Citrus Sinensis ID: 028992
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 200 | ||||||
| 224072604 | 200 | predicted protein [Populus trichocarpa] | 0.985 | 0.985 | 0.71 | 6e-76 | |
| 224057709 | 200 | predicted protein [Populus trichocarpa] | 0.98 | 0.98 | 0.69 | 2e-74 | |
| 449450365 | 204 | PREDICTED: mitochondrial import receptor | 1.0 | 0.980 | 0.696 | 4e-74 | |
| 356566216 | 201 | PREDICTED: mitochondrial import receptor | 1.0 | 0.995 | 0.656 | 9e-73 | |
| 225451445 | 201 | PREDICTED: mitochondrial import receptor | 0.98 | 0.975 | 0.702 | 2e-70 | |
| 255547728 | 206 | Mitochondrial import receptor subunit TO | 0.985 | 0.956 | 0.615 | 2e-70 | |
| 359806671 | 210 | uncharacterized protein LOC100819858 [Gl | 0.97 | 0.923 | 0.651 | 6e-68 | |
| 449494436 | 204 | PREDICTED: mitochondrial import receptor | 1.0 | 0.980 | 0.681 | 7e-68 | |
| 255536895 | 205 | Mitochondrial import receptor subunit TO | 0.98 | 0.956 | 0.648 | 2e-67 | |
| 351722735 | 201 | uncharacterized protein LOC100527313 [Gl | 1.0 | 0.995 | 0.641 | 2e-67 |
| >gi|224072604|ref|XP_002303802.1| predicted protein [Populus trichocarpa] gi|222841234|gb|EEE78781.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 288 bits (738), Expect = 6e-76, Method: Compositional matrix adjust.
Identities = 142/200 (71%), Positives = 170/200 (85%), Gaps = 3/200 (1%)
Query: 1 MEFSQSDFDRLLLSEHNRKTAEANYAKDPLDADNLTRWGEALLELSQFESVSDSKKIINE 60
MEFSQ DFDRLL EH RK+AEA YAKDPLDADNLT+WGEALLELSQF++V+++KK+INE
Sbjct: 1 MEFSQDDFDRLLRFEHTRKSAEATYAKDPLDADNLTKWGEALLELSQFQTVAEAKKMINE 60
Query: 61 AISKFEEALVIDPAKHYTLWSLGNAHTSCGFLTADLSEAKGDFDKASECFQRAVDEEPTN 120
AISK EEA++++P + +WS+GNA+TS FLT DLSEAK FDKA++ FQ+AVDE+ TN
Sbjct: 61 AISKLEEAMMLNPTAN-AMWSIGNANTSYAFLTPDLSEAKNYFDKAADYFQQAVDEDSTN 119
Query: 121 ELYQKSLEVSTKAPELHMELHKHGINQQTLGGGSSASS-AQSSKKKS-SDLKYDIFGWAI 178
ELY KSLEV KAPELHME+HKH +QQT+GG SS SS A+ SKKK+ SDLKYDIFGW I
Sbjct: 120 ELYHKSLEVCAKAPELHMEIHKHSSSQQTMGGESSPSSNAKGSKKKANSDLKYDIFGWII 179
Query: 179 LAVGIVAWVGMANSRIPPPP 198
LAVGIVAW+G+A S +PPPP
Sbjct: 180 LAVGIVAWMGIAKSHVPPPP 199
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224057709|ref|XP_002299299.1| predicted protein [Populus trichocarpa] gi|118481274|gb|ABK92583.1| unknown [Populus trichocarpa] gi|222846557|gb|EEE84104.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|449450365|ref|XP_004142933.1| PREDICTED: mitochondrial import receptor subunit TOM20-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|356566216|ref|XP_003551330.1| PREDICTED: mitochondrial import receptor subunit TOM20-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|225451445|ref|XP_002269795.1| PREDICTED: mitochondrial import receptor subunit TOM20 [Vitis vinifera] gi|296082346|emb|CBI21351.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255547728|ref|XP_002514921.1| Mitochondrial import receptor subunit TOM20, putative [Ricinus communis] gi|223545972|gb|EEF47475.1| Mitochondrial import receptor subunit TOM20, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|359806671|ref|NP_001241027.1| uncharacterized protein LOC100819858 [Glycine max] gi|255647408|gb|ACU24169.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449494436|ref|XP_004159545.1| PREDICTED: mitochondrial import receptor subunit TOM20-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|255536895|ref|XP_002509514.1| Mitochondrial import receptor subunit TOM20, putative [Ricinus communis] gi|223549413|gb|EEF50901.1| Mitochondrial import receptor subunit TOM20, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|351722735|ref|NP_001238022.1| uncharacterized protein LOC100527313 [Glycine max] gi|255632065|gb|ACU16385.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 200 | ||||||
| TAIR|locus:2015904 | 210 | TOM20-2 "AT1G27390" [Arabidops | 1.0 | 0.952 | 0.504 | 5.1e-51 | |
| TAIR|locus:2092045 | 202 | TOM20-3 "AT3G27080" [Arabidops | 0.985 | 0.975 | 0.505 | 2.2e-50 | |
| TAIR|locus:2167737 | 187 | TOM20-4 "AT5G40930" [Arabidops | 0.9 | 0.962 | 0.502 | 1.3e-43 |
| TAIR|locus:2015904 TOM20-2 "AT1G27390" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 530 (191.6 bits), Expect = 5.1e-51, P = 5.1e-51
