59
d1h3ga3		422	Cyclomaltodextrinase, central domain {Flavobacteri	85.52
d2guya2		381	Fungal alpha-amylases {Aspergillus oryzae, Taka-am	85.14
d2c0ha1		350	endo-1,4-beta-mannosidase {Blue mussel (Mytilus ed	84.99
d1olta_		441	Oxygen-independent coproporphyrinogen III oxidase	84.87
d2aaaa2		381	Fungal alpha-amylases {Aspergillus niger, acid amy	84.73
d2q02a1		271	Putative cytoplasmic protein STM4435 {Salmonella t	84.57
d1vhca_		212	Hypothetical protein HI0047 {Haemophilus influenza	83.35
d1lwha2		391	4-alpha-glucanotransferase {Thermotoga maritima [T	83.29
d1hjsa_		332	Beta-1,4-galactanase {Thielavia heterothallica, ak	82.61
d1uoka2		479	Oligo-1,6, glucosidase {Bacillus cereus [TaxId: 13	82.44
d1eh9a3		400	Glycosyltrehalose trehalohydrolase, central domain	82.25
d1ecea_		358	Endocellulase E1 {Acidothermus cellulolyticus [Tax	82.08
d3bmva4		406	Cyclodextrin glycosyltransferase {Thermoanaerobact	81.96
d1uuqa_		410	Exomannosidase {Cellvibrio mixtus [TaxId: 39650]}	80.32

>d1u83a_ c.1.27.1 (A:) (2r)-phospho-3-sulfolactate synthase ComA {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: (2r)-phospho-3-sulfolactate synthase ComA
family: (2r)-phospho-3-sulfolactate synthase ComA
domain: (2r)-phospho-3-sulfolactate synthase ComA
species: Bacillus subtilis [TaxId: 1423]

Probab=100.00  E-value=2.1e-58  Score=399.42  Aligned_cols=163  Identities=20%  Similarity=0.317  Sum_probs=140.7

Q ss_pred             C-CCCCCCCCCCCCCCceeEecCCCCCCcchhHHHHHHHhhcccccEEEeeCccccccChhHHHHHHHHHHhCCceecCc
Q 028948           11 F-DEYEDRAEKPRRFGVTEMRSPHYTLSSSHNVLEDIFESMGQFVDGLKFSGGSHSLMPKPFIEEVVKRAHQHDVYVSTG   89 (201)
Q Consensus        11 f-~~~~~R~~KPR~~GlTmV~DkG~s~~~g~~~l~DlLe~ag~yID~lKfg~GTs~l~p~~~L~eKI~l~~~~gV~v~~G   89 (201)
                      | +++|+|++|||++|+|||+||||    |+++++|+|++||+|||++||||||++++|.  |++||++||+|||+||+|
T Consensus         2 f~l~lp~R~~KPR~~GlT~v~D~Gl----~l~~leD~Le~~g~yID~vK~g~Gts~l~~~--L~eKI~l~~~~~V~v~~G   75 (249)
T d1u83a_           2 FSLELPVRTNKPRETGQSILIDNGY----PLQFFKDAIAGASDYIDFVKFGWGTSLLTKD--LEEKISTLKEHDITFFFG   75 (249)
T ss_dssp             CCCCCCCCCCSSCSSSCEEEEESSC----CHHHHHHHHHHHGGGCCEEEECTTGGGGCTT--HHHHHHHHHHTTCEEEEC
T ss_pred             CCCCCCCCCCCCcccCceEEecCCC----CHHHHHHHHHhhhhheeEEEecCceeccCHH--HHHHHHHHHHcCCeEeCC
Confidence            5 58999999999999999999998    7889999999999999999999999999986  999999999999999997


Q ss_pred             -cHHHHHHHhCCchHHHHHHHHHHcCCCEEEecCCcccCChhHHHHHHHHHHHCCCeEccccccccCC------------
Q 028948           90 -DWAEHLIRNGPSAFKEYVEDCKQVGFDTIELNVGSLEIPEETLLRYVRLVKSAGLKAKPKFAVMFNK------------  156 (201)
Q Consensus        90 -tlfE~al~qg~~~~~eyl~~~k~lGFd~IEISdGti~i~~~~r~~lI~~~~~~Gf~v~pE~g~k~~~------------  156 (201)
                       ||||+|+.||  ++++|+++|++|||++|||||||++||+++|+++|+++++ +|.|.+|+|+|++.            
T Consensus        76 GtlfE~a~~~~--~~~~y~~~~~~lGf~~iEiSdg~i~i~~~~~~~~I~~~~~-~~~V~sEvG~K~~~~~~~~~~~~~i~  152 (249)
T d1u83a_          76 GTLFEKYVSQK--KVNEFHRYCTYFGCEYIEISNGTLPMTNKEKAAYIADFSD-EFLVLSEVGSKDAELASRQSSEEWLE  152 (249)
T ss_dssp             HHHHHHHHHTT--CHHHHHHHHHHTTCSEEEECCSSSCCCHHHHHHHHHHHTT-TSEEEEECSCCC------CCSTHHHH
T ss_pred             CHHHHHHHHcC--CHHHHHHHHHHcCCCEEEECCCcccCCHHHHHHHHHHHHh-cCeeccccCCcCccccCCCCHHHHHH
Confidence             7999999999  9999999999999999999999999999999999999988 57899999999864            


