Citrus Sinensis ID: 028988


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200
MASSSSLSSATPSQLCSSKGGMFCPSRAFLVKPARTQMVTKNPMGMKIKCQATSIPADRVPDMGKRQLMNLLLLGAVSLPTGFMLVPYATFFAPPGLGSAGGGTTAKDAIGNDIIAADWLNTHGPGDRTLTEGLKGDPTYLVVEKDKTLASYGINAVCTHLGCVVPWNSAENKFICPCHGSQYNNQGRVVRGPAPLVSNT
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccEEEcccccccEEcccccccccccccccccccccccEEEEEccccccEEEEEccccccccccccccccccEEccccccccccccccccccccccccc
ccccccccccccHHHccccccccccccEEEccccccccccccccccEEEEEEccccccccccccHHHHHHHHHHHHHHHHHHHHHccHHEEEccccccccccccEcEcccccEcEHHHHHHHcccccEEEEEcHHHcEEEEEEcccccEccEEEEcEccccccEccEEccccEEEccccccEEEccccEEEccccccccc
masssslssatpsqlcsskggmfcpsraflvkpartqmvtknpmgmkikcqatsipadrvpdmgKRQLMNLLLLGavslptgfmlvpyatffappglgsagggttakdaigndiiaadwlnthgpgdrtlteglkgdptylvvekdktlasygINAVCTHLgcvvpwnsaenkficpchgsqynnqgrvvrgpaplvsnt
masssslssatpsqlcsskggmfCPSRAFLVKPARTQmvtknpmgmkikcQATSIPADRVPDMGKRQLMNLLLLGAVSLPTGFMLVPYATFFAPPGLGSAGGGTTAKDAIGNDIIAADWLNTHGPGDrtlteglkgdptYLVVEKDKTLASYGINAVCTHLGCVVPWNSAENKFICPCHGsqynnqgrvvrgpaplvsnt
MAsssslssatpsqlcssKGGMFCPSRAFLVKPARTQMVTKNPMGMKIKCQATSIPADRVPDMGKRQLMNLLLLGAVSLPTGFMLVPYATFFAPPGLGSAGGGTTAKDAIGNDIIAADWLNTHGPGDRTLTEGLKGDPTYLVVEKDKTLASYGINAVCTHLGCVVPWNSAENKFICPCHGSQYNNQGRVVRGPAPLVSNT
*********************MFCPSRAFLVKPARTQMV*****GMKIKCQATSIPADRVPDMGKRQLMNLLLLGAVSLPTGFMLVPYATFFAPPGLGSAGGGTTAKDAIGNDIIAADWLNTHGPGDRTLTEGLKGDPTYLVVEKDKTLASYGINAVCTHLGCVVPWNSAENKFICPCHGSQYNN***************
*******************************************************************LMNLLLLGAVSLPTGFMLVPYATFFAPPGLGSAGGGTTAKDAIGNDIIAADWLNTHGPGDRTLTEGLKGDPTYLVVEKDKTLASYGINAVCTHLGCVVPWNSAENKFICPCHGSQYNNQGRVVRGPAPL****
*****************SKGGMFCPSRAFLVKPARTQMVTKNPMGMKIKCQATSIPADRVPDMGKRQLMNLLLLGAVSLPTGFMLVPYATFFAPPGLGSAGGGTTAKDAIGNDIIAADWLNTHGPGDRTLTEGLKGDPTYLVVEKDKTLASYGINAVCTHLGCVVPWNSAENKFICPCHGSQYNNQGRVVRGPAPLVSNT
*********************MFCPSRAFLVK*AR********MGMKIKCQATSIPADRVPDMGKRQLMNLLLLGAVSLPTGFMLVPYATFFAPPGLGSAGGGTTAKDAIGNDIIAADWLNTHGPGDRTLTEGLKGDPTYLVVEKDKTLASYGINAVCTHLGCVVPWNSAENKFICPCHGSQYNNQGRVVRGPAPLV***
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASSSSLSSATPSQLCSSKGGMFCPSRAFLVKPARTQMVTKNPMGMKIKCQATSIPADRVPDMGKRQLMNLLLLGAVSLPTGFMLVPYATFFAPPGLGSAGGGTTAKDAIGNDIIAADWLNTHGPGDRTLTEGLKGDPTYLVVEKDKTLASYGINAVCTHLGCVVPWNSAENKFICPCHGSQYNNQGRVVRGPAPLVSNT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query200 2.2.26 [Sep-21-2011]
P26291230 Cytochrome b6-f complex i N/A no 0.97 0.843 0.752 3e-78
Q69S39225 Cytochrome b6-f complex i yes no 0.955 0.848 0.680 2e-73
P08980230 Cytochrome b6-f complex i N/A no 0.965 0.839 0.755 8e-73
O49078230 Cytochrome b6-f complex i N/A no 0.98 0.852 0.709 5e-72
Q7X9A6222 Cytochrome b6-f complex i N/A no 0.945 0.851 0.642 2e-70
Q9ZR03229 Cytochrome b6-f complex i yes no 0.96 0.838 0.739 7e-70
Q69GY7230 Cytochrome b6-f complex i N/A no 0.955 0.830 0.723 2e-64
Q02585228 Cytochrome b6-f complex i N/A no 0.945 0.828 0.718 2e-61
P30361228 Cytochrome b6-f complex i N/A no 0.945 0.828 0.713 1e-60
Q9SBN3206 Cytochrome b6-f complex i N/A no 0.805 0.781 0.579 6e-50
>sp|P26291|UCRIA_PEA Cytochrome b6-f complex iron-sulfur subunit, chloroplastic OS=Pisum sativum GN=petC PE=2 SV=1 Back     alignment and function desciption
 Score =  290 bits (743), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 146/194 (75%), Positives = 165/194 (85%)

Query: 3   SSSSLSSATPSQLCSSKGGMFCPSRAFLVKPARTQMVTKNPMGMKIKCQATSIPADRVPD 62
           SS++LS  TPSQLCS K G+ CPS A LVKP RTQM  +   GMKI CQATSIPADRVPD
Sbjct: 2   SSTTLSPTTPSQLCSGKSGISCPSIALLVKPTRTQMTGRGNKGMKITCQATSIPADRVPD 61

Query: 63  MGKRQLMNLLLLGAVSLPTGFMLVPYATFFAPPGLGSAGGGTTAKDAIGNDIIAADWLNT 122
           M KR+ +NLLLLGA+SLPT  MLVPY +F  PPG GS+ GGT AKDA+GND++A +WL T
Sbjct: 62  MSKRKTLNLLLLGALSLPTAGMLVPYGSFLVPPGSGSSTGGTVAKDAVGNDVVATEWLKT 121

Query: 123 HGPGDRTLTEGLKGDPTYLVVEKDKTLASYGINAVCTHLGCVVPWNSAENKFICPCHGSQ 182
           H PGDRTLT+GLKGDPTYLVVEKD+TLA++ INAVCTHLGCVVP+N AENKFICPCHGSQ
Sbjct: 122 HAPGDRTLTQGLKGDPTYLVVEKDRTLATFAINAVCTHLGCVVPFNQAENKFICPCHGSQ 181

Query: 183 YNNQGRVVRGPAPL 196
           YN+QGRVVRGPAPL
Sbjct: 182 YNDQGRVVRGPAPL 195




Component of the cytochrome b6-f complex, which mediates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Pisum sativum (taxid: 3888)
EC: 1EC: .EC: 1EC: 0EC: .EC: 9EC: .EC: 1
>sp|Q69S39|UCRIA_ORYSJ Cytochrome b6-f complex iron-sulfur subunit, chloroplastic OS=Oryza sativa subsp. japonica GN=petC PE=1 SV=1 Back     alignment and function description
>sp|P08980|UCRIA_SPIOL Cytochrome b6-f complex iron-sulfur subunit, chloroplastic OS=Spinacia oleracea GN=petC PE=1 SV=2 Back     alignment and function description
>sp|O49078|UCRIA_FRIAG Cytochrome b6-f complex iron-sulfur subunit, chloroplastic OS=Fritillaria agrestis GN=petC PE=2 SV=1 Back     alignment and function description
>sp|Q7X9A6|UCRIA_WHEAT Cytochrome b6-f complex iron-sulfur subunit, chloroplastic OS=Triticum aestivum GN=petC PE=2 SV=1 Back     alignment and function description
>sp|Q9ZR03|UCRIA_ARATH Cytochrome b6-f complex iron-sulfur subunit, chloroplastic OS=Arabidopsis thaliana GN=petC PE=1 SV=1 Back     alignment and function description
>sp|Q69GY7|UCRIA_SOLTU Cytochrome b6-f complex iron-sulfur subunit, chloroplastic OS=Solanum tuberosum GN=petC PE=2 SV=1 Back     alignment and function description
>sp|Q02585|UCRIB_TOBAC Cytochrome b6-f complex iron-sulfur subunit 2, chloroplastic OS=Nicotiana tabacum GN=petC2 PE=2 SV=1 Back     alignment and function description
>sp|P30361|UCRIA_TOBAC Cytochrome b6-f complex iron-sulfur subunit 1, chloroplastic OS=Nicotiana tabacum GN=petC1 PE=2 SV=2 Back     alignment and function description
>sp|Q9SBN3|UCRIA_VOLCA Cytochrome b6-f complex iron-sulfur subunit, chloroplastic OS=Volvox carteri GN=petC PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query200
225461287228 PREDICTED: cytochrome b6-f complex iron- 0.97 0.850 0.778 2e-84
255627487227 unknown [Glycine max] 0.965 0.850 0.757 4e-84
255640787262 unknown [Glycine max] 0.965 0.736 0.752 2e-83
356549980227 PREDICTED: cytochrome b6-f complex iron- 0.965 0.850 0.752 4e-83
388490498227 unknown [Lotus japonicus] 0.965 0.850 0.788 3e-81
351726724227 Rieske iron-sulphur protein precursor [G 0.965 0.850 0.737 4e-81
315364830227 chloroplast Rieske-type ion-sulfur prote 0.965 0.850 0.762 5e-80
449438050227 PREDICTED: cytochrome b6-f complex iron- 0.965 0.850 0.757 7e-79
359485728214 PREDICTED: cytochrome b6-f complex iron- 0.96 0.897 0.741 7e-79
225447691226 PREDICTED: cytochrome b6-f complex iron- 0.96 0.849 0.741 9e-79
>gi|225461287|ref|XP_002284361.1| PREDICTED: cytochrome b6-f complex iron-sulfur subunit, chloroplastic isoform 1 [Vitis vinifera] gi|147826727|emb|CAN66108.1| hypothetical protein VITISV_020089 [Vitis vinifera] gi|302143099|emb|CBI20394.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  317 bits (812), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 151/194 (77%), Positives = 167/194 (86%)

Query: 3   SSSSLSSATPSQLCSSKGGMFCPSRAFLVKPARTQMVTKNPMGMKIKCQATSIPADRVPD 62
           ++S+LS AT SQLCS + G+  PS A L K  RT        G+KIKCQATSIPADRVPD
Sbjct: 2   AASTLSPATSSQLCSIRNGVLSPSHALLPKLTRTSPFVGKGKGLKIKCQATSIPADRVPD 61

Query: 63  MGKRQLMNLLLLGAVSLPTGFMLVPYATFFAPPGLGSAGGGTTAKDAIGNDIIAADWLNT 122
           MGKR+LMNLLLLGA+SLP+  ML+PYATFFAPPG GSAGGG  AKDA+GND+IA +WL T
Sbjct: 62  MGKRKLMNLLLLGAISLPSAGMLIPYATFFAPPGTGSAGGGIVAKDALGNDVIADEWLKT 121

Query: 123 HGPGDRTLTEGLKGDPTYLVVEKDKTLASYGINAVCTHLGCVVPWNSAENKFICPCHGSQ 182
           HGPGDRTLT+GLKGDPTYLVVE DKTLA+YGINAVCTHLGCVVPWN+AENKFICPCHGSQ
Sbjct: 122 HGPGDRTLTQGLKGDPTYLVVENDKTLATYGINAVCTHLGCVVPWNAAENKFICPCHGSQ 181

