Citrus Sinensis ID: 028959
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 201 | ||||||
| 225458986 | 241 | PREDICTED: uncharacterized protein LOC10 | 0.930 | 0.775 | 0.754 | 1e-70 | |
| 302142115 | 242 | unnamed protein product [Vitis vinifera] | 0.930 | 0.772 | 0.754 | 1e-70 | |
| 147791250 | 409 | hypothetical protein VITISV_001105 [Viti | 0.955 | 0.469 | 0.739 | 9e-70 | |
| 356507969 | 269 | PREDICTED: symplekin-like [Glycine max] | 0.935 | 0.698 | 0.686 | 5e-68 | |
| 363807220 | 254 | uncharacterized protein LOC100810420 [Gl | 0.935 | 0.740 | 0.680 | 4e-66 | |
| 255537870 | 1390 | conserved hypothetical protein [Ricinus | 0.935 | 0.135 | 0.659 | 5e-65 | |
| 449436918 | 243 | PREDICTED: uncharacterized protein LOC10 | 0.930 | 0.769 | 0.668 | 3e-64 | |
| 449502855 | 211 | PREDICTED: uncharacterized LOC101221904 | 0.925 | 0.881 | 0.666 | 8e-64 | |
| 224067086 | 251 | predicted protein [Populus trichocarpa] | 0.935 | 0.749 | 0.664 | 8e-64 | |
| 388508130 | 248 | unknown [Medicago truncatula] | 0.915 | 0.741 | 0.625 | 5e-59 |
| >gi|225458986|ref|XP_002283639.1| PREDICTED: uncharacterized protein LOC100260884 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 271 bits (693), Expect = 1e-70, Method: Compositional matrix adjust.
Identities = 141/187 (75%), Positives = 158/187 (84%)
Query: 1 MAAVSRDQALSLLAAANNHGDLAVKLSSLKQVRGILSSADPSLAAELFPYLVELQSSPES 60
MA SRDQAL+LLAAANNHGDLAVKLSSL+Q + IL + PS AAELFPYLVELQSSPE+
Sbjct: 1 MAGASRDQALALLAAANNHGDLAVKLSSLRQAKDILLAVHPSFAAELFPYLVELQSSPET 60
Query: 61 LVRKSLIETIEDIGLKAMEHSSILMPVLLAFLRDGDSGVAGKSIVCGTNFFCRVLEEITM 120
LVRKSLIE IE+IGLKAMEHSSIL+ VLL FLRDGDS +A +SIV GTNFFC VLEE+ +
Sbjct: 61 LVRKSLIEAIEEIGLKAMEHSSILVSVLLVFLRDGDSIIAKQSIVSGTNFFCSVLEELAL 120
Query: 121 QFRWHGKVERWLEELWTWMVRFKDAVFAIALEPGLVGTKLLALKFLETHVLLFTSDSNDF 180
QF HGKVERWLEELW WMV+ KDAV AIAL PG G K+LA+KFLET+VL FTSD+NDF
Sbjct: 121 QFHRHGKVERWLEELWVWMVKLKDAVLAIALGPGPFGVKILAMKFLETYVLHFTSDANDF 180
Query: 181 ENFTKEG 187
E + EG
Sbjct: 181 EKSSIEG 187
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|302142115|emb|CBI19318.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|147791250|emb|CAN63444.1| hypothetical protein VITISV_001105 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356507969|ref|XP_003522735.1| PREDICTED: symplekin-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|363807220|ref|NP_001242610.1| uncharacterized protein LOC100810420 [Glycine max] gi|255644520|gb|ACU22763.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|255537870|ref|XP_002510000.1| conserved hypothetical protein [Ricinus communis] gi|223550701|gb|EEF52187.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|449436918|ref|XP_004136239.1| PREDICTED: uncharacterized protein LOC101221904 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449502855|ref|XP_004161762.1| PREDICTED: uncharacterized LOC101221904 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|224067086|ref|XP_002302348.1| predicted protein [Populus trichocarpa] gi|222844074|gb|EEE81621.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|388508130|gb|AFK42131.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 201 | ||||||
| TAIR|locus:2196869 | 264 | AT1G27590 "AT1G27590" [Arabido | 0.950 | 0.723 | 0.643 | 1e-59 | |
| TAIR|locus:2196914 | 649 | AT1G27570 [Arabidopsis thalian | 0.890 | 0.275 | 0.593 | 2.3e-48 | |
| TAIR|locus:2179137 | 1467 | ESP4 "AT5G01400" [Arabidopsis | 0.865 | 0.118 | 0.350 | 7.6e-22 |
| TAIR|locus:2196869 AT1G27590 "AT1G27590" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 612 (220.5 bits), Expect = 1.0e-59, P = 1.0e-59
Identities = 123/191 (64%), Positives = 147/191 (76%)
Query: 2 AAVSRDQALSLLAAANNHGDLAVKLSSLKQVRGILSSADPSLAAELFPYLVELQSSPESL 61
AA +R QALSLLAAANNHGDLAVKLSSL+QV+ IL S +PSL+AE+FPYL EL S E L
Sbjct: 6 AATARAQALSLLAAANNHGDLAVKLSSLRQVKEILLSLEPSLSAEIFPYLAELHLSREIL 65
Query: 62 VRKSLIETIEDIGLKAMEHSSILMPVLLAFLRDGDSGVAGKSIVCGTNFFCRVLEEITMQ 121
VRKSLIE IE++GL+ ++HS +L+ VLL RD D VA KSI GT FFC +LEE+ MQ
Sbjct: 66 VRKSLIEIIEEVGLRMLDHSYVLVSVLLVLSRDEDPTVAKKSISVGTTFFCTILEEMAMQ 125
Query: 122 FRWHGKVERWLEELWTWMVRFKDAVFAIALEPGLVGTKLLALKFLETHVLLFTSDSNDFE 181
F GKV+RW ELWTWMV+FKD VFA ALEPG VG K+LALKF+ET +LLFT D++D E
Sbjct: 126 FHHRGKVDRWCGELWTWMVKFKDTVFATALEPGCVGVKVLALKFMETFILLFTPDASDPE 185
Query: 182 NFTKEGIAFLF 192
+ EG +F
Sbjct: 186 KASSEGSRHMF 196
|
|
| TAIR|locus:2196914 AT1G27570 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2179137 ESP4 "AT5G01400" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 201 | |||
| pfam11935 | 233 | pfam11935, DUF3453, Domain of unknown function (DU | 3e-09 |