Q ss_pred             ---CCcccccccccccEEEecccCcCeeccccCC
Q 028948          157 ---SDIPSDRDRAFGAYVARAPRSTDKLFLASNP  187 (201)
Q Consensus       157 ---~dl~ag~~~a~g~~Vi~E~Res~~v~~~~~~  187 (201)
                         .+|+|||+     +||+|+||||++|+++|-
T Consensus       153 ~~~~~LeaGA~-----~ViiEarEsg~~Gi~~~~  181 (249)
T d1u83a_         153 YIVEDMEAGAE-----KVITEARESGTGGICSSS  181 (249)
T ss_dssp             HHHHHHHHTEE-----EEEEC-------------
T ss_pred             HHHHHHHCCCc-----eEEeehhccCCCCCcCCC
Confidence               44667777     999999999999999775

PyMOL of d1u83a_

>d1qwga_ c.1.27.1 (A:) (2r)-phospho-3-sulfolactate synthase ComA {Archaeon Methanococcus jannaschii [TaxId: 2190]}	Back information, alignment and structure

>d1nvma2 c.1.10.5 (A:2-290) 4-hydroxy-2-oxovalerate aldolase DmpG, catalytic domain {Pseudomonas sp. [TaxId: 306]}	Back information, alignment and structure

>d1e43a2 c.1.8.1 (A:1-393) Bacterial alpha-amylase {Chimera (Bacillus amyloliquefaciens) and (Bacillus licheniformis) [TaxId: 1390]}	Back information, alignment and structure

>d1gcya2 c.1.8.1 (A:1-357) G4-amylase (1,4-alpha-D-glucan maltotetrahydrolase) {Pseudomonas stutzeri [TaxId: 316]}	Back information, alignment and structure

>d1ht6a2 c.1.8.1 (A:1-347) Plant alpha-amylase {Barley (Hordeum vulgare), AMY1 isozyme [TaxId: 4513]}	Back information, alignment and structure

>d2d3na2 c.1.8.1 (A:5-398) Bacterial alpha-amylase {Bacillus sp. 707 [TaxId: 1416]}	Back information, alignment and structure

>d1g94a2 c.1.8.1 (A:1-354) Bacterial alpha-amylase {Pseudoalteromonas haloplanktis (Alteromonas haloplanktis) [TaxId: 228]}	Back information, alignment and structure

>d1ujpa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d2q02a1 c.1.15.4 (A:1-271) Putative cytoplasmic protein STM4435 {Salmonella typhimurium [TaxId: 90371]}	Back information, alignment and structure

>d1geqa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Archaeon Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d1yx1a1 c.1.15.7 (A:3-252) Hypothetical protein PA2260 {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d1mxga2 c.1.8.1 (A:1-361) Bacterial alpha-amylase {Archaeon Pyrococcus woesei [TaxId: 2262]}	Back information, alignment and structure

>d1hvxa2 c.1.8.1 (A:1-393) Bacterial alpha-amylase {Bacillus stearothermophilus [TaxId: 1422]}	Back information, alignment and structure

>d1qopa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Salmonella typhimurium [TaxId: 90371]}	Back information, alignment and structure

>d1q6oa_ c.1.2.3 (A:) 3-keto-L-gulonate 6-phosphate decarboxylase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1ud2a2 c.1.8.1 (A:1-390) Bacterial alpha-amylase {Bacillus sp., ksm-k38 [TaxId: 1409]}	Back information, alignment and structure

>d1k77a_ c.1.15.5 (A:) Hypothetical protein YgbM (EC1530) {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1i60a_ c.1.15.4 (A:) Hypothetical protein IolI {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1bf2a3 c.1.8.1 (A:163-637) Isoamylase, central domain {Pseudomonas amyloderamosa [TaxId: 32043]}	Back information, alignment and structure

>d1j0ha3 c.1.8.1 (A:124-505) Neopullulanase, central domain {Bacillus stearothermophilus [TaxId: 1422]}	Back information, alignment and structure

>d1wzla3 c.1.8.1 (A:121-502) Maltogenic amylase, central domain {Thermoactinomyces vulgaris, TVAII [TaxId: 2026]}	Back information, alignment and structure