Query: 183 YNNQGRVVRGPAPL 196
           YNNQGRVVRGPAPL
Sbjct: 182 YNNQGRVVRGPAPL 195




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|255627487|gb|ACU14088.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|255640787|gb|ACU20677.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|356549980|ref|XP_003543368.1| PREDICTED: cytochrome b6-f complex iron-sulfur subunit, chloroplastic-like [Glycine max] Back     alignment and taxonomy information
>gi|388490498|gb|AFK33315.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|351726724|ref|NP_001237648.1| Rieske iron-sulphur protein precursor [Glycine max] gi|158935079|emb|CAM57107.1| Rieske iron-sulphur protein precursor [Glycine max] Back     alignment and taxonomy information
>gi|315364830|gb|ADU05416.1| chloroplast Rieske-type ion-sulfur protein [Citrullus lanatus] Back     alignment and taxonomy information
>gi|449438050|ref|XP_004136803.1| PREDICTED: cytochrome b6-f complex iron-sulfur subunit, chloroplastic-like [Cucumis sativus] gi|449530696|ref|XP_004172329.1| PREDICTED: cytochrome b6-f complex iron-sulfur subunit, chloroplastic-like [Cucumis sativus] gi|395455815|emb|CCJ09121.1| Rieske type ion sulfur subunit (chloroplast) [Cucumis sativus] Back     alignment and taxonomy information
>gi|359485728|ref|XP_003633324.1| PREDICTED: cytochrome b6-f complex iron-sulfur subunit, chloroplastic-like isoform 2 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225447691|ref|XP_002276770.1| PREDICTED: cytochrome b6-f complex iron-sulfur subunit, chloroplastic-like isoform 1 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query200
TAIR|locus:2005534229 PETC "photosynthetic electron 0.89 0.777 0.744 6.5e-74
TIGR_CMR|GSU_1650139 GSU_1650 "cytochrome b/b6 comp 0.53 0.762 0.338 3.9e-12
TIGR_CMR|BA_0365508 BA_0365 "Rieske 2Fe-2S iron-su 0.25 0.098 0.46 3.4e-11
TIGR_CMR|BA_1544170 BA_1544 "menaquinol-cytochrome 0.66 0.776 0.297 9.4e-11
TIGR_CMR|GSU_2933131 GSU_2933 "cytochrome b/b6 comp 0.255 0.389 0.446 1e-10
TIGR_CMR|NSE_0624173 NSE_0624 "ubiquinol-cytochrome 0.325 0.375 0.449 1.5e-10
TIGR_CMR|APH_0401189 APH_0401 "ubiquinol-cytochrome 0.255 0.269 0.490 2.2e-09
TIGR_CMR|ECH_0520187 ECH_0520 "ubiquinol-cytochrome 0.2 0.213 0.536 3.6e-09
GENEDB_PFALCIPARUM|PF14_0373355 PF14_0373 "iron-sulphur protei 0.265 0.149 0.436 5.3e-09
UNIPROTKB|Q8IL75355 PF14_0373 "Ubiquinol-cytochrom 0.265 0.149 0.436 5.3e-09
TAIR|locus:2005534 PETC "photosynthetic electron transfer C" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 746 (267.7 bits), Expect = 6.5e-74, P = 6.5e-74
 Identities = 134/180 (74%), Positives = 152/180 (84%)

Query:    19 KGGMFCPSRAFLVKPART--QMVTKNPMGMKIKCQATSIPADRVPDMGKRQLMNLLLLGA 76
             +  +   S    VKP +   QMV K  +G++I CQA+SIPADRVPDM KR+ +NLLLLGA
Sbjct:    16 RSALMAMSSGLFVKPTKMNHQMVRKEKIGLRISCQASSIPADRVPDMEKRKTLNLLLLGA 75

Query:    77 VSLPTGFMLVPYATFFAPPGLGSAGGGTTAKDAIGNDIIAADWLNTHGPGDRTLTEGLKG 136
             +SLPTG+MLVPYATFF PPG G  GGGT AKDA+GND++AA+WL THGPGDRTLT+GLKG
Sbjct:    76 LSLPTGYMLVPYATFFVPPGTGGGGGGTPAKDALGNDVVAAEWLKTHGPGDRTLTQGLKG 135

Query:   137 DPTYLVVEKDKTLASYGINAVCTHLGCVVPWNSAENKFICPCHGSQYNNQGRVVRGPAPL 196
             DPTYLVVE DKTLA+YGINAVCTHLGCVVPWN AENKF+CPCHGSQYN QGRVVRGPAPL
Sbjct:   136 DPTYLVVENDKTLATYGINAVCTHLGCVVPWNKAENKFLCPCHGSQYNAQGRVVRGPAPL 195




GO:0008121 "ubiquinol-cytochrome-c reductase activity" evidence=IEA
GO:0009496 "plastoquinol--plastocyanin reductase activity" evidence=IEA
GO:0009507 "chloroplast" evidence=ISM;IDA
GO:0016491 "oxidoreductase activity" evidence=IEA
GO:0016679 "oxidoreductase activity, acting on diphenols and related substances as donors" evidence=IEA
GO:0051537 "2 iron, 2 sulfur cluster binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0010196 "nonphotochemical quenching" evidence=IMP
GO:0009512 "cytochrome b6f complex" evidence=TAS
GO:0009535 "chloroplast thylakoid membrane" evidence=IDA;TAS
GO:0009767 "photosynthetic electron transport chain" evidence=TAS
GO:0046028 "electron transporter, transferring electrons from cytochrome b6/f complex of photosystem II activity" evidence=TAS
GO:0005515 "protein binding" evidence=IPI
GO:0009941 "chloroplast envelope" evidence=IDA
GO:0009579 "thylakoid" evidence=IDA
GO:0005886 "plasma membrane" evidence=IDA
GO:0042742 "defense response to bacterium" evidence=IEP;RCA
GO:0016020 "membrane" evidence=IDA
GO:0009534 "chloroplast thylakoid" evidence=IDA
GO:0080167 "response to karrikin" evidence=IEP
GO:0000165 "MAPK cascade" evidence=RCA
GO:0006098 "pentose-phosphate shunt" evidence=RCA
GO:0006364 "rRNA processing" evidence=RCA
GO:0006612 "protein targeting to membrane" evidence=RCA
GO:0009409 "response to cold" evidence=RCA
GO:0009595 "detection of biotic stimulus" evidence=RCA
GO:0009657 "plastid organization" evidence=RCA
GO:0009697 "salicylic acid biosynthetic process" evidence=RCA
GO:0009814 "defense response, incompatible interaction" evidence=RCA
GO:0009862 "systemic acquired resistance, salicylic acid mediated signaling pathway" evidence=RCA
GO:0009867 "jasmonic acid mediated signaling pathway" evidence=RCA
GO:0010200 "response to chitin" evidence=RCA
GO:0010207 "photosystem II assembly" evidence=RCA
GO:0010310 "regulation of hydrogen peroxide metabolic process" evidence=RCA
GO:0010363 "regulation of plant-type hypersensitive response" evidence=RCA
GO:0019684 "photosynthesis, light reaction" evidence=RCA
GO:0031348 "negative regulation of defense response" evidence=RCA
GO:0043900 "regulation of multi-organism process" evidence=RCA
GO:0050832 "defense response to fungus" evidence=RCA
TIGR_CMR|GSU_1650 GSU_1650 "cytochrome b/b6 complex, iron-sulfur subunit" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
TIGR_CMR|BA_0365 BA_0365 "Rieske 2Fe-2S iron-sulfur protein, putative" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
TIGR_CMR|BA_1544 BA_1544 "menaquinol-cytochrome c reductase, iron-sulfur subunit" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_2933 GSU_2933 "cytochrome b/b6 complex, iron-sulfur subunit" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
TIGR_CMR|NSE_0624 NSE_0624 "ubiquinol-cytochrome c reductase, iron-sulfur subunit" [Neorickettsia sennetsu str. Miyayama (taxid:222891)] Back     alignment and assigned GO terms
TIGR_CMR|APH_0401 APH_0401 "ubiquinol-cytochrome c reductase, iron-sulfur subunit" [Anaplasma phagocytophilum HZ (taxid:212042)] Back     alignment and assigned GO terms
TIGR_CMR|ECH_0520 ECH_0520 "ubiquinol-cytochrome c reductase, iron-sulfur subunit" [Ehrlichia chaffeensis str. Arkansas (taxid:205920)] Back     alignment and assigned GO terms
GENEDB_PFALCIPARUM|PF14_0373 PF14_0373 "iron-sulphur protein subunit of the cytochrome bc1 complex" [Plasmodium falciparum (taxid:5833)] Back     alignment and assigned GO terms
UNIPROTKB|Q8IL75 PF14_0373 "Ubiquinol-cytochrome C reductase iron-sulfur subunit, putative" [Plasmodium falciparum 3D7 (taxid:36329)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
A9BE84UCRI_PROM41, ., 1, 0, ., 9, ., 10.59570.70.7865yesno
Q9ZR03UCRIA_ARATH1, ., 1, 0, ., 9, ., 10.73970.960.8384yesno
P30361UCRIA_TOBAC1, ., 1, 0, ., 9, ., 10.71350.9450.8289N/Ano
Q93SX0UCRIA_NOSS11, ., 1, 0, ., 9, ., 10.63970.680.7597yesno
Q7V2L4UCRI_PROMP1, ., 1, 0, ., 9, ., 10.54860.720.8089yesno
A3PBI5UCRI_PROM01, ., 1, 0, ., 9, ., 10.56250.720.8089yesno
Q69S39UCRIA_ORYSJ1, ., 1, 0, ., 9, ., 10.68020.9550.8488yesno
Q3AWL7UCRI_SYNS91, ., 1, 0, ., 9, ., 10.61800.720.8089yesno
Q7V654UCRI_PROMM1, ., 1, 0, ., 9, ., 10.59720.720.8089yesno
P26292UCRI_SYNP21, ., 1, 0, ., 9, ., 10.64960.6850.7611yesno
P26291UCRIA_PEA1, ., 1, 0, ., 9, ., 10.75250.970.8434N/Ano
Q02585UCRIB_TOBAC1, ., 1, 0, ., 9, ., 10.71850.9450.8289N/Ano
O49078UCRIA_FRIAG1, ., 1, 0, ., 9, ., 10.70910.980.8521N/Ano
Q31NV7UCRI_SYNE71, ., 1, 0, ., 9, ., 10.61420.70.7821yesno
A2C0R9UCRI_PROM11, ., 1, 0, ., 9, ., 10.59020.720.8089yesno
B8HNR1UCRI_CYAP41, ., 1, 0, ., 9, ., 10.63500.6850.7653yesno
B2J3K2UCRI_NOSP71, ., 1, 0, ., 9, ., 10.61310.6850.7653yesno
A8G3H7UCRI_PROM21, ., 1, 0, ., 9, ., 10.56250.720.8089yesno
Q46GW1UCRI_PROMT1, ., 1, 0, ., 9, ., 10.59020.720.8089yesno
A2BPU5UCRI_PROMS1, ., 1, 0, ., 9, ., 10.56250.720.8089yesno
Q2JL39UCRI_SYNJB1, ., 1, 0, ., 9, ., 10.52550.680.7906yesno
A2C7F6UCRI_PROM31, ., 1, 0, ., 9, ., 10.59720.720.8089yesno
Q114L6UCRI_TRIEI1, ., 1, 0, ., 9, ., 10.63010.720.8044yesno
Q69GY7UCRIA_SOLTU1, ., 1, 0, ., 9, ., 10.72360.9550.8304N/Ano
Q7U566UCRI_SYNPX1, ., 1, 0, ., 9, ., 10.60410.720.8089yesno
Q5N5B0UCRI_SYNP61, ., 1, 0, ., 9, ., 10.61420.70.7821yesno
P08980UCRIA_SPIOL1, ., 1, 0, ., 9, ., 10.75510.9650.8391N/Ano
A5GRU8UCRI_SYNR31, ., 1, 0, ., 9, ., 10.59720.720.8089yesno
Q2JUP1UCRI_SYNJA1, ., 1, 0, ., 9, ., 10.51820.680.7906yesno
Q7X9A6UCRIA_WHEAT1, ., 1, 0, ., 9, ., 10.64280.9450.8513N/Ano
Q31C72UCRI_PROM91, ., 1, 0, ., 9, ., 10.55550.720.8089yesno
Q9L3P9UCRIA_ANAVT1, ., 1, 0, ., 9, ., 10.63970.680.7597yesno
A5GMW1UCRI_SYNPW1, ., 1, 0, ., 9, ., 10.61110.720.8089yesno
P0C8N7UCRI_SYNEL1, ., 1, 0, ., 9, ., 10.61310.6850.7611yesno
Q7VDC0UCRI_PROMA1, ., 1, 0, ., 9, ., 10.59570.70.7865yesno
P0C8N8UCRI_THEEB1, ., 1, 0, ., 9, ., 10.61310.6850.7611yesno
Q3ALY0UCRI_SYNSC1, ., 1, 0, ., 9, ., 10.59720.720.8089yesno
A2BVC4UCRI_PROM51, ., 1, 0, ., 9, ., 10.54860.720.8089yesno
Q0I872UCRI_SYNS31, ., 1, 0, ., 9, ., 10.60410.720.8089yesno
B0JXB7UCRI_MICAN1, ., 1, 0, ., 9, ., 10.65690.6850.7653yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer1.10.99.10.991
3rd Layer1.10.990.976