| >gnl|CDD|221326 pfam11935, DUF3453, Domain of unknown function (DUF3453) | Back alignment and domain information |
|---|
Score = 54.6 bits (132), Expect = 3e-09
Identities = 23/96 (23%), Positives = 42/96 (43%), Gaps = 9/96 (9%)
Query: 92 LRDGDSGVAGKSIVCGTNFFCRVLEEITMQFRWHGKVERWLEELWTWMVRFKDAVFAIAL 151
LRD D V + I+C T+ + V + E+LW + K+ + +
Sbjct: 2 LRDEDPSVVKRVILCSTSIYPLVFRLVA--------NNDNDEQLWDTLTALKNRILNL-W 52
Query: 152 EPGLVGTKLLALKFLETHVLLFTSDSNDFENFTKEG 187
+ G KL A+KF+E +L+ + +D + K+
Sbjct: 53 DTDNPGVKLAAIKFVERVILVQSPGPSDSDPRRKDE 88
|
This presumed domain is functionally uncharacterized. This domain is found in eukaryotes. This domain is typically between 239 to 261 amino acids in length. Length = 233 |
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 201 | |||
| PF11935 | 239 | DUF3453: Domain of unknown function (DUF3453); Int | 99.92 | |
| KOG1895 | 957 | consensus mRNA cleavage and polyadenylation factor | 99.78 | |
| PF05918 | 556 | API5: Apoptosis inhibitory protein 5 (API5); Inter | 97.22 | |
| PRK09687 | 280 | putative lyase; Provisional | 97.04 | |
| PF01602 | 526 | Adaptin_N: Adaptin N terminal region; InterPro: IP | 96.98 | |
| PF13646 | 88 | HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2I | 96.85 | |
| COG5096 | 757 | Vesicle coat complex, various subunits [Intracellu | 96.64 | |
| PF12717 | 178 | Cnd1: non-SMC mitotic condensation complex subunit | 96.34 | |
| PTZ00429 | 746 | beta-adaptin; Provisional | 96.15 | |
| PF01602 | 526 | Adaptin_N: Adaptin N terminal region; InterPro: IP | 96.0 | |
| PF12717 | 178 | Cnd1: non-SMC mitotic condensation complex subunit | 95.66 | |
| PF12348 | 228 | CLASP_N: CLASP N terminal; InterPro: IPR024395 Thi | 95.6 | |
| cd00020 | 120 | ARM Armadillo/beta-catenin-like repeats. An approx | 95.48 | |
| PF13646 | 88 | HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2I | 95.37 | |
| cd00020 | 120 | ARM Armadillo/beta-catenin-like repeats. An approx | 95.11 | |
| KOG2956 | 516 | consensus CLIP-associating protein [General functi | 95.07 | |
| COG5096 | 757 | Vesicle coat complex, various subunits [Intracellu | 95.05 | |
| PTZ00429 | 746 | beta-adaptin; Provisional | 94.8 | |
| PF12530 | 234 | DUF3730: Protein of unknown function (DUF3730) ; I | 94.77 | |
| PF12755 | 97 | Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region | 94.02 | |
| PRK09687 | 280 | putative lyase; Provisional | 93.98 | |
| PF13513 | 55 | HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O | 93.88 | |
| PF12830 | 187 | Nipped-B_C: Sister chromatid cohesion C-terminus | 93.56 | |
| PF10508 | 503 | Proteasom_PSMB: Proteasome non-ATPase 26S subunit; | 93.3 | |
| KOG1058 | 948 | consensus Vesicle coat complex COPI, beta subunit | 92.79 | |
| PF10274 | 183 | ParcG: Parkin co-regulated protein; InterPro: IPR0 | 91.78 | |
| PF02985 | 31 | HEAT: HEAT repeat; InterPro: IPR000357 The HEAT re | 91.74 | |
| PF10363 | 92 | DUF2435: Protein of unknown function (DUF2435) | 91.66 | |
| PF10508 | 503 | Proteasom_PSMB: Proteasome non-ATPase 26S subunit; | 91.26 | |
| PF12765 | 42 | Cohesin_HEAT: HEAT repeat associated with sister c | 90.62 | |
| PF12348 | 228 | CLASP_N: CLASP N terminal; InterPro: IPR024395 Thi | 90.52 | |
| PF02985 | 31 | HEAT: HEAT repeat; InterPro: IPR000357 The HEAT re | 90.02 | |
| KOG1525 | 1266 | consensus Sister chromatid cohesion complex Cohesi | 89.6 | |
| KOG2011 | 1048 | consensus Sister chromatid cohesion complex Cohesi | 88.3 | |
| PF05918 | 556 | API5: Apoptosis inhibitory protein 5 (API5); Inter | 88.05 | |
| KOG1020 | 1692 | consensus Sister chromatid cohesion protein SCC2/N | 88.0 | |
| KOG1059 | 877 | consensus Vesicle coat complex AP-3, delta subunit | 85.75 | |
| PF12755 | 97 | Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region | 85.09 | |
| PF10521 | 282 | DUF2454: Protein of unknown function (DUF2454); In | 84.18 | |
| PRK13800 | 897 | putative oxidoreductase/HEAT repeat-containing pro | 84.04 | |
| PF00514 | 41 | Arm: Armadillo/beta-catenin-like repeat; InterPro: | 82.54 | |
| KOG1060 | 968 | consensus Vesicle coat complex AP-3, beta subunit | 82.28 | |
| PF12830 | 187 | Nipped-B_C: Sister chromatid cohesion C-terminus | 81.82 | |
| KOG2229 | 616 | consensus Protein required for actin cytoskeleton | 81.26 | |
| PRK13800 | 897 | putative oxidoreductase/HEAT repeat-containing pro | 81.06 | |
| KOG1061 | 734 | consensus Vesicle coat complex AP-1/AP-2/AP-4, bet | 80.16 |
| >PF11935 DUF3453: Domain of unknown function (DUF3453); InterPro: IPR021850 This presumed domain is functionally uncharacterised | Back alignment and domain information |