Identities = 106/210 (50%), Positives = 135/210 (64%)
Query: 1 MEFSQSDFDRLLLSEHNRKTAEANYAKDPLDADNLTRWGEALLELSQFESVSDSKKIINE 60
MEFS +DF+RL++ EH RK +EA Y DPLD++NL +WG ALLELSQF+ + ++K ++N+
Sbjct: 1 MEFSTADFERLIMFEHARKNSEAQYKNDPLDSENLLKWGGALLELSQFQPIPEAKLMLND 60
Query: 61 AISKFEEALVIDPAKHYTLWSLGNAHTSCGFLTADLSEAKGDFDKASECFQRAVDEEPTN 120
AISK EEAL I+P KH LW + NA+T+ F D EAK FDKA+E FQRA +E+P N
Sbjct: 61 AISKLEEALTINPGKHQALWCIANAYTAHAFYVHDPEEAKEHFDKATEYFQRAENEDPGN 120
Query: 121 ELYQKSLEVSTKAPELHMELHKHGINQQTLX----------XXXXXXXXXXXXXXXXDLK 170
+ Y+KSL+ S KAPELHM+ G+ QQ L +
Sbjct: 121 DTYRKSLDSSLKAPELHMQFMNQGMGQQILGGGGGGGGGGMASSNVSQSSKKKKRNTEFT 180
Query: 171 YDIFGWAILAVGIVAWVGMANSRIPPPPAR 200
YD+ GW ILA GIVAWVGMA S PPPPAR
Sbjct: 181 YDVCGWIILACGIVAWVGMAKSLGPPPPAR 210
|
|
| TAIR|locus:2092045 TOM20-3 "AT3G27080" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2167737 TOM20-4 "AT5G40930" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 200 | |||
| pfam06552 | 186 | pfam06552, TOM20_plant, Plant specific mitochondri | 1e-93 | |
| cd00189 | 100 | cd00189, TPR, Tetratricopeptide repeat domain; typ | 2e-04 |
| >gnl|CDD|191555 pfam06552, TOM20_plant, Plant specific mitochondrial import receptor subunit TOM20 | Back alignment and domain information |
|---|
Score = 270 bits (692), Expect = 1e-93
Identities = 117/186 (62%), Positives = 148/186 (79%), Gaps = 2/186 (1%)
Query: 8 FDRLLLSEHNRKTAEANYAKDPLDADNLTRWGEALLELSQFESVSDSKKIINEAISKFEE 67
FDRLL+ EH RK+AEA Y K+PLDADNLTRWG ALLELSQF+SV D+K++IN+AISK EE
Sbjct: 1 FDRLLMFEHARKSAEATYKKNPLDADNLTRWGGALLELSQFQSVPDAKQMINDAISKLEE 60
Query: 68 ALVIDPAKHYTLWSLGNAHTSCGFLTADLSEAKGDFDKASECFQRAVDEEPTNELYQKSL 127
ALVI+P KH LW +GNA+TS FLT D +EAK +FDKA++ FQ+AVDE+P N+LY+KSL
Sbjct: 61 ALVINPKKHDALWCIGNAYTSFAFLTPDPTEAKENFDKATQFFQQAVDEQPDNDLYRKSL 120
Query: 128 EVSTKAPELHMELHKHGINQQTLGGGSSASSAQSS--KKKSSDLKYDIFGWAILAVGIVA 185
E++ KAPELH E HK G+ Q +GG + +S +Q + KKSSD KYD+ GW ILA+G+VA
Sbjct: 121 EMAAKAPELHTEFHKQGLGSQIMGGEAPSSPSQKTVKNKKSSDFKYDVMGWVILAIGVVA 180
Query: 186 WVGMAN 191
W+ A
Sbjct: 181 WISFAK 186
|
This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins. Most mitochondrial proteins are encoded by the nuclear genome, and are synthesised in the cytosol. TOM20 is a general import receptor that binds to mitochondrial pre-sequences in the early step of protein import into the mitochondria. Length = 186 |
| >gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 200 | |||
| PF06552 | 186 | TOM20_plant: Plant specific mitochondrial import r | 100.0 | |
| KOG4626 | 966 | consensus O-linked N-acetylglucosamine transferase | 99.68 | |
| KOG4626 | 966 | consensus O-linked N-acetylglucosamine transferase | 99.65 | |
| PRK15359 | 144 | type III secretion system chaperone protein SscB; | 99.63 | |
| TIGR00990 | 615 | 3a0801s09 mitochondrial precursor proteins import | 99.62 | |
| KOG0553 | 304 | consensus TPR repeat-containing protein [General f | 99.6 | |
| PRK11189 | 296 | lipoprotein NlpI; Provisional | 99.57 | |
| PRK15359 | 144 | type III secretion system chaperone protein SscB; | 99.52 | |
| PRK12370 | 553 | invasion protein regulator; Provisional | 99.52 | |
| TIGR02552 | 135 | LcrH_SycD type III secretion low calcium response | 99.49 | |
| PRK12370 | 553 | invasion protein regulator; Provisional | 99.46 | |
| PLN03088 | 356 | SGT1, suppressor of G2 allele of SKP1; Provisional | 99.44 | |
| TIGR00990 | 615 | 3a0801s09 mitochondrial precursor proteins import | 99.44 | |
| PRK09782 | 987 | bacteriophage N4 receptor, outer membrane subunit; | 99.42 | |
| PF13414 | 69 | TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A | 99.41 | |
| PRK10370 | 198 | formate-dependent nitrite reductase complex subuni | 99.41 | |
| PRK10370 | 198 | formate-dependent nitrite reductase complex subuni | 99.41 | |
| TIGR02521 | 234 | type_IV_pilW type IV pilus biogenesis/stability pr | 99.4 | |
| PRK09782 | 987 | bacteriophage N4 receptor, outer membrane subunit; | 99.38 | |
| PRK15363 | 157 | pathogenicity island 2 chaperone protein SscA; Pro | 99.36 | |
| COG3063 | 250 | PilF Tfp pilus assembly protein PilF [Cell motilit | 99.35 | |
| KOG1125 | 579 | consensus TPR repeat-containing protein [General f | 99.35 | |