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query200
PRK13474178 PRK13474, PRK13474, cytochrome b6-f complex iron-s 2e-80
cd03471126 cd03471, Rieske_cytochrome_b6f, Iron-sulfur protei 4e-66
COG0723177 COG0723, QcrA, Rieske Fe-S protein [Energy product 7e-29
cd0347791 cd03477, Rieske_YhfW_C, YhfW family, C-terminal Ri 4e-16
cd03470126 cd03470, Rieske_cytochrome_bc1, Iron-sulfur protei 5e-15
pfam0035599 pfam00355, Rieske, Rieske [2Fe-2S] domain 6e-15
cd0346798 cd03467, Rieske, Rieske domain; a [2Fe-2S] cluster 1e-13
pfam0880236 pfam08802, CytB6-F_Fe-S, Cytochrome B6-F complex F 2e-13
TIGR01416174 TIGR01416, Rieske_proteo, ubiquinol-cytochrome c r 7e-12
cd03476126 cd03476, Rieske_ArOX_small, Small subunit of Arsen 3e-06
TIGR02694129 TIGR02694, arsenite_ox_S, arsenite oxidase, small 1e-04
cd03475171 cd03475, Rieske_SoxF_SoxL, SoxF and SoxL family, R 0.002
COG2146106 COG2146, {NirD}, Ferredoxin subunits of nitrite re 0.002
cd03469118 cd03469, Rieske_RO_Alpha_N, Rieske non-heme iron o 0.003
>gnl|CDD|237392 PRK13474, PRK13474, cytochrome b6-f complex iron-sulfur subunit; Provisional Back     alignment and domain information
 Score =  237 bits (606), Expect = 2e-80
 Identities = 96/143 (67%), Positives = 109/143 (76%), Gaps = 1/143 (0%)

Query: 54  SIPADRVPDMGKRQLMNLLLLGAVSLPTGFMLVPYATFFAPPGLGSAGGGTTAKDAIGND 113
           S  +D VP MG+RQ MNLL  G V+      L P   +F PP  G AGGGTTAKD +GND
Sbjct: 4   SGSSD-VPSMGRRQFMNLLTFGTVTGVALGALYPVVKYFIPPSAGGAGGGTTAKDELGND 62

Query: 114 IIAADWLNTHGPGDRTLTEGLKGDPTYLVVEKDKTLASYGINAVCTHLGCVVPWNSAENK 173
           I A+ +L TH  GDR+L +GLKGDPTYLVVE+D T+ASYGINAVCTHLGCVVPWNS ENK
Sbjct: 63  IPASQFLATHPAGDRSLVQGLKGDPTYLVVEEDGTIASYGINAVCTHLGCVVPWNSGENK 122

Query: 174 FICPCHGSQYNNQGRVVRGPAPL 196
           F CPCHGSQY+  G+VVRGPAPL
Sbjct: 123 FQCPCHGSQYDATGKVVRGPAPL 145


Length = 178

>gnl|CDD|239553 cd03471, Rieske_cytochrome_b6f, Iron-sulfur protein (ISP) component of the b6f complex family, Rieske domain; The Rieske domain is a [2Fe-2S] cluster binding domain involved in electron transfer Back     alignment and domain information
>gnl|CDD|223795 COG0723, QcrA, Rieske Fe-S protein [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|239559 cd03477, Rieske_YhfW_C, YhfW family, C-terminal Rieske domain; YhfW is a protein of unknown function with an N-terminal DadA-like (glycine/D-amino acid dehydrogenase) domain and a C-terminal Rieske domain Back     alignment and domain information
>gnl|CDD|239552 cd03470, Rieske_cytochrome_bc1, Iron-sulfur protein (ISP) component of the bc(1) complex family, Rieske domain; The Rieske domain is a [2Fe-2S] cluster binding domain involved in electron transfer Back     alignment and domain information
>gnl|CDD|215875 pfam00355, Rieske, Rieske [2Fe-2S] domain Back     alignment and domain information
>gnl|CDD|239550 cd03467, Rieske, Rieske domain; a [2Fe-2S] cluster binding domain commonly found in Rieske non-heme iron oxygenase (RO) systems such as naphthalene and biphenyl dioxygenases, as well as in plant/cyanobacterial chloroplast b6f and mitochondrial cytochrome bc(1) complexes Back     alignment and domain information
>gnl|CDD|220024 pfam08802, CytB6-F_Fe-S, Cytochrome B6-F complex Fe-S subunit Back     alignment and domain information
>gnl|CDD|233404 TIGR01416, Rieske_proteo, ubiquinol-cytochrome c reductase, iron-sulfur subunit Back     alignment and domain information
>gnl|CDD|239558 cd03476, Rieske_ArOX_small, Small subunit of Arsenite oxidase (ArOX) family, Rieske domain; ArOX is a molybdenum/iron protein involved in the detoxification of arsenic, oxidizing it to arsenate Back     alignment and domain information
>gnl|CDD|131741 TIGR02694, arsenite_ox_S, arsenite oxidase, small subunit Back     alignment and domain information
>gnl|CDD|239557 cd03475, Rieske_SoxF_SoxL, SoxF and SoxL family, Rieske domain; The Rieske domain is a [2Fe-2S] cluster binding domain involved in electron transfer Back     alignment and domain information
>gnl|CDD|225057 COG2146, {NirD}, Ferredoxin subunits of nitrite reductase and ring-hydroxylating dioxygenases [Inorganic ion transport and metabolism / General function prediction only] Back     alignment and domain information
>gnl|CDD|239551 cd03469, Rieske_RO_Alpha_N, Rieske non-heme iron oxygenase (RO) family, N-terminal Rieske domain of the oxygenase alpha subunit; The RO family comprise a large class of aromatic ring-hydroxylating dioxygenases found predominantly in microorganisms Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 200
PRK13474178 cytochrome b6-f complex iron-sulfur subunit; Provi 100.0
KOG1671210 consensus Ubiquinol cytochrome c reductase, subuni 99.95
TIGR01416174 Rieske_proteo ubiquinol-cytochrome c reductase, ir 99.93
TIGR03171321 soxL2 Rieske iron-sulfur protein SoxL2. This iron- 99.93
COG0723177 QcrA Rieske Fe-S protein [Energy production and co 99.92
cd03471126 Rieske_cytochrome_b6f Iron-sulfur protein (ISP) co 99.88
cd03470126 Rieske_cytochrome_bc1 Iron-sulfur protein (ISP) co 99.78
cd0347791 Rieske_YhfW_C YhfW family, C-terminal Rieske domai 99.7
PF0035597 Rieske: Rieske [2Fe-2S] domain; InterPro: IPR01794 99.65
cd03476126 Rieske_ArOX_small Small subunit of Arsenite oxidas 99.64
cd0347895 Rieske_AIFL_N AIFL (apoptosis-inducing factor like 99.63
cd0352898 Rieske_RO_ferredoxin Rieske non-heme iron oxygenas 99.61
TIGR02694129 arsenite_ox_S arsenite oxidase, small subunit. Thi 99.6
TIGR02377101 MocE_fam_FeS Rieske [2Fe-2S] domain protein, MocE 99.57
cd0346798 Rieske Rieske domain; a [2Fe-2S] cluster binding d 99.57
cd0353098 Rieske_NirD_small_Bacillus Small subunit of nitrit 99.55
cd03469118 Rieske_RO_Alpha_N Rieske non-heme iron oxygenase ( 99.55
cd03475171 Rieske_SoxF_SoxL SoxF and SoxL family, Rieske doma 99.54
cd03472128 Rieske_RO_Alpha_BPDO_like Rieske non-heme iron oxy 99.51
cd03474108 Rieske_T4moC Toluene-4-monooxygenase effector prot 99.49
PRK09965106 3-phenylpropionate dioxygenase ferredoxin subunit; 99.48
cd03541118 Rieske_RO_Alpha_CMO Rieske non-heme iron oxygenase 99.48
cd03479144 Rieske_RO_Alpha_PhDO_like Rieske non-heme iron oxy 99.45
cd03532116 Rieske_RO_Alpha_VanA_DdmC Rieske non-heme iron oxy 99.45
cd04337129 Rieske_RO_Alpha_Cao Cao (chlorophyll a oxygenase) 99.45
cd03531115 Rieske_RO_Alpha_KSH The alignment model represents 99.44
cd03535123 Rieske_RO_Alpha_NDO Rieske non-heme iron oxygenase 99.43
cd03536123 Rieske_RO_Alpha_DTDO This alignment model represen 99.43
cd04338134 Rieske_RO_Alpha_Tic55 Tic55 is a 55kDa LLS1-relate 99.4
cd03542123 Rieske_RO_Alpha_HBDO Rieske non-heme iron oxygenas 99.39
cd03538146 Rieske_RO_Alpha_AntDO Rieske non-heme iron oxygena 99.38
cd03545150 Rieske_RO_Alpha_OHBDO_like Rieske non-heme iron ox 99.36
COG2146106 {NirD} Ferredoxin subunits of nitrite reductase an 99.35
cd03537123 Rieske_RO_Alpha_PrnD This alignment model represen 99.33
cd03473107 Rieske_CMP_Neu5Ac_hydrolase_N Cytidine monophospha 99.33
cd03480138 Rieske_RO_Alpha_PaO Rieske non-heme iron oxygenase 99.33
cd03529103 Rieske_NirD Assimilatory nitrite reductase (NirD) 99.32
cd03539129 Rieske_RO_Alpha_S5H This alignment model represent 99.31
TIGR02378105 nirD_assim_sml nitrite reductase [NAD(P)H], small 99.3
cd03548136 Rieske_RO_Alpha_OMO_CARDO Rieske non-heme iron oxy 99.25
PRK09511108 nirD nitrite reductase small subunit; Provisional 99.21
PF0880239 CytB6-F_Fe-S: Cytochrome B6-F complex Fe-S subunit 99.2
PLN00095 394 chlorophyllide a oxygenase; Provisional 99.11
PLN02281 536 chlorophyllide a oxygenase 99.09
TIGR03229 433 benzo_1_2_benA benzoate 1,2-dioxygenase, large sub 99.06
TIGR03228 438 anthran_1_2_A anthranilate 1,2-dioxygenase, large 98.98
PF13806104 Rieske_2: Rieske-like [2Fe-2S] domain; PDB: 2JO6_A 98.95
PLN02518 539 pheophorbide a oxygenase 98.91
COG4638 367 HcaE Phenylpropionate dioxygenase and related ring 98.84
PF1039941 UCR_Fe-S_N: Ubiquitinol-cytochrome C reductase Fe- 98.47
TIGR0281166 formate_TAT formate dehydrogenase region TAT targe 95.93
PF1051826 TAT_signal: TAT (twin-arginine translocation) path 95.66
TIGR0140929 TAT_signal_seq Tat (twin-arginine translocation) p 93.78
PRK09898208 hypothetical protein; Provisional 86.64
>PRK13474 cytochrome b6-f complex iron-sulfur subunit; Provisional Back     alignment and domain information
Probab=100.00  E-value=1.2e-34  Score=240.74  Aligned_cols=145  Identities=65%  Similarity=1.110  Sum_probs=129.4