|---|
Probab=99.92 E-value=1.2e-25 Score=193.62 Aligned_cols=98 Identities=29% Similarity=0.416 Sum_probs=79.9
Q ss_pred hhccCChhHHHHHHhhhhhhhHHHHHHHhhhhhccCcchhhHHHHHHHHHHhHHHHHHHhccCCCCchhHHHHHhhhHhh
Q 028959 91 FLRDGDSGVAGKSIVCGTNFFCRVLEEITMQFRWHGKVERWLEELWTWMVRFKDAVFAIALEPGLVGTKLLALKFLETHV 170 (201)
Q Consensus 91 LL~D~~~~VvK~aI~~~t~lyr~~L~~~~~q~i~~~~~~~~~~~~W~~m~~lK~~Il~~~~~s~n~GVr~~aiKF~E~vI 170 (201)
||+|+||+|+|++|+|+|++||.+| +|++ .+++++++|++|++||++|++ +|+++|+|||++|+||+|+||
T Consensus 1 Ll~d~d~~v~K~~I~~~~~iy~~~~-----~~i~---~~~~~~~~W~~~~~lK~~Il~-~~~~~~~gvk~~~iKFle~vI 71 (239)
T PF11935_consen 1 LLNDEDPAVVKRAIQCSTSIYPLVF-----RWIC---VNPSDEQLWESMNELKDRILS-LWDSENPGVKLAAIKFLERVI 71 (239)
T ss_dssp HCT-SSHHHHHHHHHHHHHHHHHHH-----HHHS-----HHHHHHHHHHHHHHHHHHH-GGGSSSHHHHHHHHHHHHHHH
T ss_pred CCCCCcHHHHHHHHHHHHHHHHHHH-----HHHc---CCchHHHHHHHHHHHHHHHHH-HhcCCCchHHHHHHHHHHHHH
Confidence 6899999999999999999999999 7773 566899999999999999999 799999999999999999999
Q ss_pred hhccCCCCCCccccccccccceehhhhcc
Q 028959 171 LLFTSDSNDFENFTKEGIAFLFVMAIYLK 199 (201)
Q Consensus 171 L~qT~~~~d~~~~~~~~~~~~~~~~~~~~ 199 (201)
++||+++.+++.+ .+...+||++|++.
T Consensus 72 l~qs~~~~~~~~~--~~~~~d~SL~~vp~ 98 (239)
T PF11935_consen 72 LVQSPGSSDSPPR--RGSPNDFSLSSVPP 98 (239)
T ss_dssp HHTS---TTS-----GGGTTS--GGGS-T
T ss_pred HhcCCCCCCCccc--cccccCCCHHHcCC
Confidence 9999998877665 55677999999875
|
This domain is found in eukaryotes. This domain is typically between 239 to 261 amino acids in length. ; PDB: 3ODS_A 3ODR_A 3O2Q_A 3O2T_A 3O2S_A 3GS3_A. |
| >KOG1895 consensus mRNA cleavage and polyadenylation factor II complex, subunit PTA1 [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF05918 API5: Apoptosis inhibitory protein 5 (API5); InterPro: IPR008383 This family consists of apoptosis inhibitory protein 5 (API5) sequences from several organisms | Back alignment and domain information |
|---|
| >PRK09687 putative lyase; Provisional | Back alignment and domain information |
|---|
| >PF01602 Adaptin_N: Adaptin N terminal region; InterPro: IPR002553 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment | Back alignment and domain information |
|---|
| >PF13646 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2IAE_A 3B2A_A | Back alignment and domain information |
|---|
| >COG5096 Vesicle coat complex, various subunits [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PF12717 Cnd1: non-SMC mitotic condensation complex subunit 1 | Back alignment and domain information |
|---|
| >PTZ00429 beta-adaptin; Provisional | Back alignment and domain information |
|---|
| >PF01602 Adaptin_N: Adaptin N terminal region; InterPro: IPR002553 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment | Back alignment and domain information |
|---|
| >PF12717 Cnd1: non-SMC mitotic condensation complex subunit 1 | Back alignment and domain information |
|---|
| >PF12348 CLASP_N: CLASP N terminal; InterPro: IPR024395 This domain is found in the N-terminal region of CLIP-associated proteins (CLASPs), which are widely conserved microtubule plus-end-tracking proteins that regulate the stability of dynamic microtubules [, ] | Back alignment and domain information |
|---|
| >cd00020 ARM Armadillo/beta-catenin-like repeats | Back alignment and domain information |
|---|
| >PF13646 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2IAE_A 3B2A_A | Back alignment and domain information |
|---|
| >cd00020 ARM Armadillo/beta-catenin-like repeats | Back alignment and domain information |
|---|
| >KOG2956 consensus CLIP-associating protein [General function prediction only] | Back alignment and domain information |
|---|
| >COG5096 Vesicle coat complex, various subunits [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PTZ00429 beta-adaptin; Provisional | Back alignment and domain information |
|---|
| >PF12530 DUF3730: Protein of unknown function (DUF3730) ; InterPro: IPR022542 This domain is found in eukaryotes, and is typically between 220 and 262 amino acids in length | Back alignment and domain information |
|---|
| >PF12755 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region | Back alignment and domain information |
|---|
| >PRK09687 putative lyase; Provisional | Back alignment and domain information |
|---|
| >PF13513 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O_A 2H4M_A 2QMR_A 1QBK_B 2Z5M_A 2Z5K_A 2Z5N_A 1GCJ_B | Back alignment and domain information |
|---|
| >PF12830 Nipped-B_C: Sister chromatid cohesion C-terminus | Back alignment and domain information |