| KOG1126 | 638 | consensus DNA-binding cell division cycle control | 99.33 | |
| PRK15174 | 656 | Vi polysaccharide export protein VexE; Provisional | 99.33 | |
| PRK11189 | 296 | lipoprotein NlpI; Provisional | 99.33 | |
| TIGR02552 | 135 | LcrH_SycD type III secretion low calcium response | 99.31 | |
| TIGR02795 | 119 | tol_pal_ybgF tol-pal system protein YbgF. Members | 99.3 | |
| PF13432 | 65 | TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL | 99.29 | |
| cd00189 | 100 | TPR Tetratricopeptide repeat domain; typically con | 99.28 | |
| TIGR02521 | 234 | type_IV_pilW type IV pilus biogenesis/stability pr | 99.26 | |
| TIGR03302 | 235 | OM_YfiO outer membrane assembly lipoprotein YfiO. | 99.24 | |
| PRK15179 | 694 | Vi polysaccharide biosynthesis protein TviE; Provi | 99.23 | |
| KOG1155 | 559 | consensus Anaphase-promoting complex (APC), Cdc23 | 99.23 | |
| TIGR02917 | 899 | PEP_TPR_lipo putative PEP-CTERM system TPR-repeat | 99.22 | |
| PRK11447 | 1157 | cellulose synthase subunit BcsC; Provisional | 99.22 | |
| KOG1126 | 638 | consensus DNA-binding cell division cycle control | 99.22 | |
| TIGR02917 | 899 | PEP_TPR_lipo putative PEP-CTERM system TPR-repeat | 99.21 | |
| PRK11447 | 1157 | cellulose synthase subunit BcsC; Provisional | 99.19 | |
| PRK15174 | 656 | Vi polysaccharide export protein VexE; Provisional | 99.18 | |
| KOG0547 | 606 | consensus Translocase of outer mitochondrial membr | 99.18 | |
| PRK02603 | 172 | photosystem I assembly protein Ycf3; Provisional | 99.17 | |
| CHL00033 | 168 | ycf3 photosystem I assembly protein Ycf3 | 99.15 | |
| PLN03098 | 453 | LPA1 LOW PSII ACCUMULATION1; Provisional | 99.15 | |
| PLN02789 | 320 | farnesyltranstransferase | 99.13 | |
| PRK11788 | 389 | tetratricopeptide repeat protein; Provisional | 99.12 | |
| PF12895 | 84 | Apc3: Anaphase-promoting complex, cyclosome, subun | 99.1 | |
| PRK10049 | 765 | pgaA outer membrane protein PgaA; Provisional | 99.09 | |
| PLN02789 | 320 | farnesyltranstransferase | 99.08 | |
| COG3063 | 250 | PilF Tfp pilus assembly protein PilF [Cell motilit | 99.07 | |
| KOG0547 | 606 | consensus Translocase of outer mitochondrial membr | 99.06 | |
| PF13429 | 280 | TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 | 99.05 | |
| PRK11788 | 389 | tetratricopeptide repeat protein; Provisional | 99.05 | |
| PF13429 | 280 | TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 | 99.04 | |
| PRK15363 | 157 | pathogenicity island 2 chaperone protein SscA; Pro | 99.04 | |
| KOG4162 | 799 | consensus Predicted calmodulin-binding protein [Si | 99.03 | |
| KOG1125 | 579 | consensus TPR repeat-containing protein [General f | 99.02 | |
| KOG3060 | 289 | consensus Uncharacterized conserved protein [Funct | 99.02 | |
| PLN03088 | 356 | SGT1, suppressor of G2 allele of SKP1; Provisional | 98.98 | |
| PRK10803 | 263 | tol-pal system protein YbgF; Provisional | 98.98 | |
| PRK15179 | 694 | Vi polysaccharide biosynthesis protein TviE; Provi | 98.97 | |
| KOG0553 | 304 | consensus TPR repeat-containing protein [General f | 98.97 | |
| KOG0548 | 539 | consensus Molecular co-chaperone STI1 [Posttransla | 98.97 | |
| PF14559 | 68 | TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN | 98.96 | |
| KOG1155 | 559 | consensus Anaphase-promoting complex (APC), Cdc23 | 98.95 | |
| PF13371 | 73 | TPR_9: Tetratricopeptide repeat | 98.94 | |
| PRK10049 | 765 | pgaA outer membrane protein PgaA; Provisional | 98.94 | |
| COG5010 | 257 | TadD Flp pilus assembly protein TadD, contains TPR | 98.94 | |
| KOG0548 | 539 | consensus Molecular co-chaperone STI1 [Posttransla | 98.93 | |
| PRK15331 | 165 | chaperone protein SicA; Provisional | 98.93 | |
| KOG1173 | 611 | consensus Anaphase-promoting complex (APC), Cdc16 | 98.88 | |
| PF13432 | 65 | TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL | 98.87 | |
| PF13414 | 69 | TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A | 98.86 | |
| PRK11906 | 458 | transcriptional regulator; Provisional | 98.85 | |
| COG4235 | 287 | Cytochrome c biogenesis factor [Posttranslational | 98.85 | |
| COG4235 | 287 | Cytochrome c biogenesis factor [Posttranslational | 98.84 | |