Q ss_pred             CCCCCCCcchHHHHHHHHHHHhHHHHHHhhccceeccCCCCCCCCCCCceeecCCCCceeeecccccCCCCCcccccccC
Q 028988           56 PADRVPDMGKRQLMNLLLLGAVSLPTGFMLVPYATFFAPPGLGSAGGGTTAKDAIGNDIIAADWLNTHGPGDRTLTEGLK  135 (200)
Q Consensus        56 ~~~~~pd~~RR~FL~~~~~G~~al~~~~~~~P~~~~l~Pp~~~~~~~~~v~vd~~g~~i~~~~W~~~~~P~~~~~~~~~~  135 (200)
                      ..+++||++||+||+.+++++++++++++++|+++|+.||....+.++.+.+|.+|++|..++|+.++.++++.+.+...
T Consensus         5 ~~~~~~d~~RR~FL~~~~~~~gg~~a~~~~~P~v~~~~Pp~~~~~~g~~~a~d~~G~~I~~s~~~~~~~~g~~~~v~~~~   84 (178)
T PRK13474          5 GSSDVPSMGRRQFMNLLTFGTVTGVALGALYPVVKYFIPPSAGGAGGGTTAKDELGNDIPASQFLATHPAGDRSLVQGLK   84 (178)
T ss_pred             ccCCCCCccHHHHHHHHHHHHHHHHHHHHHHHhhheeCChhHccCCCcceeecccCCeeehhhccccCCCCCcEEEEEcC
Confidence            45789999999999999999999999999999999999998877777788899999999999998887777766655667


Q ss_pred             CCCeEEEEecCCceeEEEEeccCCCCCccCCCCCCCCeEEcCCCCeeeCCCCeeccCCCCCCCCC
Q 028988          136 GDPTYLVVEKDKTLASYGINAVCTHLGCVVPWNSAENKFICPCHGSQYNNQGRVVRGPAPLVSNT  200 (200)
Q Consensus       136 g~p~~lv~~~~g~~~~~A~s~vCTHlGC~l~~~~~~~~~~CPcHGS~Fd~~G~v~~GPAp~pL~~  200 (200)
                      +++.+++++.++++.+||++++|||+||++.|+..++.|.||||||+||.+|+++.||++++|++
T Consensus        85 g~~~~lv~~~~g~~~~~a~~~~CtH~gc~l~~~~~~~~~~CP~Hgs~Fd~tG~~~~gPa~~~L~~  149 (178)
T PRK13474         85 GDPTYLVVEEDGTIASYGINAVCTHLGCVVPWNSGENKFQCPCHGSQYDATGKVVRGPAPLSLAL  149 (178)
T ss_pred             CCeEEEEEeCCCEEEEEEecCCCCCCCCccccccCCCEEEecCcCCEECCCCCCccCCCCCCCCe
Confidence            88888888888998778999999999999999877789999999999999999999999999974



>KOG1671 consensus Ubiquinol cytochrome c reductase, subunit RIP1 [Energy production and conversion] Back     alignment and domain information
>TIGR01416 Rieske_proteo ubiquinol-cytochrome c reductase, iron-sulfur subunit Back     alignment and domain information
>TIGR03171 soxL2 Rieske iron-sulfur protein SoxL2 Back     alignment and domain information
>COG0723 QcrA Rieske Fe-S protein [Energy production and conversion] Back     alignment and domain information
>cd03471 Rieske_cytochrome_b6f Iron-sulfur protein (ISP) component of the b6f complex family, Rieske domain; The Rieske domain is a [2Fe-2S] cluster binding domain involved in electron transfer Back     alignment and domain information
>cd03470 Rieske_cytochrome_bc1 Iron-sulfur protein (ISP) component of the bc(1) complex family, Rieske domain; The Rieske domain is a [2Fe-2S] cluster binding domain involved in electron transfer Back     alignment and domain information
>cd03477 Rieske_YhfW_C YhfW family, C-terminal Rieske domain; YhfW is a protein of unknown function with an N-terminal DadA-like (glycine/D-amino acid dehydrogenase) domain and a C-terminal Rieske domain Back     alignment and domain information
>PF00355 Rieske: Rieske [2Fe-2S] domain; InterPro: IPR017941 There are multiple types of iron-sulphur clusters which are grouped into three main categories based on their atomic content: [2Fe-2S], [3Fe-4S], [4Fe-4S] (see PDOC00176 from PROSITEDOC), and other hybrid or mixed metal types Back     alignment and domain information
>cd03476 Rieske_ArOX_small Small subunit of Arsenite oxidase (ArOX) family, Rieske domain; ArOX is a molybdenum/iron protein involved in the detoxification of arsenic, oxidizing it to arsenate Back     alignment and domain information
>cd03478 Rieske_AIFL_N AIFL (apoptosis-inducing factor like) family, N-terminal Rieske domain; members of this family show similarity to human AIFL, containing an N-terminal Rieske domain and a C-terminal pyridine nucleotide-disulfide oxidoreductase domain (Pyr_redox) Back     alignment and domain information
>cd03528 Rieske_RO_ferredoxin Rieske non-heme iron oxygenase (RO) family, Rieske ferredoxin component; composed of the Rieske ferredoxin component of some three-component RO systems including biphenyl dioxygenase (BPDO) and carbazole 1,9a-dioxygenase (CARDO) Back     alignment and domain information
>TIGR02694 arsenite_ox_S arsenite oxidase, small subunit Back     alignment and domain information
>TIGR02377 MocE_fam_FeS Rieske [2Fe-2S] domain protein, MocE subfamily Back     alignment and domain information
>cd03467 Rieske Rieske domain; a [2Fe-2S] cluster binding domain commonly found in Rieske non-heme iron oxygenase (RO) systems such as naphthalene and biphenyl dioxygenases, as well as in plant/cyanobacterial chloroplast b6f and mitochondrial cytochrome bc(1) complexes Back     alignment and domain information
>cd03530 Rieske_NirD_small_Bacillus Small subunit of nitrite reductase (NirD) family, Rieske domain; composed of proteins similar to the Bacillus subtilis small subunit of assimilatory nitrite reductase containing a Rieske domain Back     alignment and domain information
>cd03469 Rieske_RO_Alpha_N Rieske non-heme iron oxygenase (RO) family, N-terminal Rieske domain of the oxygenase alpha subunit; The RO family comprise a large class of aromatic ring-hydroxylating dioxygenases found predominantly in microorganisms Back     alignment and domain information
>cd03475 Rieske_SoxF_SoxL SoxF and SoxL family, Rieske domain; The Rieske domain is a [2Fe-2S] cluster binding domain involved in electron transfer Back     alignment and domain information
>cd03472 Rieske_RO_Alpha_BPDO_like Rieske non-heme iron oxygenase (RO) family, Biphenyl dioxygenase (BPDO)-like subfamily, N-terminal Rieske domain of the oxygenase alpha subunit; composed of the oxygenase alpha subunits of BPDO and similar proteins including cumene dioxygenase (CumDO), nitrobenzene dioxygenase (NBDO), alkylbenzene dioxygenase (AkbDO) and dibenzofuran 4,4a-dioxygenase (DFDO) Back     alignment and domain information
>cd03474 Rieske_T4moC Toluene-4-monooxygenase effector protein complex (T4mo), Rieske ferredoxin subunit; The Rieske domain is a [2Fe-2S] cluster binding domain involved in electron transfer Back     alignment and domain information
>PRK09965 3-phenylpropionate dioxygenase ferredoxin subunit; Provisional Back     alignment and domain information
>cd03541 Rieske_RO_Alpha_CMO Rieske non-heme iron oxygenase (RO) family, Choline monooxygenase (CMO) subfamily, N-terminal Rieske domain of the oxygenase alpha subunit; ROs comprise a large class of aromatic ring-hydroxylating dioxygenases that enable microorganisms to tolerate and utilize aromatic compounds for growth Back     alignment and domain information
>cd03479 Rieske_RO_Alpha_PhDO_like Rieske non-heme iron oxygenase (RO) family, Phthalate 4,5-dioxygenase (PhDO)-like subfamily, N-terminal Rieske domain of the oxygenase alpha subunit; composed of the oxygenase alpha subunits of PhDO and similar proteins including 3-chlorobenzoate 3,4-dioxygenase (CBDO), phenoxybenzoate dioxygenase (POB-dioxygenase) and 3-nitrobenzoate oxygenase (MnbA) Back     alignment and domain information
>cd03532 Rieske_RO_Alpha_VanA_DdmC Rieske non-heme iron oxygenase (RO) family, Vanillate-O-demethylase oxygenase (VanA) and dicamba O-demethylase oxygenase (DdmC) subfamily, N-terminal Rieske domain of the oxygenase alpha subunit; ROs comprise a large class of aromatic ring-hydroxylating dioxygenases that enable microorganisms to tolerate and utilize aromatic compounds for growth Back     alignment and domain information
>cd04337 Rieske_RO_Alpha_Cao Cao (chlorophyll a oxygenase) is a rieske non-heme iron-sulfur protein located within the plastid-envelope inner and thylakoid membranes, that catalyzes the conversion of chlorophyllide a to chlorophyllide b Back     alignment and domain information
>cd03531 Rieske_RO_Alpha_KSH The alignment model represents the N-terminal rieske iron-sulfur domain of KshA, the oxygenase component of 3-ketosteroid 9-alpha-hydroxylase (KSH) Back     alignment and domain information
>cd03535 Rieske_RO_Alpha_NDO Rieske non-heme iron oxygenase (RO) family, Nathphalene 1,2-dioxygenase (NDO) subfamily, N-terminal Rieske domain of the oxygenase alpha subunit; ROs comprise a large class of aromatic ring-hydroxylating dioxygenases that enable microorganisms to tolerate and utilize aromatic compounds for growth Back     alignment and domain information
>cd03536 Rieske_RO_Alpha_DTDO This alignment model represents the N-terminal rieske domain of the oxygenase alpha subunit (DitA) of diterpenoid dioxygenase (DTDO) Back     alignment and domain information
>cd04338 Rieske_RO_Alpha_Tic55 Tic55 is a 55kDa LLS1-related non-heme iron oxygenase associated with protein transport through the plant inner chloroplast membrane Back     alignment and domain information
>cd03542 Rieske_RO_Alpha_HBDO Rieske non-heme iron oxygenase (RO) family, 2-Halobenzoate 1,2-dioxygenase (HBDO) subfamily, N-terminal Rieske domain of the oxygenase alpha subunit; ROs comprise a large class of aromatic ring-hydroxylating dioxygenases that enable microorganisms to tolerate and utilize aromatic compounds for growth Back     alignment and domain information
>cd03538 Rieske_RO_Alpha_AntDO Rieske non-heme iron oxygenase (RO) family, Anthranilate 1,2-dioxygenase (AntDO) subfamily, N-terminal Rieske domain of the oxygenase alpha subunit; ROs comprise a large class of aromatic ring-hydroxylating dioxygenases that enable microorganisms to tolerate and utilize aromatic compounds for growth Back     alignment and domain information
>cd03545 Rieske_RO_Alpha_OHBDO_like Rieske non-heme iron oxygenase (RO) family, Ortho-halobenzoate-1,2-dioxygenase (OHBDO)-like subfamily, N-terminal Rieske domain of the oxygenase alpha subunit; composed of the oxygenase alpha subunits of OHBDO, salicylate 5-hydroxylase (S5H), terephthalate 1,2-dioxygenase system (TERDOS) and similar proteins Back     alignment and domain information
>COG2146 {NirD} Ferredoxin subunits of nitrite reductase and ring-hydroxylating dioxygenases [Inorganic ion transport and metabolism / General function prediction only] Back     alignment and domain information
>cd03537 Rieske_RO_Alpha_PrnD This alignment model represents the N-terminal rieske domain of the oxygenase alpha subunit of aminopyrrolnitrin oxygenase (PrnD) Back     alignment and domain information
>cd03473 Rieske_CMP_Neu5Ac_hydrolase_N Cytidine monophosphate-N-acetylneuraminic acid (CMP Neu5Ac) hydroxylase family, N-terminal Rieske domain; The Rieske domain is a [2Fe-2S] cluster binding domain involved in electron transfer Back     alignment and domain information
>cd03480 Rieske_RO_Alpha_PaO Rieske non-heme iron oxygenase (RO) family, Pheophorbide a oxygenase (PaO) subfamily, N-terminal Rieske domain of the oxygenase alpha subunit; composed of the oxygenase alpha subunits of a small subfamily of enzymes found in plants as well as oxygenic cyanobacterial photosynthesizers including LLS1 (lethal leaf spot 1, also known as PaO) and ACD1 (accelerated cell death 1) Back     alignment and domain information
>cd03529 Rieske_NirD Assimilatory nitrite reductase (NirD) family, Rieske domain; Assimilatory nitrate and nitrite reductases convert nitrate through nitrite to ammonium Back     alignment and domain information
>cd03539 Rieske_RO_Alpha_S5H This alignment model represents the N-terminal rieske iron-sulfur domain of the oxygenase alpha subunit (NagG) of salicylate 5-hydroxylase (S5H) Back     alignment and domain information
>TIGR02378 nirD_assim_sml nitrite reductase [NAD(P)H], small subunit Back     alignment and domain information
>cd03548 Rieske_RO_Alpha_OMO_CARDO Rieske non-heme iron oxygenase (RO) family, 2-Oxoquinoline 8-monooxygenase (OMO) and Carbazole 1,9a-dioxygenase (CARDO) subfamily, N-terminal Rieske domain of the oxygenase alpha subunit; ROs comprise a large class of aromatic ring-hydroxylating dioxygenases that enable microorganisms to tolerate and utilize aromatic compounds for growth Back     alignment and domain information
>PRK09511 nirD nitrite reductase small subunit; Provisional Back     alignment and domain information
>PF08802 CytB6-F_Fe-S: Cytochrome B6-F complex Fe-S subunit ; InterPro: IPR014909 The cytochrome b6-f complex mediates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions Back     alignment and domain information
>PLN00095 chlorophyllide a oxygenase; Provisional Back     alignment and domain information
>PLN02281 chlorophyllide a oxygenase Back     alignment and domain information
>TIGR03229 benzo_1_2_benA benzoate 1,2-dioxygenase, large subunit Back     alignment and domain information
>TIGR03228 anthran_1_2_A anthranilate 1,2-dioxygenase, large subunit Back     alignment and domain information
>PF13806 Rieske_2: Rieske-like [2Fe-2S] domain; PDB: 2JO6_A 3C0D_A 3D89_A 2JZA_A Back     alignment and domain information
>PLN02518 pheophorbide a oxygenase Back     alignment and domain information
>COG4638 HcaE Phenylpropionate dioxygenase and related ring-hydroxylating dioxygenases, large terminal subunit [Inorganic ion transport and metabolism / General function prediction only] Back     alignment and domain information
>PF10399 UCR_Fe-S_N: Ubiquitinol-cytochrome C reductase Fe-S subunit TAT signal; InterPro: IPR019470 This entry represents the TAT-signal region found in the iron-sulphur subunit of Ubiquinol-cytochrome C reductase (also known as the cytochrome bc1 complex) Back     alignment and domain information
>TIGR02811 formate_TAT formate dehydrogenase region TAT target Back     alignment and domain information
>PF10518 TAT_signal: TAT (twin-arginine translocation) pathway signal sequence; InterPro: IPR019546 The twin-arginine translocation (Tat) pathway serves the role of transporting folded proteins across energy-transducing membranes [] Back     alignment and domain information
>TIGR01409 TAT_signal_seq Tat (twin-arginine translocation) pathway signal sequence Back     alignment and domain information
>PRK09898 hypothetical protein; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query200
1rfs_A139 Rieske Soluble Fragment From Spinach Length = 139 3e-46
2zt9_D179 Crystal Structure Of The Cytochrome B6f Complex Fro 4e-44
1vf5_D179 Crystal Structure Of Cytochrome B6f Complex From M. 9e-44
2e74_D179 Crystal Structure Of The Cytochrome B6f Complex Fro 2e-43
1q90_C127 Structure Of The Cytochrome B6f (Plastohydroquinone 5e-38
3azc_A133 Crystal Structure Of The Soluble Part Of Cytochrome 9e-37
1bcc_E196 Cytochrome Bc1 Complex From Chicken Length = 196 7e-08
1qcr_E196 Crystal Structure Of Bovine Mitochondrial Cytochrom 8e-08
3cwb_E196 Chicken Cytochrome Bc1 Complex Inhibited By An Iodi 1e-07
1rie_A129 Structure Of A Water Soluble Fragment Of The Rieske 2e-07
2yiu_C190 X-Ray Structure Of The Dimeric Cytochrome Bc1 Compl 3e-07
1zrt_E191 Rhodobacter Capsulatus Cytochrome Bc1 Complex With 5e-07
2nuk_A141 Soluble Domain Of The Rieske Iron-Sulfur Protein Fr 6e-07
1ezv_E185 Structure Of The Yeast Cytochrome Bc1 Complex Co- C 6e-07
2qjp_C179 Crystal Structure Of Wild Type Rhodobacter Sphaeroi 7e-07
2nve_A141 Soluble Domain Of Rieske Iron Sulfur Protein Length 1e-06
2nvg_A141 Soluble Domain Of Rieske Iron Sulfur Protein Length 1e-06
2num_A141 Soluble Domain Of Rieske Iron-Sulfur Protein Length 1e-06
2nwf_A141 Soluble Domain Of Rieske Iron Sulfur Protein Length 2e-06
2nvf_A141 Soluble Domain Of Rieske Iron-Sulfur Protein Length 3e-06
2fyn_C187 Crystal Structure Analysis Of The Double Mutant Rho 3e-06
2qjk_C179 Crystal Structure Analysis Of Mutant Rhodobacter Sp 3e-06
3fou_A156 Low Ph Structure Of The Rieske Protein From Thermus 5e-05
1nyk_A165 Crystal Structure Of The Rieske Protein From Thermu 6e-05
1q90_R49 Structure Of The Cytochrome B6f (Plastohydroquinone 3e-04
1g8k_B133 Crystal Structure Analysis Of Arsenite Oxidase From 3e-04
1g8j_B133 Crystal Structure Analysis Of Arsenite Oxidase From 3e-04
>pdb|1RFS|A Chain A, Rieske Soluble Fragment From Spinach Length = 139 Back     alignment and structure