|---|
| >PF10508 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; InterPro: IPR019538 The 26S proteasome is an enzymatic complex that degrades ubiquitinated proteins in eukaryotic cells | Back alignment and domain information |
|---|
| >KOG1058 consensus Vesicle coat complex COPI, beta subunit [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF10274 ParcG: Parkin co-regulated protein; InterPro: IPR019399 This family of proteins is transcribed anti-sense along the DNA to the Parkin gene product and the two appear to be transcribed under the same promoter | Back alignment and domain information |
|---|
| >PF02985 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT repeat is a tandemly repeated, 37-47 amino acid long module occurring in a number of cytoplasmic proteins, including the four name-giving proteins huntingtin, elongation factor 3 (EF3), the 65 Kd alpha regulatory subunit of protein phosphatase 2A (PP2A) and the yeast PI3-kinase TOR1 [] | Back alignment and domain information |
|---|
| >PF10363 DUF2435: Protein of unknown function (DUF2435) | Back alignment and domain information |
|---|
| >PF10508 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; InterPro: IPR019538 The 26S proteasome is an enzymatic complex that degrades ubiquitinated proteins in eukaryotic cells | Back alignment and domain information |
|---|
| >PF12765 Cohesin_HEAT: HEAT repeat associated with sister chromatid cohesion | Back alignment and domain information |
|---|
| >PF12348 CLASP_N: CLASP N terminal; InterPro: IPR024395 This domain is found in the N-terminal region of CLIP-associated proteins (CLASPs), which are widely conserved microtubule plus-end-tracking proteins that regulate the stability of dynamic microtubules [, ] | Back alignment and domain information |
|---|
| >PF02985 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT repeat is a tandemly repeated, 37-47 amino acid long module occurring in a number of cytoplasmic proteins, including the four name-giving proteins huntingtin, elongation factor 3 (EF3), the 65 Kd alpha regulatory subunit of protein phosphatase 2A (PP2A) and the yeast PI3-kinase TOR1 [] | Back alignment and domain information |
|---|
| >KOG1525 consensus Sister chromatid cohesion complex Cohesin, subunit PDS5 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG2011 consensus Sister chromatid cohesion complex Cohesin, subunit STAG/IRR1/SCC3 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF05918 API5: Apoptosis inhibitory protein 5 (API5); InterPro: IPR008383 This family consists of apoptosis inhibitory protein 5 (API5) sequences from several organisms | Back alignment and domain information |
|---|
| >KOG1020 consensus Sister chromatid cohesion protein SCC2/Nipped-B [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG1059 consensus Vesicle coat complex AP-3, delta subunit [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF12755 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region | Back alignment and domain information |
|---|
| >PF10521 DUF2454: Protein of unknown function (DUF2454); InterPro: IPR018870 Putative protein of unknown function; subunit of the ASTRA complex which is part of the chromatin remodeling machinery; similar to Schizosaccharomyces pombe (Fission yeast) Tti2p; may interact with Rsm23p [] | Back alignment and domain information |
|---|
| >PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional | Back alignment and domain information |
|---|
| >PF00514 Arm: Armadillo/beta-catenin-like repeat; InterPro: IPR000225 The armadillo (Arm) repeat is an approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila melanogaster segment polarity gene armadillo involved in signal transduction through wingless | Back alignment and domain information |
|---|
| >KOG1060 consensus Vesicle coat complex AP-3, beta subunit [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF12830 Nipped-B_C: Sister chromatid cohesion C-terminus | Back alignment and domain information |
|---|
| >KOG2229 consensus Protein required for actin cytoskeleton organization and cell cycle progression [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional | Back alignment and domain information |
|---|
| >KOG1061 consensus Vesicle coat complex AP-1/AP-2/AP-4, beta subunit [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 201 | ||||
| 3o2q_A | 351 | Crystal Structure Of The Human Symplekin-Ssu72-Ctd | 9e-04 |
| >pdb|3O2Q|A Chain A, Crystal Structure Of The Human Symplekin-Ssu72-Ctd Phosphopeptide Complex Length = 351 | Back alignment and structure |