| cd00189 | 100 | TPR Tetratricopeptide repeat domain; typically con | 98.83 | |
| CHL00033 | 168 | ycf3 photosystem I assembly protein Ycf3 | 98.82 | |
| PRK11906 | 458 | transcriptional regulator; Provisional | 98.81 | |
| TIGR02795 | 119 | tol_pal_ybgF tol-pal system protein YbgF. Members | 98.79 | |
| KOG0543 | 397 | consensus FKBP-type peptidyl-prolyl cis-trans isom | 98.79 | |
| TIGR03302 | 235 | OM_YfiO outer membrane assembly lipoprotein YfiO. | 98.78 | |
| PF14559 | 68 | TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN | 98.78 | |
| PRK10153 | 517 | DNA-binding transcriptional activator CadC; Provis | 98.77 | |
| PRK02603 | 172 | photosystem I assembly protein Ycf3; Provisional | 98.74 | |
| PF13424 | 78 | TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 | 98.73 | |
| cd05804 | 355 | StaR_like StaR_like; a well-conserved protein foun | 98.73 | |
| PRK14574 | 822 | hmsH outer membrane protein; Provisional | 98.73 | |
| KOG1129 | 478 | consensus TPR repeat-containing protein [General f | 98.69 | |
| COG5010 | 257 | TadD Flp pilus assembly protein TadD, contains TPR | 98.68 | |
| PRK10153 | 517 | DNA-binding transcriptional activator CadC; Provis | 98.67 | |
| PF13371 | 73 | TPR_9: Tetratricopeptide repeat | 98.66 | |
| PF12688 | 120 | TPR_5: Tetratrico peptide repeat | 98.64 | |
| cd05804 | 355 | StaR_like StaR_like; a well-conserved protein foun | 98.61 | |
| KOG1173 | 611 | consensus Anaphase-promoting complex (APC), Cdc16 | 98.56 | |
| KOG3060 | 289 | consensus Uncharacterized conserved protein [Funct | 98.52 | |
| TIGR00540 | 409 | hemY_coli hemY protein. This is an uncharacterized | 98.5 | |
| KOG2076 | 895 | consensus RNA polymerase III transcription factor | 98.5 | |
| COG4783 | 484 | Putative Zn-dependent protease, contains TPR repea | 98.5 | |
| KOG2002 | 1018 | consensus TPR-containing nuclear phosphoprotein th | 98.47 | |
| PRK14574 | 822 | hmsH outer membrane protein; Provisional | 98.46 | |
| KOG1156 | 700 | consensus N-terminal acetyltransferase [Chromatin | 98.45 | |
| PF13431 | 34 | TPR_17: Tetratricopeptide repeat | 98.45 | |
| KOG1129 | 478 | consensus TPR repeat-containing protein [General f | 98.44 | |
| PRK10747 | 398 | putative protoheme IX biogenesis protein; Provisio | 98.42 | |
| KOG0624 | 504 | consensus dsRNA-activated protein kinase inhibitor | 98.41 | |
| PRK10747 | 398 | putative protoheme IX biogenesis protein; Provisio | 98.41 | |
| PF00515 | 34 | TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 | 98.4 | |
| PF09976 | 145 | TPR_21: Tetratricopeptide repeat; InterPro: IPR018 | 98.4 | |
| KOG4234 | 271 | consensus TPR repeat-containing protein [General f | 98.4 | |
| PF06552 | 186 | TOM20_plant: Plant specific mitochondrial import r | 98.39 | |
| KOG1127 | 1238 | consensus TPR repeat-containing protein [RNA proce | 98.37 | |
| COG4785 | 297 | NlpI Lipoprotein NlpI, contains TPR repeats [Gener | 98.37 | |
| KOG2002 | 1018 | consensus TPR-containing nuclear phosphoprotein th | 98.37 | |
| KOG4642 | 284 | consensus Chaperone-dependent E3 ubiquitin protein | 98.36 | |
| KOG2003 | 840 | consensus TPR repeat-containing protein [General f | 98.35 | |
| KOG4648 | 536 | consensus Uncharacterized conserved protein, conta | 98.35 | |
| PRK10803 | 263 | tol-pal system protein YbgF; Provisional | 98.34 | |
| PF13428 | 44 | TPR_14: Tetratricopeptide repeat | 98.33 | |
| PF07719 | 34 | TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 | 98.32 | |
| KOG1174 | 564 | consensus Anaphase-promoting complex (APC), subuni | 98.3 | |
| KOG1174 | 564 | consensus Anaphase-promoting complex (APC), subuni | 98.29 | |
| TIGR00540 | 409 | hemY_coli hemY protein. This is an uncharacterized | 98.29 | |
| KOG0550 | 486 | consensus Molecular chaperone (DnaJ superfamily) [ | 98.29 | |
| PRK10866 | 243 | outer membrane biogenesis protein BamD; Provisiona | 98.27 | |
| KOG0624 | 504 | consensus dsRNA-activated protein kinase inhibitor | 98.27 | |
| KOG1128 | 777 | consensus Uncharacterized conserved protein, conta | 98.23 | |
| KOG2076 | 895 | consensus RNA polymerase III transcription factor | 98.2 | |
| KOG0550 | 486 | consensus Molecular chaperone (DnaJ superfamily) [ | 98.2 | |