Iteration: 1

Score = 181 bits (459), Expect = 3e-46, Method: Compositional matrix adjust. Identities = 88/105 (83%), Positives = 97/105 (92%) Query: 92 FAPPGLGSAGGGTTAKDAIGNDIIAADWLNTHGPGDRTLTEGLKGDPTYLVVEKDKTLAS 151 F PPG G+ GGT AKDA+GND+IAA+WL TH PGDRTLT+GLKGDPTYLVVE DKTLA+ Sbjct: 1 FVPPGGGAGTGGTIAKDALGNDVIAAEWLKTHAPGDRTLTQGLKGDPTYLVVESDKTLAT 60 Query: 152 YGINAVCTHLGCVVPWNSAENKFICPCHGSQYNNQGRVVRGPAPL 196 +GINAVCTHLGCVVP+N+AENKFICPCHGSQYNNQGRVVRGPAPL Sbjct: 61 FGINAVCTHLGCVVPFNAAENKFICPCHGSQYNNQGRVVRGPAPL 105
>pdb|2ZT9|D Chain D, Crystal Structure Of The Cytochrome B6f Complex From Nostoc Sp. Pcc 7120 Length = 179 Back     alignment and structure
>pdb|1VF5|D Chain D, Crystal Structure Of Cytochrome B6f Complex From M.Laminosus Length = 179 Back     alignment and structure
>pdb|2E74|D Chain D, Crystal Structure Of The Cytochrome B6f Complex From M.Laminosus Length = 179 Back     alignment and structure
>pdb|1Q90|C Chain C, Structure Of The Cytochrome B6f (Plastohydroquinone : Plastocyanin Oxidoreductase) From Chlamydomonas Reinhardtii Length = 127 Back     alignment and structure
>pdb|3AZC|A Chain A, Crystal Structure Of The Soluble Part Of Cytochrome B6f Complex Iron- Sulfur Subunit From Thermosynechococcus Elongatus Bp-1 Length = 133 Back     alignment and structure
>pdb|1BCC|E Chain E, Cytochrome Bc1 Complex From Chicken Length = 196 Back     alignment and structure
>pdb|1QCR|E Chain E, Crystal Structure Of Bovine Mitochondrial Cytochrome Bc1 Complex, Alpha Carbon Atoms Only Length = 196 Back     alignment and structure
>pdb|3CWB|E Chain E, Chicken Cytochrome Bc1 Complex Inhibited By An Iodinated Analogue Of The Polyketide Crocacin-d Length = 196 Back     alignment and structure
>pdb|1RIE|A Chain A, Structure Of A Water Soluble Fragment Of The Rieske Iron- Sulfur Protein Of The Bovine Heart Mitochondrial Cytochrome Bc1-complex Length = 129 Back     alignment and structure
>pdb|2YIU|C Chain C, X-Ray Structure Of The Dimeric Cytochrome Bc1 Complex From The Soil Bacterium Paracoccus Denitrificans At 2.7 Angstrom Resolution Length = 190 Back     alignment and structure
>pdb|1ZRT|E Chain E, Rhodobacter Capsulatus Cytochrome Bc1 Complex With Stigmatellin Bound Length = 191 Back     alignment and structure
>pdb|2NUK|A Chain A, Soluble Domain Of The Rieske Iron-Sulfur Protein From Rhodobacter Sphaeroides Length = 141 Back     alignment and structure
>pdb|1EZV|E Chain E, Structure Of The Yeast Cytochrome Bc1 Complex Co- Crystallized With An Antibody Fv-Fragment Length = 185 Back     alignment and structure
>pdb|2QJP|C Chain C, Crystal Structure Of Wild Type Rhodobacter Sphaeroides With Stigmatellin And Antimycin Inhibited Length = 179 Back     alignment and structure
>pdb|2NVE|A Chain A, Soluble Domain Of Rieske Iron Sulfur Protein Length = 141 Back     alignment and structure
>pdb|2NVG|A Chain A, Soluble Domain Of Rieske Iron Sulfur Protein Length = 141 Back     alignment and structure
>pdb|2NUM|A Chain A, Soluble Domain Of Rieske Iron-Sulfur Protein Length = 141 Back     alignment and structure
>pdb|2NWF|A Chain A, Soluble Domain Of Rieske Iron Sulfur Protein Length = 141 Back     alignment and structure
>pdb|2NVF|A Chain A, Soluble Domain Of Rieske Iron-Sulfur Protein Length = 141 Back     alignment and structure
>pdb|2FYN|C Chain C, Crystal Structure Analysis Of The Double Mutant Rhodobacter Sphaeroides Bc1 Complex Length = 187 Back     alignment and structure
>pdb|2QJK|C Chain C, Crystal Structure Analysis Of Mutant Rhodobacter Sphaeroides Bc1 With Stigmatellin And Antimycin Length = 179 Back     alignment and structure
>pdb|3FOU|A Chain A, Low Ph Structure Of The Rieske Protein From Thermus Thermophilus At 2.1 A Length = 156 Back     alignment and structure
>pdb|1NYK|A Chain A, Crystal Structure Of The Rieske Protein From Thermus Thermophilus Length = 165 Back     alignment and structure
>pdb|1Q90|R Chain R, Structure Of The Cytochrome B6f (Plastohydroquinone : Plastocyanin Oxidoreductase) From Chlamydomonas Reinhardtii Length = 49 Back     alignment and structure
>pdb|1G8K|B Chain B, Crystal Structure Analysis Of Arsenite Oxidase From Alcaligenes Faecalis Length = 133 Back     alignment and structure
>pdb|1G8J|B Chain B, Crystal Structure Analysis Of Arsenite Oxidase From Alcaligenes Faecalis Length = 133 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query200
1vf5_D179 Rieske iron-sulfur protein; photosynthesis, membra 5e-59
1rfs_A139 Rieske protein; iron-sulfur protein, electron tran 7e-55
3azc_A133 Cytochrome B6-F complex iron-sulfur subunit; riesk 1e-44
1g8k_B133 Arsenite oxidase; molybdopterin, [3Fe-4S] cluster, 4e-22
2nwf_A141 Ubiquinol-cytochrome C reductase iron-sulfur SUBU; 7e-22
1nyk_A165 Rieske iron-sulfur protein; beta barrel, iron sulf 5e-20
1jm1_A204 Rieske iron-sulfur protein SOXF; electron transpor 5e-19
2qjy_C187 Ubiquinol-cytochrome C reductase iron-sulfur SUBU; 9e-19
1pp9_E196 Ubiquinol-cytochrome C reductase iron-sulfur SUBU 1e-17
1q90_R49 Cytochrome B6-F complex iron-sulfur subunit; membr 3e-17
1rie_A129 Rieske iron-sulfur protein; oxidoreductase, cytoch 1e-13
3cx5_E185 Cytochrome B-C1 complex subunit rieske, mitochondr 5e-12
>1vf5_D Rieske iron-sulfur protein; photosynthesis, membrane protein complex, electron transfer complex; HET: HEM TDS PL9 OPC CLA BCR; 3.00A {Mastigocladus laminosus} SCOP: b.33.1.1 f.23.12.1 PDB: 2d2c_D* 2e74_D* 2e75_D* 2e76_D* 2zt9_D* Length = 179 Back     alignment and structure
 Score =  181 bits (462), Expect = 5e-59
 Identities = 86/145 (59%), Positives = 104/145 (71%)