|
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 201 | |||
| 3gs3_A | 257 | Symplekin, LD45768P; helix-turn-helix heat repeat | 1e-33 | |
| 3o2t_A | 386 | Symplekin; heat repeat, scaffold, protein binding; | 2e-32 | |
| 2db0_A | 253 | 253AA long hypothetical protein; heat repeats, hel | 7e-04 |
| >3gs3_A Symplekin, LD45768P; helix-turn-helix heat repeat extended loop, transcription, protein binding; 2.40A {Drosophila melanogaster} Length = 257 | Back alignment and structure |
|---|
Score = 119 bits (300), Expect = 1e-33
Identities = 33/179 (18%), Positives = 68/179 (37%), Gaps = 6/179 (3%)
Query: 1 MAAVSRDQALSLLAAANNHGDLAVKLSSLKQVRGILSSADPSLAAELFPYLVELQSSPES 60
A +R + + + K L +V+ + + LA E ++ L
Sbjct: 9 KTATARAKVVDWCNELVIASP-STKCELLAKVQETVLGSCAELAEEFLESVLSLAHDSNM 67
Query: 61 LVRKSLIETIEDIGLKAMEHSSILMPVLLAFLRDGDSGVAGKSIVCGTNFFCRVLEEITM 120
VRK ++ +E + +E ++ V+ LRD + V + I + + L+ +
Sbjct: 68 EVRKQVVAFVEQVCKVKVELLPHVINVVSMLLRDNSAQVIKRVIQACGSIYKNGLQYLCS 127
Query: 121 QFRWHGKVERWLEELWTWMVRFKDAVFAIALEPGLVGTKLLALKFLETHVLLFTSDSND 179
+ E+ W + K + + ++ G + A+KFLE V+L + D
Sbjct: 128 ----LMEPGDSAEQAWNILSLIKAQILDM-IDNENDGIRTNAIKFLEGVVVLQSFADED 181
|
| >3o2t_A Symplekin; heat repeat, scaffold, protein binding; 1.40A {Homo sapiens} PDB: 3odr_A 3ods_A 3o2q_A* 3o2s_A Length = 386 | Back alignment and structure |
|---|
| >2db0_A 253AA long hypothetical protein; heat repeats, helical structure, structural genomics; 2.20A {Pyrococcus horikoshii} Length = 253 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 201 | |||
| 3gs3_A | 257 | Symplekin, LD45768P; helix-turn-helix heat repeat | 100.0 | |
| 3o2t_A | 386 | Symplekin; heat repeat, scaffold, protein binding; | 100.0 | |
| 2qk2_A | 242 | LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2 | 97.36 | |
| 2vgl_B | 591 | AP-2 complex subunit beta-1; cytoplasmic vesicle, | 97.28 | |
| 1oyz_A | 280 | Hypothetical protein YIBA; structural genomics, PS | 97.23 | |
| 2db0_A | 253 | 253AA long hypothetical protein; heat repeats, hel | 97.07 | |
| 3ltm_A | 211 | Alpha-REP4; protein engineering, heat-like repeat, | 97.03 | |
| 2qk1_A | 249 | Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, h | 96.98 | |
| 2vgl_B | 591 | AP-2 complex subunit beta-1; cytoplasmic vesicle, | 96.98 | |
| 2qk2_A | 242 | LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2 | 96.92 | |
| 1b3u_A | 588 | Protein (protein phosphatase PP2A); scaffold prote | 96.88 | |
| 2qk1_A | 249 | Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, h | 96.85 | |
| 1b3u_A | 588 | Protein (protein phosphatase PP2A); scaffold prote | 96.77 | |
| 4fdd_A | 852 | Transportin-1; heat repeats, karyopherin, nuclear | 96.74 | |
| 4hxt_A | 252 | De novo protein OR329; structural genomics, PSI-bi | 96.69 | |
| 4db6_A | 210 | Armadillo repeat protein; solenoid repeat, armadil | 96.65 | |
| 3ltj_A | 201 | Alpharep-4; protein engineering, heat-like repeat, | 96.55 | |
| 3ltm_A | 211 | Alpha-REP4; protein engineering, heat-like repeat, | 96.42 | |
| 3u0r_A | 507 | Apoptosis inhibitor 5; heat repeat, armadillo repe | 96.42 | |
| 2vgl_A | 621 | Adaptor protein complex AP-2, alpha 2 subunit; cyt | 96.31 | |
| 1w63_A | 618 | Adapter-related protein complex 1 gamma 1 subunit; | 96.23 | |
| 2jdq_A | 450 | Importin alpha-1 subunit; transport, PB2 subunit, | 96.1 | |
| 3ltj_A | 201 | Alpharep-4; protein engineering, heat-like repeat, | 95.98 | |
| 3tjz_B | 355 | Coatomer subunit gamma; protein trafficking, golgi | 95.98 | |
| 1te4_A | 131 | Conserved protein MTH187; methanobacterium thermoa | 95.84 | |
| 1ibr_B | 462 | P95, importin beta-1 subunit, nuclear factor; smal | 95.79 | |
| 4hxt_A | 252 | De novo protein OR329; structural genomics, PSI-bi | 95.73 | |
| 2jdq_A | 450 | Importin alpha-1 subunit; transport, PB2 subunit, | 95.65 | |
| 1u6g_C | 1230 | TIP120 protein, CAND1; cullin repeat, heat repeat, | 95.63 | |
| 1wa5_B | 530 | Importin alpha subunit; nuclear transport/complex, | 95.55 | |
| 1u6g_C | 1230 | TIP120 protein, CAND1; cullin repeat, heat repeat, | 95.52 | |
| 1oyz_A | 280 | Hypothetical protein YIBA; structural genomics, PS | 95.48 | |
| 1w63_A | 618 | Adapter-related protein complex 1 gamma 1 subunit; | 95.45 | |
| 4b8j_A | 528 | Importin subunit alpha-1A; transport protein, nucl | 95.43 | |
| 2bpt_A | 861 | Importin beta-1 subunit; nuclear transport, nucleo | 95.4 | |
| 4db6_A | 210 | Armadillo repeat protein; solenoid repeat, armadil | 95.32 | |
| 4db8_A | 252 | Armadillo-repeat protein; solenoid repeat, de novo | 94.97 | |