| PRK14720 | 906 | transcript cleavage factor/unknown domain fusion p | 98.2 | |
| KOG1840 | 508 | consensus Kinesin light chain [Cytoskeleton] | 98.17 | |
| KOG4162 | 799 | consensus Predicted calmodulin-binding protein [Si | 98.17 | |
| KOG0543 | 397 | consensus FKBP-type peptidyl-prolyl cis-trans isom | 98.16 | |
| PF13512 | 142 | TPR_18: Tetratricopeptide repeat | 98.1 | |
| KOG3364 | 149 | consensus Membrane protein involved in organellar | 98.1 | |
| KOG1127 | 1238 | consensus TPR repeat-containing protein [RNA proce | 98.09 | |
| PF12688 | 120 | TPR_5: Tetratrico peptide repeat | 98.09 | |
| PRK10866 | 243 | outer membrane biogenesis protein BamD; Provisiona | 98.08 | |
| PF00515 | 34 | TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 | 98.04 | |
| COG4783 | 484 | Putative Zn-dependent protease, contains TPR repea | 98.01 | |
| PF07719 | 34 | TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 | 97.99 | |
| PF12895 | 84 | Apc3: Anaphase-promoting complex, cyclosome, subun | 97.96 | |
| PF13428 | 44 | TPR_14: Tetratricopeptide repeat | 97.95 | |
| PF13525 | 203 | YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M | 97.95 | |
| PRK14720 | 906 | transcript cleavage factor/unknown domain fusion p | 97.95 | |
| PF04733 | 290 | Coatomer_E: Coatomer epsilon subunit; InterPro: IP | 97.95 | |
| PRK15331 | 165 | chaperone protein SicA; Provisional | 97.95 | |
| COG1729 | 262 | Uncharacterized protein conserved in bacteria [Fun | 97.95 | |
| PF09295 | 395 | ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter | 97.94 | |
| PF13181 | 34 | TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ | 97.93 | |
| PF09295 | 395 | ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter | 97.88 | |
| KOG4555 | 175 | consensus TPR repeat-containing protein [Function | 97.87 | |
| PLN03098 | 453 | LPA1 LOW PSII ACCUMULATION1; Provisional | 97.87 | |
| PF13431 | 34 | TPR_17: Tetratricopeptide repeat | 97.86 | |
| KOG0376 | 476 | consensus Serine-threonine phosphatase 2A, catalyt | 97.81 | |
| KOG1308 | 377 | consensus Hsp70-interacting protein Hip/Transient | 97.79 | |
| COG4785 | 297 | NlpI Lipoprotein NlpI, contains TPR repeats [Gener | 97.77 | |
| KOG1128 | 777 | consensus Uncharacterized conserved protein, conta | 97.76 | |
| PF09976 | 145 | TPR_21: Tetratricopeptide repeat; InterPro: IPR018 | 97.76 | |
| PF13512 | 142 | TPR_18: Tetratricopeptide repeat | 97.73 | |
| PF13525 | 203 | YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M | 97.73 | |
| COG2956 | 389 | Predicted N-acetylglucosaminyl transferase [Carboh | 97.7 | |
| KOG2003 | 840 | consensus TPR repeat-containing protein [General f | 97.7 | |
| COG0457 | 291 | NrfG FOG: TPR repeat [General function prediction | 97.69 | |
| COG2956 | 389 | Predicted N-acetylglucosaminyl transferase [Carboh | 97.65 | |
| KOG4648 | 536 | consensus Uncharacterized conserved protein, conta | 97.63 | |
| COG0457 | 291 | NrfG FOG: TPR repeat [General function prediction | 97.62 | |
| COG1729 | 262 | Uncharacterized protein conserved in bacteria [Fun | 97.61 | |
| KOG1156 | 700 | consensus N-terminal acetyltransferase [Chromatin | 97.55 | |
| KOG4555 | 175 | consensus TPR repeat-containing protein [Function | 97.53 | |
| PF04733 | 290 | Coatomer_E: Coatomer epsilon subunit; InterPro: IP | 97.5 | |
| PF13176 | 36 | TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ | 97.5 | |
| KOG1840 | 508 | consensus Kinesin light chain [Cytoskeleton] | 97.48 | |
| KOG0545 | 329 | consensus Aryl-hydrocarbon receptor-interacting pr | 97.46 | |
| KOG0495 | 913 | consensus HAT repeat protein [RNA processing and m | 97.42 | |
| KOG4234 | 271 | consensus TPR repeat-containing protein [General f | 97.42 | |
| KOG4507 | 886 | consensus Uncharacterized conserved protein, conta | 97.41 | |
| smart00028 | 34 | TPR Tetratricopeptide repeats. Repeats present in | 97.4 | |
| PF12569 | 517 | NARP1: NMDA receptor-regulated protein 1 ; InterPr | 97.37 | |
| PF13174 | 33 | TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ | 97.36 | |
| COG4700 | 251 | Uncharacterized protein conserved in bacteria cont | 97.36 | |