Query: 52  ATSIPADRVPDMGKRQLMNLLLLGAVSLPTGFMLVPYATFFAPPGLGSAGGGTTAKDAIG 111
           A    +  VPDMG+RQ MNLL  G V+      L P   +F PP  G+ GGGTTAKD +G
Sbjct: 2   AQFTESMDVPDMGRRQFMNLLAFGTVTGVALGALYPLVKYFIPPSGGAVGGGTTAKDKLG 61

Query: 112 NDIIAADWLNTHGPGDRTLTEGLKGDPTYLVVEKDKTLASYGINAVCTHLGCVVPWNSAE 171
           N++  + +L +H  GDR L +GLKGDPTY+VVE  + +  YGINAVCTHLGCVVPWN+AE
Sbjct: 62  NNVKVSKFLESHNAGDRVLVQGLKGDPTYIVVESKEAIRDYGINAVCTHLGCVVPWNAAE 121

Query: 172 NKFICPCHGSQYNNQGRVVRGPAPL 196
           NKF CPCHGSQY+  GRV+RGPAPL
Sbjct: 122 NKFKCPCHGSQYDETGRVIRGPAPL 146


>1rfs_A Rieske protein; iron-sulfur protein, electron transport; 1.83A {Spinacia oleracea} SCOP: b.33.1.1 PDB: 1q90_C* Length = 139 Back     alignment and structure
>3azc_A Cytochrome B6-F complex iron-sulfur subunit; rieske, thermosynechococcus elongatu photosynthesis, electron transport; 2.00A {Thermosynechococcus elongatus} Length = 133 Back     alignment and structure
>1g8k_B Arsenite oxidase; molybdopterin, [3Fe-4S] cluster, [2Fe-2S] rieske, oxidoreductase; HET: MGD; 1.64A {Alcaligenes faecalis} SCOP: b.33.1.1 PDB: 1g8j_B* Length = 133 Back     alignment and structure
>2nwf_A Ubiquinol-cytochrome C reductase iron-sulfur SUBU; rieske [2Fe-2S] ISP, oxidoreductase; HET: GOL; 1.10A {Rhodobacter sphaeroides} PDB: 2nuk_A 2nve_A 2num_A 2nvg_A 2nvf_A Length = 141 Back     alignment and structure
>1nyk_A Rieske iron-sulfur protein; beta barrel, iron sulfur cluster, electron transport; 1.31A {Thermus thermophilus} SCOP: b.33.1.1 PDB: 3fou_A Length = 165 Back     alignment and structure
>1jm1_A Rieske iron-sulfur protein SOXF; electron transport, respiratory chain, oxidoreductase; 1.11A {Sulfolobus acidocaldarius} SCOP: b.33.1.1 Length = 204 Back     alignment and structure
>2qjy_C Ubiquinol-cytochrome C reductase iron-sulfur SUBU; cytochrome B, 8 TM helixces cytochrome C1, 1 C-TERM TM helix 1 N-TERM TM helix; HET: BGL HEM SMA LOP UQ2; 2.40A {Rhodobacter sphaeroides} PDB: 2fyn_C* 2qjk_C* 2qjp_C* 1zrt_E* 2yiu_C* Length = 187 Back     alignment and structure
>1pp9_E Ubiquinol-cytochrome C reductase iron-sulfur SUBU mitochondrial; cytochrome BC1, membrane protein, heme protein, rieske iron protein, cytochrome B, complex III; HET: BHG HEM HEC SMA UQ CDL PEE; 2.10A {Bos taurus} SCOP: b.33.1.1 f.23.12.1 PDB: 1bgy_E* 1be3_E* 1l0n_E* 1ntk_E* 1ntm_E* 1ntz_E* 1nu1_E* 1l0l_E* 1ppj_E* 1qcr_E* 1sqb_E* 1sqp_E* 1sqq_E* 1sqv_E* 1sqx_E* 2a06_E* 2fyu_E* 2ybb_E* 1bcc_E* 2bcc_E* ... Length = 196 Back     alignment and structure
>1q90_R Cytochrome B6-F complex iron-sulfur subunit; membrane protein complex, photosynthesis, electron transfer, oxydoreductase, chlorophyll; HET: HEM CL1 BCR TDS SQD LFA LMG; 3.10A {Chlamydomonas reinhardtii} SCOP: f.23.12.1 Length = 49 Back     alignment and structure
>1rie_A Rieske iron-sulfur protein; oxidoreductase, cytochrome BC1 complex, histidine ligands, rieske iron-sulfur cluster, electron transport; 1.50A {Bos taurus} SCOP: b.33.1.1 Length = 129 Back     alignment and structure
>3cx5_E Cytochrome B-C1 complex subunit rieske, mitochondrial; complex III, electron transfer complex, cytochrome BC1 complex, mitochondrialtransmembrane complex; HET: M3L SUC 6PH UMQ HEM SMA 8PE 9PE CN5 7PH CN3; 1.90A {Saccharomyces cerevisiae} SCOP: b.33.1.1 f.23.12.1 PDB: 1kb9_E* 1kyo_E* 1p84_E* 2ibz_E* 1ezv_E* 3cxh_E* Length = 185 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query200
1vf5_D179 Rieske iron-sulfur protein; photosynthesis, membra 100.0
2qjy_C187 Ubiquinol-cytochrome C reductase iron-sulfur SUBU; 99.94
3cx5_E185 Cytochrome B-C1 complex subunit rieske, mitochondr 99.93
1pp9_E196 Ubiquinol-cytochrome C reductase iron-sulfur SUBU 99.91
1rfs_A139 Rieske protein; iron-sulfur protein, electron tran 99.84
4aay_B175 AROB; oxidoreductase, rieske, iron sulfur, molybdo 99.81
2nwf_A141 Ubiquinol-cytochrome C reductase iron-sulfur SUBU; 99.74
3azc_A133 Cytochrome B6-F complex iron-sulfur subunit; riesk 99.59
1rie_A129 Rieske iron-sulfur protein; oxidoreductase, cytoch 99.72
1g8k_B133 Arsenite oxidase; molybdopterin, [3Fe-4S] cluster, 99.69
2qpz_A103 Naphthalene 1,2-dioxygenase system ferredoxin subu 99.67
3dqy_A106 Toluene 1,2-dioxygenase system ferredoxin subunit; 99.66
2i7f_A108 Ferredoxin component of dioxygenase; rieske ferred 99.65
3gce_A121 Ferredoxin component of carbazole 1,9A- dioxygenas 99.65
1fqt_A112 Rieske-type ferredoxin of biphenyl dioxygenase; 2F 99.65
1vm9_A111 Toluene-4-monooxygenase system protein C; structur 99.62
2de6_D115 Ferredoxin component of carbazole; electron transf 99.6
2jo6_A113 Nitrite reductase [NAD(P)H] small subunit; all bet 99.52
1jm1_A204 Rieske iron-sulfur protein SOXF; electron transpor 99.51
3c0d_A119 Putative nitrite reductase NADPH (small subunit) o 99.5
1nyk_A165 Rieske iron-sulfur protein; beta barrel, iron sulf 99.49
2jza_A130 Nitrite reductase [NAD(P)H] small subunit; ISP dom 99.47
4aiv_A119 Probable nitrite reductase [NAD(P)H] small subuni; 99.42
3d89_A157 Rieske domain-containing protein; CAsp target, rie 99.29
3gke_A 349 DDMC; rieske cluster, non-heme mononuclear iron, o 99.26
2zyl_A 386 Possible oxidoreductase; KSHA, cholesterol, rieske 99.26
2gbw_A 454 Biphenyl 2,3-dioxygenase alpha subunit; rieske oxy 99.19
2b1x_A 470 Naphthalene dioxygenase large subunit; rieske non- 99.19
1q90_R49 Cytochrome B6-F complex iron-sulfur subunit; membr 99.19
3gcf_A 394 Terminal oxygenase component of carbazole 1,9A- di 99.18
3n0q_A 409 Putative aromatic-ring hydroxylating dioxygenase; 99.18
1uli_A 460 Biphenyl dioxygenase large subunit; alpha3 BETA3 h 99.18
3gkq_A 389 Terminal oxygenase component of carbazole 1,9A- di 99.18
2de6_A 392 Terminal oxygenase component of carbazole; electro 99.17
2bmo_A 447 Oxygenase-alpha NBDO; nitrobenzene dioxygenase, ni 99.16
1z01_A 446 2-OXO-1,2-dihydroquinoline 8-monooxygenase, oxygen 99.15
3vca_A 412 Ring-hydroxylating dioxygenase; rieske-type, monon 99.15
3gzx_A 457 Biphenyl dioxygenase subunit alpha; rieskie, non-h 99.12
2pq4_B35 Periplasmic nitrate reductase precursor; NAPD/NAPA 94.16
>1vf5_D Rieske iron-sulfur protein; photosynthesis, membrane protein complex, electron transfer complex; HET: HEM TDS PL9 OPC CLA BCR; 3.00A {Mastigocladus laminosus} SCOP: b.33.1.1 f.23.12.1 PDB: 2d2c_D* 2e74_D* 2e75_D* 2e76_D* 2zt9_D* Back     alignment and structure
Probab=100.00  E-value=5.9e-35  Score=240.17  Aligned_cols=149  Identities=58%  Similarity=1.046  Sum_probs=119.7

Q ss_pred             cccCCCCCCCCcchHHHHHHHHHHHhHHHHHHhhccceeccCCCCCCCCCCCceeecCCCCceeeecccccCCCCCcccc
Q 028988           52 ATSIPADRVPDMGKRQLMNLLLLGAVSLPTGFMLVPYATFFAPPGLGSAGGGTTAKDAIGNDIIAADWLNTHGPGDRTLT  131 (200)
Q Consensus        52 ~~~~~~~~~pd~~RR~FL~~~~~G~~al~~~~~~~P~~~~l~Pp~~~~~~~~~v~vd~~g~~i~~~~W~~~~~P~~~~~~  131 (200)
                      +.+.+.++.|||+||+||+++++++++++++++++|+++++.|+.....+++.+.+|..|+++..++|+.+..+++....
T Consensus         2 ~~~~~~~~~~~~~RR~Fl~~~~~~~~~~~~~~~~~p~~~~~~p~~~~~~~~~~v~~d~~g~~i~~~~~~~~l~~g~~~~~   81 (179)
T 1vf5_D            2 AQFTESMDVPDMGRRQFMNLLAFGTVTGVALGALYPLVKYFIPPSGGAVGGGTTAKDKLGNNVKVSKFLESHNAGDRVLV   81 (179)
T ss_dssp             ----------CCCCCTTSCTTHHHHHHHHHHHHHHHHHHHHSCCCCSSCCCCCCCCBTTSSCCCHHHHHHCCCTTCCCEE
T ss_pred             CcccCCCCCCCCcHHHHHHHHHHHHHHHHHHHHHHHHHHHhCCchhhcccCCcEEEccCCCeEehhhcccccCCCceEEE
Confidence            34566778999999999999999999999999999999999999877666667888888998887777665555555444