| 4db8_A | 252 | Armadillo-repeat protein; solenoid repeat, de novo | 94.93 | |
| 1qgr_A | 876 | Protein (importin beta subunit); transport recepto | 94.82 | |
| 4fdd_A | 852 | Transportin-1; heat repeats, karyopherin, nuclear | 94.76 | |
| 2bpt_A | 861 | Importin beta-1 subunit; nuclear transport, nucleo | 94.61 | |
| 1qgr_A | 876 | Protein (importin beta subunit); transport recepto | 94.59 | |
| 4b8j_A | 528 | Importin subunit alpha-1A; transport protein, nucl | 94.38 | |
| 3tpo_A | 529 | Importin subunit alpha-2; nuclear import, protein | 93.89 | |
| 3tjz_B | 355 | Coatomer subunit gamma; protein trafficking, golgi | 93.76 | |
| 1xqr_A | 296 | HSPBP1 protein; armadillo repeat, superhelical twi | 93.72 | |
| 1wa5_B | 530 | Importin alpha subunit; nuclear transport/complex, | 93.6 | |
| 2vgl_A | 621 | Adaptor protein complex AP-2, alpha 2 subunit; cyt | 93.54 | |
| 1te4_A | 131 | Conserved protein MTH187; methanobacterium thermoa | 93.51 | |
| 3ul1_B | 510 | Importin subunit alpha-2; arm repeat, armadillo re | 93.34 | |
| 3ul1_B | 510 | Importin subunit alpha-2; arm repeat, armadillo re | 92.87 | |
| 1ibr_B | 462 | P95, importin beta-1 subunit, nuclear factor; smal | 92.66 | |
| 3tpo_A | 529 | Importin subunit alpha-2; nuclear import, protein | 92.65 | |
| 1xqr_A | 296 | HSPBP1 protein; armadillo repeat, superhelical twi | 91.08 | |
| 4ady_A | 963 | RPN2, 26S proteasome regulatory subunit RPN2; prot | 88.82 | |
| 1xm9_A | 457 | Plakophilin 1; armadillo repeat, cell adhesion; 2. | 88.26 | |
| 3b2a_A | 265 | TON_1937, putative uncharacterized protein; heat-r | 87.98 | |
| 4ffb_C | 278 | Protein STU2; tubulin fold, heat repeats, cytoskel | 87.79 | |
| 2db0_A | 253 | 253AA long hypothetical protein; heat repeats, hel | 87.59 | |
| 2of3_A | 266 | ZYG-9; multifunctional macromolecule, kinetochore, | 86.51 | |
| 2z6g_A | 780 | B-catenin; FULL-length, beta-catenin, cell adhesio | 85.55 | |
| 2of3_A | 266 | ZYG-9; multifunctional macromolecule, kinetochore, | 85.15 | |
| 1jdh_A | 529 | Beta-catenin; beta-catenin, protein-protein comple | 83.49 | |
| 1jdh_A | 529 | Beta-catenin; beta-catenin, protein-protein comple | 82.66 | |
| 3u0r_A | 507 | Apoptosis inhibitor 5; heat repeat, armadillo repe | 81.28 | |
| 4atg_A | 196 | TAF6; transcription, TFIID; HET: NHE; 1.89A {Anton | 81.25 |
| >3gs3_A Symplekin, LD45768P; helix-turn-helix heat repeat extended loop, transcription, protein binding; 2.40A {Drosophila melanogaster} | Back alignment and structure |
|---|
Probab=100.00 E-value=2.3e-55 Score=381.20 Aligned_cols=185 Identities=20% Similarity=0.253 Sum_probs=173.4
Q ss_pred cchHHHHHHHHHHhhcCCChHHHHHHHHHHHHhhccCCCchHHhhhHHHhhhccCcchhHHHHHHHHHHHHhhchhhhhh
Q 028959 3 AVSRDQALSLLAAANNHGDLAVKLSSLKQVRGILSSADPSLAAELFPYLVELQSSPESLVRKSLIETIEDIGLKAMEHSS 82 (201)
Q Consensus 3 ~s~~~~v~~lLn~A~~~~d~~~Kl~~L~q~~elll~~dp~ll~~fl~~il~f~~d~~~~VRk~v~~fiee~c~~~~el~~ 82 (201)
+++||||++|||+|+.++| ++|+++|+|+||+++++||+|||+||+++++|++|++.+||||+++||||+|++++++++
T Consensus 11 ~~~~~~v~~lln~A~~~~~-~~kl~~L~qa~el~~~~dp~ll~~~l~~il~~~~~~~~~vrk~~~~Fi~e~~~~k~~l~~ 89 (257)
T 3gs3_A 11 ATARAKVVDWCNELVIASP-STKCELLAKVQETVLGSCAELAEEFLESVLSLAHDSNMEVRKQVVAFVEQVCKVKVELLP 89 (257)
T ss_dssp HHHHHHHHHHHHHHTTCCH-HHHHHHHHHHHHHHTTTTGGGHHHHHHHHHGGGGCSCHHHHHHHHHHHHHHHHHCGGGHH
T ss_pred ccHHHHHHHHHHHhhhcCc-HHHHHHHHHHHHHHHccCHhHHHHHHHHHHHhccCChHHHHHHHHHHHHHHHHHHHHHHH
Confidence 5899999999999999998 699999999999999999999999999999999999999999999999999999999999
Q ss_pred hHHHHHHHhhccCChhHHHHHHhhhhhhhHHHHHHHhhhhhccCc-chhhHHHHHHHHHHhHHHHHHHhccCCCCchhHH
Q 028959 83 ILMPVLLAFLRDGDSGVAGKSIVCGTNFFCRVLEEITMQFRWHGK-VERWLEELWTWMVRFKDAVFAIALEPGLVGTKLL 161 (201)
Q Consensus 83 ~~v~~L~~LL~D~~~~VvK~aI~~~t~lyr~~L~~~~~q~i~~~~-~~~~~~~~W~~m~~lK~~Il~~~~~s~n~GVr~~ 161 (201)
+++++|.+||+|+||+|+|++|+|+|++||.+| +|++.++ .+++++++|++|++||++|++ +|+++|+|||++
T Consensus 90 ~~l~~L~~Ll~d~d~~V~K~~I~~~~~iY~~~l-----~~i~~~~~~~~~~~~~W~~m~~lK~~Il~-~~~s~n~gvkl~ 163 (257)
T 3gs3_A 90 HVINVVSMLLRDNSAQVIKRVIQACGSIYKNGL-----QYLCSLMEPGDSAEQAWNILSLIKAQILD-MIDNENDGIRTN 163 (257)
T ss_dssp HHHHHHHHHTTCSCHHHHHHHHHHHHHHHHHHH-----HHHTTSSSCCHHHHHHHHHHHHHHHHHHH-GGGSSCHHHHHH
T ss_pred HHHHHHHHHHcCCCHHHHHHHHHHHHHHHHHHH-----HHHhcCCCCcchHHHHHHHHHHHHHHHHH-HHccCCcchHHH
Confidence 999999999999999999999999999999999 8888776 778899999999999999999 899999999999
Q ss_pred HHHhhhHhhhhccCCCCCCccccccccccceehhhhcc
Q 028959 162 ALKFLETHVLLFTSDSNDFENFTKEGIAFLFVMAIYLK 199 (201)
Q Consensus 162 aiKF~E~vIL~qT~~~~d~~~~~~~~~~~~~~~~~~~~ 199 (201)
|+||+|+||++||++.++ .|++++ +||++|++.