>d1i60a_ c.1.15.4 (A:) Hypothetical protein IolI {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1x7fa2 c.1.8.12 (A:1-244) Outer surface protein, N-terminal domain {Bacillus cereus [TaxId: 1396]}	Back information, alignment and structure

>d1hx0a2 c.1.8.1 (A:1-403) Animal alpha-amylase {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d1km4a_ c.1.2.3 (A:) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]}	Back information, alignment and structure

>d1gjwa2 c.1.8.1 (A:1-572) Maltosyltransferase {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1m7xa3 c.1.8.1 (A:227-622) 1,4-alpha-glucan branching enzyme, central domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1kwga2 c.1.8.1 (A:1-393) A4 beta-galactosidase {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1rh9a1 c.1.8.3 (A:30-399) Beta-mannanase {Tomato (Lycopersicon esculentum) [TaxId: 4081]}	Back information, alignment and structure

>d1qhoa4 c.1.8.1 (A:1-407) Cyclodextrin glycosyltransferase {Bacillus stearothermophilus, maltogenic alpha-amylase [TaxId: 1422]}	Back information, alignment and structure

>d1qtwa_ c.1.15.1 (A:) Endonuclease IV {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1ea9c3 c.1.8.1 (C:122-503) Maltogenic amylase, central domain {Bacillus sp., cyclomaltodextrinase [TaxId: 1409]}	Back information, alignment and structure

>d1olta_ c.1.28.2 (A:) Oxygen-independent coproporphyrinogen III oxidase HemN {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2g0wa1 c.1.15.4 (A:10-284) Hypothetical protein Lmo2234 {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1m53a2 c.1.8.1 (A:43-520) Isomaltulose synthase PalI {Klebsiella sp., lx3 [TaxId: 576]}	Back information, alignment and structure

>d1yx1a1 c.1.15.7 (A:3-252) Hypothetical protein PA2260 {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d1tg7a5 c.1.8.14 (A:41-394) Beta-galactosidase LacA, N-terminal domain {Penicillium sp. [TaxId: 5081]}	Back information, alignment and structure

>d2fhfa5 c.1.8.1 (A:403-965) Pullulanase PulA {Klebsiella pneumoniae [TaxId: 573]}	Back information, alignment and structure

>d1jaea2 c.1.8.1 (A:1-378) Animal alpha-amylase {Yellow mealworm (Tenebrio molitor), larva [TaxId: 7067]}	Back information, alignment and structure

>d1h3ga3 c.1.8.1 (A:96-517) Cyclomaltodextrinase, central domain {Flavobacterium sp. 92 [TaxId: 197856]}	Back information, alignment and structure

>d2guya2 c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergillus oryzae, Taka-amylase [TaxId: 5062]}	Back information, alignment and structure

>d2c0ha1 c.1.8.3 (A:18-367) endo-1,4-beta-mannosidase {Blue mussel (Mytilus edulis) [TaxId: 6550]}	Back information, alignment and structure

>d1olta_ c.1.28.2 (A:) Oxygen-independent coproporphyrinogen III oxidase HemN {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2aaaa2 c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergillus niger, acid amylase [TaxId: 5061]}	Back information, alignment and structure

>d2q02a1 c.1.15.4 (A:1-271) Putative cytoplasmic protein STM4435 {Salmonella typhimurium [TaxId: 90371]}	Back information, alignment and structure

>d1vhca_ c.1.10.1 (A:) Hypothetical protein HI0047 {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d1lwha2 c.1.8.1 (A:1-391) 4-alpha-glucanotransferase {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1hjsa_ c.1.8.3 (A:) Beta-1,4-galactanase {Thielavia heterothallica, aka Myceliophthora thermophila [TaxId: 78579]}	Back information, alignment and structure

>d1uoka2 c.1.8.1 (A:1-479) Oligo-1,6, glucosidase {Bacillus cereus [TaxId: 1396]}	Back information, alignment and structure

>d1eh9a3 c.1.8.1 (A:91-490) Glycosyltrehalose trehalohydrolase, central domain {Archaeon Sulfolobus solfataricus, km1 [TaxId: 2287]}	Back information, alignment and structure

>d1ecea_ c.1.8.3 (A:) Endocellulase E1 {Acidothermus cellulolyticus [TaxId: 28049]}	Back information, alignment and structure

>d3bmva4 c.1.8.1 (A:1-406) Cyclodextrin glycosyltransferase {Thermoanaerobacterium [TaxId: 28895]}	Back information, alignment and structure

>d1uuqa_ c.1.8.3 (A:) Exomannosidase {Cellvibrio mixtus [TaxId: 39650]}	Back information, alignment and structure