Q ss_pred             cccCCCCeEEEEecCCceeEEEEeccCCCCCccCCCCCCCCeEEcCCCCeeeCCCCeeccCCCCCCCCC
Q 028988          132 EGLKGDPTYLVVEKDKTLASYGINAVCTHLGCVVPWNSAENKFICPCHGSQYNNQGRVVRGPAPLVSNT  200 (200)
Q Consensus       132 ~~~~g~p~~lv~~~~g~~~~~A~s~vCTHlGC~l~~~~~~~~~~CPcHGS~Fd~~G~v~~GPAp~pL~~  200 (200)
                      ....+++++++++.+|++.+||++++|||+||+|.|+.+++.|.||||||+||.+|+++.||++++|++
T Consensus        82 ~~~~g~~~~lv~~~~g~~~~~a~~~~CtH~G~~l~~~~~~~~~~CP~Hgs~Fd~~G~~~~gPa~~~L~~  150 (179)
T 1vf5_D           82 QGLKGDPTYIVVESKEAIRDYGINAVCTHLGCVVPWNAAENKFKCPCHGSQYDETGRVIRGPAPLSLAL  150 (179)
T ss_dssp             SCSSSSCEECCBCTTCCBCSCCCBCBCTTTSCBCCBCSSSSSEECTTTCCEECSSSCCCSSSCCSCCBC
T ss_pred             eccCCCeEEEEEECCCcEEEEEEeCccCCCCCCCcccCCCCEEECCCCCCEECCCCcEecCCCCCCCCe
Confidence            345678899988888887568999999999999999887889999999999999999999999999964



>2qjy_C Ubiquinol-cytochrome C reductase iron-sulfur SUBU; cytochrome B, 8 TM helixces cytochrome C1, 1 C-TERM TM helix 1 N-TERM TM helix; HET: BGL HEM SMA LOP UQ2; 2.40A {Rhodobacter sphaeroides} PDB: 2fyn_C* 2qjk_C* 2qjp_C* 1zrt_E* 2yiu_C* Back     alignment and structure
>3cx5_E Cytochrome B-C1 complex subunit rieske, mitochondrial; complex III, electron transfer complex, cytochrome BC1 complex, mitochondrialtransmembrane complex; HET: M3L SUC 6PH UMQ HEM SMA 8PE 9PE CN5 7PH CN3; 1.90A {Saccharomyces cerevisiae} SCOP: b.33.1.1 f.23.12.1 PDB: 1kb9_E* 1kyo_E* 1p84_E* 2ibz_E* 1ezv_E* 3cxh_E* Back     alignment and structure
>1pp9_E Ubiquinol-cytochrome C reductase iron-sulfur SUBU mitochondrial; cytochrome BC1, membrane protein, heme protein, rieske iron protein, cytochrome B, complex III; HET: BHG HEM HEC SMA UQ CDL PEE; 2.10A {Bos taurus} SCOP: b.33.1.1 f.23.12.1 PDB: 1bgy_E* 1be3_E* 1l0n_E* 1ntk_E* 1ntm_E* 1ntz_E* 1nu1_E* 1l0l_E* 1ppj_E* 1qcr_E* 1sqb_E* 1sqp_E* 1sqq_E* 1sqv_E* 1sqx_E* 2a06_E* 2fyu_E* 2ybb_E* 1bcc_E* 2bcc_E* ... Back     alignment and structure
>1rfs_A Rieske protein; iron-sulfur protein, electron transport; 1.83A {Spinacia oleracea} SCOP: b.33.1.1 PDB: 1q90_C* Back     alignment and structure
>4aay_B AROB; oxidoreductase, rieske, iron sulfur, molybdopterin; HET: MGD; 2.70A {Rhizobium species} Back     alignment and structure
>2nwf_A Ubiquinol-cytochrome C reductase iron-sulfur SUBU; rieske [2Fe-2S] ISP, oxidoreductase; HET: GOL; 1.10A {Rhodobacter sphaeroides} PDB: 2nuk_A 2nve_A 2num_A 2nvg_A 2nvf_A Back     alignment and structure
>3azc_A Cytochrome B6-F complex iron-sulfur subunit; rieske, thermosynechococcus elongatu photosynthesis, electron transport; 2.00A {Thermosynechococcus elongatus} Back     alignment and structure
>1rie_A Rieske iron-sulfur protein; oxidoreductase, cytochrome BC1 complex, histidine ligands, rieske iron-sulfur cluster, electron transport; 1.50A {Bos taurus} SCOP: b.33.1.1 Back     alignment and structure
>1g8k_B Arsenite oxidase; molybdopterin, [3Fe-4S] cluster, [2Fe-2S] rieske, oxidoreductase; HET: MGD; 1.64A {Alcaligenes faecalis} SCOP: b.33.1.1 PDB: 1g8j_B* Back     alignment and structure
>2qpz_A Naphthalene 1,2-dioxygenase system ferredoxin subunit; rieske ferredoxin, 2Fe-2S, aromatic hydrocarbons catabolism, electron transport, iron; 1.85A {Pseudomonas putida} Back     alignment and structure
>3dqy_A Toluene 1,2-dioxygenase system ferredoxin subunit; rieske, iron-sulfur cluster, 2Fe-2S, aromatic hydrocarbons catabolism, electron transport; 1.20A {Pseudomonas putida} SCOP: b.33.1.0 PDB: 4emj_B* Back     alignment and structure
>2i7f_A Ferredoxin component of dioxygenase; rieske ferredoxin, oxidoreductase; HET: CIT; 1.90A {Sphingobium yanoikuyae} Back     alignment and structure
>3gce_A Ferredoxin component of carbazole 1,9A- dioxygenase; rieske ferredoxin, 2Fe-2S, electron transfer, oxidoreductase; 2.00A {Nocardioides aromaticivorans} Back     alignment and structure
>1fqt_A Rieske-type ferredoxin of biphenyl dioxygenase; 2Fe-2S cluster, beta sandwich, oxido; 1.60A {Burkholderia xenovorans} SCOP: b.33.1.1 PDB: 2e4q_A 2e4p_A 2yvj_B* Back     alignment and structure
>1vm9_A Toluene-4-monooxygenase system protein C; structural genomics, CESG, protein structure initiative, PSI, ferredoxin, FES, [2Fe-2S] cluster; 1.48A {Pseudomonas mendocina} SCOP: b.33.1.1 PDB: 2q3w_A 1sjg_A Back     alignment and structure
>2de6_D Ferredoxin component of carbazole; electron transfer complex, rieske non-heme iron oxygenase system, terminal oxygenase; 1.80A {Pseudomonas resinovorans} PDB: 2de5_D 1vck_A 2de7_D* Back     alignment and structure
>2jo6_A Nitrite reductase [NAD(P)H] small subunit; all beta, ISP domain, rieske iron-sulfur protein, 3-layer sandwich, structural genomics, PSI-2; NMR {Escherichia coli} SCOP: b.33.1.3 Back     alignment and structure
>1jm1_A Rieske iron-sulfur protein SOXF; electron transport, respiratory chain, oxidoreductase; 1.11A {Sulfolobus acidocaldarius} SCOP: b.33.1.1 Back     alignment and structure
>3c0d_A Putative nitrite reductase NADPH (small subunit) oxidoreductase protein; NESG, VPR162, Q87HB1, XRAY, structure; 2.40A {Vibrio parahaemolyticus rimd 2210633} SCOP: b.33.1.3 Back     alignment and structure
>1nyk_A Rieske iron-sulfur protein; beta barrel, iron sulfur cluster, electron transport; 1.31A {Thermus thermophilus} SCOP: b.33.1.1 PDB: 3fou_A Back     alignment and structure
>2jza_A Nitrite reductase [NAD(P)H] small subunit; ISP domain, rieske iron-sulfur protein, 3-layer beta- sandwich; NMR {Pectobacterium atrosepticum SCRI1043} SCOP: b.33.1.3 Back     alignment and structure
>4aiv_A Probable nitrite reductase [NAD(P)H] small subuni; oxidoreductase, nitrite metabolism; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3d89_A Rieske domain-containing protein; CAsp target, rieske ferredoxin, [2Fe-2S] cluster, protein ST initiative, PSI; 2.07A {Mus musculus} Back     alignment and structure
>3gke_A DDMC; rieske cluster, non-heme mononuclear iron, oxygenase, oxidoreductase; 1.75A {Stenotrophomonas maltophilia} PDB: 3gb4_A 3gl0_A* 3gl2_A* 3gob_A* 3gte_A 3gts_A* Back     alignment and structure
>2zyl_A Possible oxidoreductase; KSHA, cholesterol, rieske; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>2gbw_A Biphenyl 2,3-dioxygenase alpha subunit; rieske oxygenase, oxidoreductase, non heme iron; 1.70A {Sphingobium yanoikuyae} PDB: 2gbx_A* 2ckf_A Back     alignment and structure
>2b1x_A Naphthalene dioxygenase large subunit; rieske non-heme iron oxygenase, oxidoreductase; 2.00A {Rhodococcus SP} SCOP: b.33.1.2 d.129.3.3 PDB: 2b24_A Back     alignment and structure
>1q90_R Cytochrome B6-F complex iron-sulfur subunit; membrane protein complex, photosynthesis, electron transfer, oxydoreductase, chlorophyll; HET: HEM CL1 BCR TDS SQD LFA LMG; 3.10A {Chlamydomonas reinhardtii} SCOP: f.23.12.1 Back     alignment and structure
>3gcf_A Terminal oxygenase component of carbazole 1,9A- dioxygenase; rieske oxygenase, 2Fe-2S, electron transfer, oxidoreductase; 2.30A {Nocardioides aromaticivorans} Back     alignment and structure
>3n0q_A Putative aromatic-ring hydroxylating dioxygenase; rieske [2Fe-2S] domain, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.80A {Ruegeria SP} Back     alignment and structure
>1uli_A Biphenyl dioxygenase large subunit; alpha3 BETA3 hetero hexamer, oxidoreductase; 2.20A {Rhodococcus SP} SCOP: b.33.1.2 d.129.3.3 PDB: 1ulj_A* 3en1_A* 3eqq_A Back     alignment and structure
>3gkq_A Terminal oxygenase component of carbazole 1,9A- dioxygenase; rieske nonheme iron oxygenase, electron transfer, putidaredoxin-type ferredoxin; 2.10A {Sphingomonas} Back     alignment and structure
>2de6_A Terminal oxygenase component of carbazole; electron transfer complex, rieske non-heme iron oxygenase system, terminal oxygenase; 1.80A {Janthinobacterium} SCOP: b.33.1.2 d.129.3.3 PDB: 1ww9_A 2de5_A 2de7_A* Back     alignment and structure
>2bmo_A Oxygenase-alpha NBDO; nitrobenzene dioxygenase, nitroarene, rieske non-heme dioxygenase, substrate specificity iron- sulfur, metal-binding, NAD; 1.2A {Comamonas SP} SCOP: b.33.1.2 d.129.3.3 PDB: 2bmq_A 2bmr_A* 2hmj_A 2hml_A* 2hmn_A* 1o7n_A 1ndo_A 1o7g_A* 1o7h_A 1o7m_A 1eg9_A 1o7p_A* 1o7w_A 1uuv_A 1uuw_A 2hmk_A* 2hmm_A* 2hmo_A* Back     alignment and structure
>1z01_A 2-OXO-1,2-dihydroquinoline 8-monooxygenase, oxygenase component; rieske center, oxygen binding/activation, substrate bound complex; 1.80A {Pseudomonas putida} SCOP: b.33.1.2 d.129.3.3 PDB: 1z02_A 1z03_A* Back     alignment and structure
>3vca_A Ring-hydroxylating dioxygenase; rieske-type, mononuclear non-heme iron, N-demethylase, oxido; 1.59A {Sinorhizobium meliloti} PDB: 3vcp_A Back     alignment and structure
>3gzx_A Biphenyl dioxygenase subunit alpha; rieskie, non-heme iron, 2Fe-2S, aromatic hydroc catabolism, iron, iron-sulfur, metal-binding, NAD; HET: BNL MES; 1.58A {Comamonas testosteroni} PDB: 3gzy_A* 1wql_A 2xso_A 2xsh_A 2xrx_A* 2xr8_A* 2yfi_A 2yfj_A* 2yfl_A* Back     alignment and structure
>2pq4_B Periplasmic nitrate reductase precursor; NAPD/NAPA1-35, mixed beta-alpha sandwich structure, protein- peptide complex, alpha-helix; NMR {Escherichia coli} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 200
d1rfsa_127 b.33.1.1 (A:) ISP subunit from chloroplast cytochr 2e-37
d2e74d1134 b.33.1.1 (D:46-179) ISP subunit from the cytochrom 4e-36
d1q90r_39 f.23.12.1 (R:) ISP subunit from the cytochrome b6f 1e-16
d1riea_127 b.33.1.1 (A:) ISP subunit of the mitochondrial cyt 2e-14
d3cx5e1129 b.33.1.1 (E:87-215) ISP subunit of the mitochondri 1e-12
d1jm1a_202 b.33.1.1 (A:) Rieske protein II (SoxF) {Archaeon S 1e-10
d1g8kb_133 b.33.1.1 (B:) Arsenite oxidase Rieske subunit {Alc 5e-09
d1nyka_156 b.33.1.1 (A:) Soluble Rieske protein {Thermus ther 5e-06
d2e74d234 f.23.12.1 (D:12-45) ISP subunit from the cytochrom 7e-05
d1vm9a_109 b.33.1.1 (A:) Toluene-4-monooxygenase system prote 1e-04
>d1rfsa_ b.33.1.1 (A:) ISP subunit from chloroplast cytochrome bf complex {Spinach (Spinacia oleracea) [TaxId: 3562]} Length = 127 Back     information, alignment and structure