T Consensus 164 ~iKF~e~vIl~qT~~~~~--~~~~~~---d~SL~~Vp~ 196 (257)
T 3gs3_A 164 AIKFLEGVVVLQSFADED--SLKRDG---DFSLADVPD 196 (257)
T ss_dssp HHHHHHHHHHHTSCCCTT--SCCCTT---CCCGGGSCS
T ss_pred HHHHHHHHHHhhcCCCcc--cCCCCC---CCCHHHCCC
Confidence 999999999999966443 444433 899999875
|
| >3o2t_A Symplekin; heat repeat, scaffold, protein binding; 1.40A {Homo sapiens} PDB: 3odr_A 3ods_A 4h3k_A* 3o2s_A 3o2q_A* 4h3h_A* | Back alignment and structure |
|---|
| >2qk2_A LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2, heat repeat, micro plus END, +TIP, protein binding; 2.10A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2vgl_B AP-2 complex subunit beta-1; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Homo sapiens} SCOP: i.23.1.1 PDB: 2jkt_B 2jkr_B* 2xa7_B 1w63_B | Back alignment and structure |
|---|
| >1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 | Back alignment and structure |
|---|
| >2db0_A 253AA long hypothetical protein; heat repeats, helical structure, structural genomics; 2.20A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} | Back alignment and structure |
|---|
| >2qk1_A Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, heat repeat, microtubule plus END, +TIP, protein binding; 1.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2vgl_B AP-2 complex subunit beta-1; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Homo sapiens} SCOP: i.23.1.1 PDB: 2jkt_B 2jkr_B* 2xa7_B 1w63_B | Back alignment and structure |
|---|
| >2qk2_A LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2, heat repeat, micro plus END, +TIP, protein binding; 2.10A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A | Back alignment and structure |
|---|
| >2qk1_A Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, heat repeat, microtubule plus END, +TIP, protein binding; 1.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A | Back alignment and structure |
|---|
| >4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* | Back alignment and structure |
|---|
| >4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene} | Back alignment and structure |
|---|
| >4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A | Back alignment and structure |
|---|
| >3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} | Back alignment and structure |
|---|
| >3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} | Back alignment and structure |
|---|
| >3u0r_A Apoptosis inhibitor 5; heat repeat, armadillo repeat, lysine acetylation; 2.50A {Homo sapiens} PDB: 3v6a_A | Back alignment and structure |
|---|
| >2vgl_A Adaptor protein complex AP-2, alpha 2 subunit; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Rattus norvegicus} PDB: 2xa7_A 2jkr_A 2jkt_A | Back alignment and structure |
|---|
| >1w63_A Adapter-related protein complex 1 gamma 1 subunit; endocytosis, clathrin adaptor, transport, coated PITS; 4.0A {Mus musculus} SCOP: i.23.1.1 | Back alignment and structure |
|---|
| >2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A | Back alignment and structure |
|---|
| >3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} | Back alignment and structure |
|---|
| >3tjz_B Coatomer subunit gamma; protein trafficking, golgi membrane, protein transport-prote binding complex; HET: GNP; 2.90A {Bos taurus} | Back alignment and structure |
|---|
| >1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 | Back alignment and structure |
|---|
| >1ibr_B P95, importin beta-1 subunit, nuclear factor; small GTPase, nuclear transport receptor, cell cycle, translation; HET: GNP; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1m5n_S 1gcj_A 1f59_A 1o6o_A 1o6p_A | Back alignment and structure |
|---|
| >4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene} | Back alignment and structure |
|---|
| >2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A | Back alignment and structure |
|---|
| >1u6g_C TIP120 protein, CAND1; cullin repeat, heat repeat, ring finger, ligase; 3.10A {Homo sapiens} SCOP: a.118.1.2 PDB: 4a0c_A | Back alignment and structure |
|---|
| >1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A | Back alignment and structure |
|---|
| >1u6g_C TIP120 protein, CAND1; cullin repeat, heat repeat, ring finger, ligase; 3.10A {Homo sapiens} SCOP: a.118.1.2 PDB: 4a0c_A | Back alignment and structure |
|---|
| >1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 | Back alignment and structure |
|---|
| >1w63_A Adapter-related protein complex 1 gamma 1 subunit; endocytosis, clathrin adaptor, transport, coated PITS; 4.0A {Mus musculus} SCOP: i.23.1.1 | Back alignment and structure |
|---|
| >4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A | Back alignment and structure |
|---|
| >2bpt_A Importin beta-1 subunit; nuclear transport, nucleocytoplasmic transport, nuclear trafficking, importin- beta, complex; 1.99A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 2bku_B 3ea5_B* 3nd2_A | Back alignment and structure |
|---|
| >4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A | Back alignment and structure |
|---|
| >4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} | Back alignment and structure |
|---|
| >4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} | Back alignment and structure |
|---|
| >1qgr_A Protein (importin beta subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qgk_A 2p8q_A 2q5d_A 3lww_A 1ukl_A 2qna_A | Back alignment and structure |
|---|
| >4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* | Back alignment and structure |
|---|
| >2bpt_A Importin beta-1 subunit; nuclear transport, nucleocytoplasmic transport, nuclear trafficking, importin- beta, complex; 1.99A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 2bku_B 3ea5_B* 3nd2_A | Back alignment and structure |
|---|
| >1qgr_A Protein (importin beta subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qgk_A 2p8q_A 2q5d_A 3lww_A 1ukl_A 2qna_A | Back alignment and structure |
|---|
| >4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A | Back alignment and structure |
|---|
| >3tpo_A Importin subunit alpha-2; nuclear import, protein transport; 2.10A {Mus musculus} PDB: 1qgk_B 1qgr_B | Back alignment and structure |
|---|
| >3tjz_B Coatomer subunit gamma; protein trafficking, golgi membrane, protein transport-prote binding complex; HET: GNP; 2.90A {Bos taurus} | Back alignment and structure |
|---|
| >1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* | Back alignment and structure |
|---|
| >1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A | Back alignment and structure |
|---|
| >2vgl_A Adaptor protein complex AP-2, alpha 2 subunit; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Rattus norvegicus} PDB: 2xa7_A 2jkr_A 2jkt_A | Back alignment and structure |