| KOG0495 | 913 | consensus HAT repeat protein [RNA processing and m | 97.36 | |
| PF13181 | 34 | TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ | 97.35 | |
| KOG2053 | 932 | consensus Mitochondrial inheritance and actin cyto | 97.31 | |
| PF13424 | 78 | TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 | 97.27 | |
| PF04184 | 539 | ST7: ST7 protein; InterPro: IPR007311 The ST7 (for | 97.25 | |
| KOG0551 | 390 | consensus Hsp90 co-chaperone CNS1 (contains TPR re | 97.23 | |
| PF05843 | 280 | Suf: Suppressor of forked protein (Suf); InterPro: | 97.22 | |
| PF03704 | 146 | BTAD: Bacterial transcriptional activator domain; | 97.22 | |
| COG4700 | 251 | Uncharacterized protein conserved in bacteria cont | 97.19 | |
| KOG3785 | 557 | consensus Uncharacterized conserved protein [Funct | 97.15 | |
| COG3071 | 400 | HemY Uncharacterized enzyme of heme biosynthesis [ | 97.11 | |
| PF12569 | 517 | NARP1: NMDA receptor-regulated protein 1 ; InterPr | 97.05 | |
| PF14561 | 90 | TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S | 97.03 | |
| KOG4642 | 284 | consensus Chaperone-dependent E3 ubiquitin protein | 96.96 | |
| smart00028 | 34 | TPR Tetratricopeptide repeats. Repeats present in | 96.94 | |
| PF08424 | 321 | NRDE-2: NRDE-2, necessary for RNA interference; In | 96.92 | |
| KOG1130 | 639 | consensus Predicted G-alpha GTPase interaction pro | 96.9 | |
| PLN03077 | 857 | Protein ECB2; Provisional | 96.85 | |
| PF13281 | 374 | DUF4071: Domain of unknown function (DUF4071) | 96.83 | |
| PLN03081 | 697 | pentatricopeptide (PPR) repeat-containing protein; | 96.81 | |
| PF14853 | 53 | Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe | 96.7 | |
| PF14561 | 90 | TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S | 96.69 | |
| KOG3081 | 299 | consensus Vesicle coat complex COPI, epsilon subun | 96.66 | |
| KOG3824 | 472 | consensus Huntingtin interacting protein HYPE [Gen | 96.66 | |
| PF14938 | 282 | SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 | 96.56 | |
| PLN03081 | 697 | pentatricopeptide (PPR) repeat-containing protein; | 96.54 | |
| PF13174 | 33 | TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ | 96.5 | |
| COG3071 | 400 | HemY Uncharacterized enzyme of heme biosynthesis [ | 96.46 | |
| PRK10941 | 269 | hypothetical protein; Provisional | 96.43 | |
| PF10300 | 468 | DUF3808: Protein of unknown function (DUF3808); In | 96.42 | |
| KOG1130 | 639 | consensus Predicted G-alpha GTPase interaction pro | 96.41 | |
| COG4105 | 254 | ComL DNA uptake lipoprotein [General function pred | 96.38 | |
| PF14938 | 282 | SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 | 96.33 | |
| PLN03077 | 857 | Protein ECB2; Provisional | 96.27 | |
| KOG2376 | 652 | consensus Signal recognition particle, subunit Srp | 96.27 | |
| PF13374 | 42 | TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT | 96.26 | |
| KOG2396 | 568 | consensus HAT (Half-A-TPR) repeat-containing prote | 96.15 | |
| KOG3081 | 299 | consensus Vesicle coat complex COPI, epsilon subun | 96.15 | |
| PF13176 | 36 | TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ | 96.11 | |
| COG4105 | 254 | ComL DNA uptake lipoprotein [General function pred | 96.06 | |
| KOG3824 | 472 | consensus Huntingtin interacting protein HYPE [Gen | 96.02 | |
| PF14853 | 53 | Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe | 96.01 | |
| KOG4340 | 459 | consensus Uncharacterized conserved protein [Funct | 95.95 | |
| KOG4340 | 459 | consensus Uncharacterized conserved protein [Funct | 95.85 | |
| KOG0376 | 476 | consensus Serine-threonine phosphatase 2A, catalyt | 95.77 | |
| KOG2376 | 652 | consensus Signal recognition particle, subunit Srp | 95.71 | |
| COG3118 | 304 | Thioredoxin domain-containing protein [Posttransla | 95.67 | |
| COG4976 | 287 | Predicted methyltransferase (contains TPR repeat) | 95.65 | |
| PLN03218 | 1060 | maturation of RBCL 1; Provisional | 95.63 | |
| PRK04841 | 903 | transcriptional regulator MalT; Provisional | 95.62 | |
| KOG3785 | 557 | consensus Uncharacterized conserved protein [Funct | 95.58 | |
| PF04781 | 111 | DUF627: Protein of unknown function (DUF627); Inte | 95.45 | |