class: All beta proteins
fold: ISP domain
superfamily: ISP domain
family: Rieske iron-sulfur protein (ISP)
domain: ISP subunit from chloroplast cytochrome bf complex
species: Spinach (Spinacia oleracea) [TaxId: 3562]
 Score =  123 bits (311), Expect = 2e-37
 Identities = 80/92 (86%), Positives = 88/92 (95%)

Query: 104 TTAKDAIGNDIIAADWLNTHGPGDRTLTEGLKGDPTYLVVEKDKTLASYGINAVCTHLGC 163
           T AKDA+GND+IAA+WL TH PGDRTLT+GLKGDPTYLVVE DKTLA++GINAVCTHLGC
Sbjct: 1   TIAKDALGNDVIAAEWLKTHAPGDRTLTQGLKGDPTYLVVESDKTLATFGINAVCTHLGC 60

Query: 164 VVPWNSAENKFICPCHGSQYNNQGRVVRGPAP 195
           VVP+N+AENKFICPCHGSQYNNQGRVVRGPAP
Sbjct: 61  VVPFNAAENKFICPCHGSQYNNQGRVVRGPAP 92


>d2e74d1 b.33.1.1 (D:46-179) ISP subunit from the cytochrome b6f complex, soluble domain {Mastigocladus laminosus [TaxId: 83541]} Length = 134 Back     information, alignment and structure
>d1q90r_ f.23.12.1 (R:) ISP subunit from the cytochrome b6f complex, transmembrane anchor {Chlamydomonas reinhardtii [TaxId: 3055]} Length = 39 Back     information, alignment and structure
>d1riea_ b.33.1.1 (A:) ISP subunit of the mitochondrial cytochrome bc1-complex, water-soluble domain {Cow (Bos taurus) [TaxId: 9913]} Length = 127 Back     information, alignment and structure
>d3cx5e1 b.33.1.1 (E:87-215) ISP subunit of the mitochondrial cytochrome bc1-complex, water-soluble domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 129 Back     information, alignment and structure
>d1jm1a_ b.33.1.1 (A:) Rieske protein II (SoxF) {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Length = 202 Back     information, alignment and structure
>d1g8kb_ b.33.1.1 (B:) Arsenite oxidase Rieske subunit {Alcaligenes faecalis [TaxId: 511]} Length = 133 Back     information, alignment and structure
>d1nyka_ b.33.1.1 (A:) Soluble Rieske protein {Thermus thermophilus [TaxId: 274]} Length = 156 Back     information, alignment and structure
>d2e74d2 f.23.12.1 (D:12-45) ISP subunit from the cytochrome b6f complex, transmembrane anchor {Mastigocladus laminosus [TaxId: 83541]} Length = 34 Back     information, alignment and structure
>d1vm9a_ b.33.1.1 (A:) Toluene-4-monooxygenase system protein C, TmoC {Pseudomonas mendocina [TaxId: 300]} Length = 109 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query200
d1rfsa_127 ISP subunit from chloroplast cytochrome bf complex 99.88
d1riea_127 ISP subunit of the mitochondrial cytochrome bc1-co 99.86
d2e74d1134 ISP subunit from the cytochrome b6f complex, solub 99.86
d3cx5e1129 ISP subunit of the mitochondrial cytochrome bc1-co 99.86
d1jm1a_202 Rieske protein II (SoxF) {Archaeon Sulfolobus acid 99.66
d1g8kb_133 Arsenite oxidase Rieske subunit {Alcaligenes faeca 99.65
d1nyka_156 Soluble Rieske protein {Thermus thermophilus [TaxI 99.57
d1fqta_109 Rieske-type ferredoxin associated with biphenyl di 99.51
d1vm9a_109 Toluene-4-monooxygenase system protein C, TmoC {Ps 99.49
d3c0da1108 NADH-nitrite reductase small subunit NirD {Vibrio 99.46
d2jo6a1108 NADH-nitrite reductase small subunit NirD {Escheri 99.38
d2jzaa1122 NADH-nitrite reductase small subunit NirD {Erwinia 99.35
d2bmoa1150 Nitrobenzene dioxygenase alpha subunit, NBDO-alpha 99.34
d2b1xa1162 Naphthalene 1,2-dioxygenase alpha subunit, N-domai 99.33
d2de6a1142 Terminal oxygenase component of carbazole CarAa {J 99.33
d1ulia1154 Biphenyl dioxygenase large subunit BphA1, N-termin 99.31
d1z01a1148 2-oxo-1,2-dihydroquinoline 8-monooxygenase, oxygen 99.28
d1q90r_39 ISP subunit from the cytochrome b6f complex, trans 99.12
d2e74d234 ISP subunit from the cytochrome b6f complex, trans 98.47
>d1rfsa_ b.33.1.1 (A:) ISP subunit from chloroplast cytochrome bf complex {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
class: All beta proteins
fold: ISP domain
superfamily: ISP domain
family: Rieske iron-sulfur protein (ISP)
domain: ISP subunit from chloroplast cytochrome bf complex
species: Spinach (Spinacia oleracea) [TaxId: 3562]
Probab=99.88  E-value=6.8e-24  Score=164.68  Aligned_cols=97  Identities=84%  Similarity=1.414  Sum_probs=85.9

Q ss_pred             ceeecCCCCceeeecccccCCCCCcccccccCCCCeEEEEecCCceeEEEEeccCCCCCccCCCCCCCCeEEcCCCCeee
Q 028988          104 TTAKDAIGNDIIAADWLNTHGPGDRTLTEGLKGDPTYLVVEKDKTLASYGINAVCTHLGCVVPWNSAENKFICPCHGSQY  183 (200)
Q Consensus       104 ~v~vd~~g~~i~~~~W~~~~~P~~~~~~~~~~g~p~~lv~~~~g~~~~~A~s~vCTHlGC~l~~~~~~~~~~CPcHGS~F  183 (200)
                      ++++|.+|++|...+|++...++++.+.....+++..|++..++...+||++++|||+||++.++..++.|.||||||+|
T Consensus         1 ~~a~d~~gndi~~~~wl~~~~~G~~~l~~~~~g~~~~lvv~~d~~~~v~A~~~~C~H~g~~l~~~~~~~~~~Cp~Hg~~F   80 (127)
T d1rfsa_           1 TIAKDALGNDVIAAEWLKTHAPGDRTLTQGLKGDPTYLVVESDKTLATFGINAVCTHLGCVVPFNAAENKFICPCHGSQY   80 (127)
T ss_dssp             CBCBCTTSCBCBHHHHHHHSCTTCEEEEECGGGCEEEEEBCTTSSBCSEEEECBCTTTCCBCCEETTTTEEECTTTCCEE
T ss_pred             CccccccCCcceecceecccCCCcceeeeeecCCceEEEEEeCCCCEEEEEcCCCCCCCCCccCcccCCeEEcCCCCeEE
Confidence            35678999999999999888788877777788899999988777655699999999999999998888899999999999


Q ss_pred             CCCCeeccCCCCCCCCC
Q 028988          184 NNQGRVVRGPAPLVSNT  200 (200)
Q Consensus       184 d~~G~v~~GPAp~pL~~  200 (200)
                      |.+|+++.|||+++|++
T Consensus        81 d~~G~~~~~Pa~~~L~~   97 (127)
T d1rfsa_          81 NNQGRVVRGPAPLSLAL   97 (127)
T ss_dssp             ETTCCEEESSCCSCCCE
T ss_pred             CCCCCCCcCCCCCCcce
Confidence            99999999999999973



>d1riea_ b.33.1.1 (A:) ISP subunit of the mitochondrial cytochrome bc1-complex, water-soluble domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2e74d1 b.33.1.1 (D:46-179) ISP subunit from the cytochrome b6f complex, soluble domain {Mastigocladus laminosus [TaxId: 83541]} Back     information, alignment and structure
>d3cx5e1 b.33.1.1 (E:87-215) ISP subunit of the mitochondrial cytochrome bc1-complex, water-soluble domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jm1a_ b.33.1.1 (A:) Rieske protein II (SoxF) {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1g8kb_ b.33.1.1 (B:) Arsenite oxidase Rieske subunit {Alcaligenes faecalis [TaxId: 511]} Back     information, alignment and structure
>d1nyka_ b.33.1.1 (A:) Soluble Rieske protein {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1fqta_ b.33.1.1 (A:) Rieske-type ferredoxin associated with biphenyl dioxygenase {Burkholderia cepacia [TaxId: 292]} Back     information, alignment and structure
>d1vm9a_ b.33.1.1 (A:) Toluene-4-monooxygenase system protein C, TmoC {Pseudomonas mendocina [TaxId: 300]} Back     information, alignment and structure
>d3c0da1 b.33.1.3 (A:4-111) NADH-nitrite reductase small subunit NirD {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2jo6a1 b.33.1.3 (A:1-108) NADH-nitrite reductase small subunit NirD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2jzaa1 b.33.1.3 (A:1-122) NADH-nitrite reductase small subunit NirD {Erwinia carotovora [TaxId: 554]} Back     information, alignment and structure
>d2bmoa1 b.33.1.2 (A:3-152) Nitrobenzene dioxygenase alpha subunit, NBDO-alpha {Comamonas sp. JS765 [TaxId: 58226]} Back     information, alignment and structure
>d2b1xa1 b.33.1.2 (A:1-162) Naphthalene 1,2-dioxygenase alpha subunit, N-domain {Rhodococcus sp. ncimb12038 [TaxId: 92694]} Back     information, alignment and structure
>d2de6a1 b.33.1.2 (A:1-142) Terminal oxygenase component of carbazole CarAa {Janthinobacterium sp. j3 [TaxId: 213804]} Back     information, alignment and structure
>d1ulia1 b.33.1.2 (A:17-170) Biphenyl dioxygenase large subunit BphA1, N-terminal domain {Rhodococcus sp. (strain RHA1) [TaxId: 101510]} Back     information, alignment and structure
>d1z01a1 b.33.1.2 (A:16-163) 2-oxo-1,2-dihydroquinoline 8-monooxygenase, oxygenase component OxoO {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1q90r_ f.23.12.1 (R:) ISP subunit from the cytochrome b6f complex, transmembrane anchor {Chlamydomonas reinhardtii [TaxId: 3055]} Back     information, alignment and structure
>d2e74d2 f.23.12.1 (D:12-45) ISP subunit from the cytochrome b6f complex, transmembrane anchor {Mastigocladus laminosus [TaxId: 83541]} Back     information, alignment and structure