|---|
| >1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 | Back alignment and structure |
|---|
| >3ul1_B Importin subunit alpha-2; arm repeat, armadillo repeat, nuclear transport, nuclear LOC signal binding, importin beta binding; 1.90A {Mus musculus} PDB: 3ukx_B 3uky_B 3ukz_B 3ukw_B 3ul0_B 3oqs_A 3rz9_A 3rzx_A 3uvu_A 1q1s_C 1q1t_C 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C ... | Back alignment and structure |
|---|
| >3ul1_B Importin subunit alpha-2; arm repeat, armadillo repeat, nuclear transport, nuclear LOC signal binding, importin beta binding; 1.90A {Mus musculus} PDB: 3ukx_B 3uky_B 3ukz_B 3ukw_B 3ul0_B 3oqs_A 3rz9_A 3rzx_A 3uvu_A 1q1s_C 1q1t_C 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C ... | Back alignment and structure |
|---|
| >1ibr_B P95, importin beta-1 subunit, nuclear factor; small GTPase, nuclear transport receptor, cell cycle, translation; HET: GNP; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1m5n_S 1gcj_A 1f59_A 1o6o_A 1o6p_A | Back alignment and structure |
|---|
| >3tpo_A Importin subunit alpha-2; nuclear import, protein transport; 2.10A {Mus musculus} PDB: 1qgk_B 1qgr_B | Back alignment and structure |
|---|
| >1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* | Back alignment and structure |
|---|
| >4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N | Back alignment and structure |
|---|
| >1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 | Back alignment and structure |
|---|
| >3b2a_A TON_1937, putative uncharacterized protein; heat-repeats, hypothetical, unknown function; 2.20A {Thermococcus onnurineus} | Back alignment and structure |
|---|
| >4ffb_C Protein STU2; tubulin fold, heat repeats, cytoskeleton, microtubule, tubul domain, hydrolase; HET: GTP; 2.88A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2db0_A 253AA long hypothetical protein; heat repeats, helical structure, structural genomics; 2.20A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2of3_A ZYG-9; multifunctional macromolecule, kinetochore, microtubule, XMAP215, STU2, DIS1, microtubule associated protein, structural protein; 1.90A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} | Back alignment and structure |
|---|
| >2of3_A ZYG-9; multifunctional macromolecule, kinetochore, microtubule, XMAP215, STU2, DIS1, microtubule associated protein, structural protein; 1.90A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A | Back alignment and structure |
|---|
| >1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A | Back alignment and structure |
|---|
| >3u0r_A Apoptosis inhibitor 5; heat repeat, armadillo repeat, lysine acetylation; 2.50A {Homo sapiens} PDB: 3v6a_A | Back alignment and structure |
|---|
| >4atg_A TAF6; transcription, TFIID; HET: NHE; 1.89A {Antonospora locustae} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 201 | ||||
| d1b3ua_ | 588 | a.118.1.2 (A:) Constant regulatory domain of prote | 3e-05 |
| >d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 588 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: alpha-alpha superhelix superfamily: ARM repeat family: HEAT repeat domain: Constant regulatory domain of protein phosphatase 2a, pr65alpha species: Human (Homo sapiens) [TaxId: 9606]
Score = 41.7 bits (96), Expect = 3e-05
Identities = 15/98 (15%), Positives = 42/98 (42%), Gaps = 3/98 (3%)
Query: 5 SRDQALSLLAAANNHGDLAVKLSSLKQVRGILSSADPSLAAE-LFPYLVELQSSPESLVR 63
+ + + A + + ++++L + + + + + P ++ + P + VR
Sbjct: 477 AHATIIPKVLAMSGDPNYLHRMTTLFCINVLSEVCGQDITTKHMLPTVLRMAGDPVANVR 536
Query: 64 KSLIETIEDIG--LKAMEHSSILMPVLLAFLRDGDSGV 99
++ ++++ IG L S + P+L +D D V
Sbjct: 537 FNVAKSLQKIGPILDNSTLQSEVKPILEKLTQDQDVDV 574
|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 201 | |||
| d2vglb_ | 579 | Adaptin beta subunit N-terminal fragment {Human (H | 96.74 | |
| d1te4a_ | 111 | MTH187 {Archaeon Methanobacterium thermoautotrophi | 96.62 | |
| d1oyza_ | 276 | Hypothetical protein YibA {Escherichia coli [TaxId | 96.53 | |
| d2vglb_ | 579 | Adaptin beta subunit N-terminal fragment {Human (H | 96.34 | |
| d1b3ua_ | 588 | Constant regulatory domain of protein phosphatase | 95.89 | |
| d1b3ua_ | 588 | Constant regulatory domain of protein phosphatase | 95.82 | |
| d1te4a_ | 111 | MTH187 {Archaeon Methanobacterium thermoautotrophi | 95.79 | |
| d2vgla_ | 584 | Adaptin alpha C subunit N-terminal fragment {Mouse | 95.54 | |
| d1q1sc_ | 434 | Importin alpha {Mouse (Mus musculus) [TaxId: 10090 | 95.3 | |
| d1oyza_ | 276 | Hypothetical protein YibA {Escherichia coli [TaxId | 95.01 | |
| d1xm9a1 | 457 | Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} | 94.53 | |
| d1xqra1 | 264 | Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi | 94.44 | |
| d1qbkb_ | 888 | Karyopherin beta2 {Human (Homo sapiens) [TaxId: 96 | 94.43 | |
| d1q1sc_ | 434 | Importin alpha {Mouse (Mus musculus) [TaxId: 10090 | 93.81 | |
| d1u6gc_ | 1207 | Cullin-associated NEDD8-dissociated protein 1 (Tip | 93.1 | |
| d1wa5b_ | 503 | Karyopherin alpha {Baker's yeast (Saccharomyces ce | 93.09 | |
| d1xqra1 | 264 | Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi | 92.81 | |
| d1wa5b_ | 503 | Karyopherin alpha {Baker's yeast (Saccharomyces ce | 92.04 | |
| d2bpta1 | 861 | Importin beta {Baker's yeast (Saccharomyces cerevi | 91.91 | |
| d1u6gc_ | 1207 | Cullin-associated NEDD8-dissociated protein 1 (Tip | 91.55 | |
| d1ibrb_ | 458 | Importin beta {Human (Homo sapiens) [TaxId: 9606]} | 91.38 | |
| d2vgla_ | 584 | Adaptin alpha C subunit N-terminal fragment {Mouse | 90.88 | |
| d1xm9a1 | 457 | Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} | 90.73 | |
| d2bpta1 | 861 | Importin beta {Baker's yeast (Saccharomyces cerevi | 88.92 | |
| d1qbkb_ | 888 | Karyopherin beta2 {Human (Homo sapiens) [TaxId: 96 | 88.62 | |
| d1qgra_ | 876 | Importin beta {Human (Homo sapiens) [TaxId: 9606]} | 88.21 | |
| d1ibrb_ | 458 | Importin beta {Human (Homo sapiens) [TaxId: 9606]} | 88.0 | |
| d1jdha_ | 529 | beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} | 85.97 | |
| d1qgra_ | 876 | Importin beta {Human (Homo sapiens) [TaxId: 9606]} | 84.15 |
| >d1te4a_ a.118.1.16 (A:) MTH187 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1te4a_ a.118.1.16 (A:) MTH187 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2bpta1 a.118.1.1 (A:1-861) Importin beta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bpta1 a.118.1.1 (A:1-861) Importin beta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qgra_ a.118.1.1 (A:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qgra_ a.118.1.1 (A:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|