| PLN03218 | 1060 | maturation of RBCL 1; Provisional | 95.43 | |
| KOG0545 | 329 | consensus Aryl-hydrocarbon receptor-interacting pr | 95.43 | |
| PRK10941 | 269 | hypothetical protein; Provisional | 95.41 | |
| KOG1941 | 518 | consensus Acetylcholine receptor-associated protei | 95.33 | |
| PF13281 | 374 | DUF4071: Domain of unknown function (DUF4071) | 95.26 | |
| PF05843 | 280 | Suf: Suppressor of forked protein (Suf); InterPro: | 95.16 | |
| COG4976 | 287 | Predicted methyltransferase (contains TPR repeat) | 95.16 | |
| PF09986 | 214 | DUF2225: Uncharacterized protein conserved in bact | 95.07 | |
| KOG1310 | 758 | consensus WD40 repeat protein [General function pr | 95.04 | |
| PF12968 | 144 | DUF3856: Domain of Unknown Function (DUF3856); Int | 95.02 | |
| PF13374 | 42 | TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT | 94.92 | |
| PRK04841 | 903 | transcriptional regulator MalT; Provisional | 94.71 | |
| PF04781 | 111 | DUF627: Protein of unknown function (DUF627); Inte | 94.6 | |
| KOG2053 | 932 | consensus Mitochondrial inheritance and actin cyto | 94.57 | |
| COG3118 | 304 | Thioredoxin domain-containing protein [Posttransla | 94.39 | |
| PF03704 | 146 | BTAD: Bacterial transcriptional activator domain; | 94.38 | |
| KOG1941 | 518 | consensus Acetylcholine receptor-associated protei | 94.32 | |
| PF08424 | 321 | NRDE-2: NRDE-2, necessary for RNA interference; In | 94.29 | |
| KOG1070 | 1710 | consensus rRNA processing protein Rrp5 [RNA proces | 93.85 | |
| COG3914 | 620 | Spy Predicted O-linked N-acetylglucosamine transfe | 93.76 | |
| KOG4814 | 872 | consensus Uncharacterized conserved protein [Funct | 93.75 | |
| PF10373 | 278 | EST1_DNA_bind: Est1 DNA/RNA binding domain; InterP | 93.28 | |
| PF09613 | 160 | HrpB1_HrpK: Bacterial type III secretion protein ( | 93.18 | |
| KOG1586 | 288 | consensus Protein required for fusion of vesicles | 93.05 | |
| KOG1915 | 677 | consensus Cell cycle control protein (crooked neck | 92.93 | |
| KOG2796 | 366 | consensus Uncharacterized conserved protein [Funct | 92.9 | |
| PF04190 | 260 | DUF410: Protein of unknown function (DUF410) ; Int | 92.79 | |
| PF07720 | 36 | TPR_3: Tetratricopeptide repeat; InterPro: IPR0117 | 92.57 | |
| PF12862 | 94 | Apc5: Anaphase-promoting complex subunit 5 | 92.57 | |
| COG3914 | 620 | Spy Predicted O-linked N-acetylglucosamine transfe | 92.29 | |
| PF04184 | 539 | ST7: ST7 protein; InterPro: IPR007311 The ST7 (for | 92.17 | |
| KOG2796 | 366 | consensus Uncharacterized conserved protein [Funct | 92.02 | |
| COG5191 | 435 | Uncharacterized conserved protein, contains HAT (H | 91.87 | |
| KOG1308 | 377 | consensus Hsp70-interacting protein Hip/Transient | 91.82 | |
| PF02259 | 352 | FAT: FAT domain; InterPro: IPR003151 The FAT domai | 91.43 | |
| KOG0551 | 390 | consensus Hsp90 co-chaperone CNS1 (contains TPR re | 91.36 | |
| PRK13184 | 932 | pknD serine/threonine-protein kinase; Reviewed | 91.31 | |
| PF10516 | 38 | SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat | 91.16 | |
| COG2976 | 207 | Uncharacterized protein conserved in bacteria [Fun | 91.14 | |
| KOG1915 | 677 | consensus Cell cycle control protein (crooked neck | 91.09 | |
| KOG2396 | 568 | consensus HAT (Half-A-TPR) repeat-containing prote | 91.03 | |
| KOG2471 | 696 | consensus TPR repeat-containing protein [General f | 90.86 | |
| PF07079 | 549 | DUF1347: Protein of unknown function (DUF1347); In | 90.67 | |
| KOG2610 | 491 | consensus Uncharacterized conserved protein [Funct | 90.64 | |
| KOG1070 | 1710 | consensus rRNA processing protein Rrp5 [RNA proces | 90.53 | |
| COG2912 | 269 | Uncharacterized conserved protein [Function unknow | 90.29 | |
| KOG0529 | 421 | consensus Protein geranylgeranyltransferase type I | 90.11 | |
| PF10516 | 38 | SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat | 89.92 | |
| COG0790 | 292 | FOG: TPR repeat, SEL1 subfamily [General function | 89.91 | |
| PF07721 | 26 | TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 | 89.8 | |
| PF10373 | 278 | EST1_DNA_bind: Est1 DNA/RNA binding domain; InterP | 89.79 | |
| PF09613 | 160 | HrpB1_HrpK: Bacterial type III secretion protein ( | 89.77 | |
| KOG2610 | 491 | consensus Uncharacterized conserved protein [Funct | 89.51 | |
| KOG1550 | 552 | consensus Extracellular protein SEL-1 and related | 88.92 | |
| COG5191 | 435 | Uncharacterized conserved protein, contains HAT (H | 88.86 | |
| PF02259 | 352 | FAT: FAT domain; InterPro: IPR003151 The FAT domai | 88.68 | |
| COG2912 | 269 | Uncharacterized conserved protein [Function unknow | 88.67 | |
| KOG2047 | 835 | consensus mRNA splicing factor [RNA processing and | 88.53 | |
| COG0790 | 292 | FOG: TPR repeat, SEL1 subfamily [General function | 88.52 | |
| PF11207 | 203 | DUF2989: Protein of unknown function (DUF2989); In | 88.45 | |
| PF12862 | 94 | Apc5: Anaphase-promoting complex subunit 5 | 88.08 | |
| PF04910 | 360 | Tcf25: Transcriptional repressor TCF25; InterPro: | 87.61 | |
| COG3629 | 280 | DnrI DNA-binding transcriptional activator of the | 87.61 | |
| PTZ00441 | 576 | sporozoite surface protein 2 (SSP2); Provisional | 87.5 | |
| KOG2047 | 835 | consensus mRNA splicing factor [RNA processing and | 86.51 | |
| TIGR02561 | 153 | HrpB1_HrpK type III secretion protein HrpB1/HrpK. | 86.08 | |
| KOG1585 | 308 | consensus Protein required for fusion of vesicles | 85.98 | |
| KOG0530 | 318 | consensus Protein farnesyltransferase, alpha subun | 85.87 | |
| smart00386 | 33 | HAT HAT (Half-A-TPR) repeats. Present in several R | 85.82 | |
| KOG0546 | 372 | consensus HSP90 co-chaperone CPR7/Cyclophilin [Pos | 84.93 | |
| COG3898 | 531 | Uncharacterized membrane-bound protein [Function u | 84.91 | |
| KOG2471 | 696 | consensus TPR repeat-containing protein [General f | 84.87 | |
| KOG4507 | 886 | consensus Uncharacterized conserved protein, conta | 84.79 | |
| PF09797 | 365 | NatB_MDM20: N-acetyltransferase B complex (NatB) n | 84.54 | |
| PF10300 | 468 | DUF3808: Protein of unknown function (DUF3808); In | 84.37 | |
| KOG1550 | 552 | consensus Extracellular protein SEL-1 and related | 84.05 | |
| PF10579 | 80 | Rapsyn_N: Rapsyn N-terminal myristoylation and lin | 83.46 | |
| KOG3364 | 149 | consensus Membrane protein involved in organellar | 83.35 | |
| COG3947 | 361 | Response regulator containing CheY-like receiver a | 82.71 | |
| COG4455 | 273 | ImpE Protein of avirulence locus involved in tempe | 82.39 | |
| PF09986 | 214 | DUF2225: Uncharacterized protein conserved in bact | 81.71 | |
| smart00299 | 140 | CLH Clathrin heavy chain repeat homology. | 81.65 | |
| PF07721 | 26 | TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 | 81.64 | |
| KOG1914 | 656 | consensus mRNA cleavage and polyadenylation factor | 80.97 | |
| smart00671 | 36 | SEL1 Sel1-like repeats. These represent a subfamil | 80.3 | |
| PF11846 | 193 | DUF3366: Domain of unknown function (DUF3366); Int | 80.22 | |
| smart00386 | 33 | HAT HAT (Half-A-TPR) repeats. Present in several R | 80.16 | |
| KOG0529 | 421 | consensus Protein geranylgeranyltransferase type I | 80.06 |
| >PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins | Back alignment and domain information |
|---|
Probab=100.00 E-value=2.1e-64 Score=411.11 Aligned_cols=184 Identities=68% Similarity=1.067 Sum_probs=127.3
Q ss_pred HHHhchHHHHHHHHHHHHhhCCCCHHHHHHHHHHHHHhcCCcccccccccHHHHHHHHHHHHHhCCCCHHHHHHHHHHHH
Q 028992 8 FDRLLLSEHNRKTAEANYAKDPLDADNLTRWGEALLELSQFESVSDSKKIINEAISKFEEALVIDPAKHYTLWSLGNAHT 87 (200)
Q Consensus 8 ~~~l~~fe~A~~~~e~a~~~~P~d~~~l~~lG~al~~l~~~~~~~~~~~~~~eAi~~le~AL~ldP~~~~a~~~LG~a~~ 87 (200)
||||++||+||+.++.+|..||+|++++++||++|+++++|+++.+++.|+++||++|++||.|||++++++||||++|+
T Consensus 1 ~~rl~~FE~ark~aea~y~~nP~DadnL~~WG~ALLELAqfk~g~es~~miedAisK~eeAL~I~P~~hdAlw~lGnA~t 80 (186)
T PF06552_consen 1 FERLLFFEHARKKAEAAYAKNPLDADNLTNWGGALLELAQFKQGPESKKMIEDAISKFEEALKINPNKHDALWCLGNAYT 80 (186)
T ss_dssp HHHHHHHHHHHHHHHHHHHH-TT-HHHHHHHHHHHHHHHHHS-HHHHHHHHHHHHHHHHHHHHH-TT-HHHHHHHHHHHH
T ss_pred ChHHHHHHHHHHHHHHHHHhCcHhHHHHHHHHHHHHHHHhccCcchHHHHHHHHHHHHHHHHhcCCchHHHHHHHHHHHH
Confidence 79999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred hcCcccCChHHhhcCHHHHHHHHHHHHHhCCCCHHHHHHHHhCCCChHHHHHHHHHHHhccccCCCCCcc--hhhhhccc
Q 028992 88 SCGFLTADLSEAKGDFDKASECFQRAVDEEPTNELYQKSLEVSTKAPELHMELHKHGINQQTLGGGSSAS--SAQSSKKK 165 (200)
Q Consensus 88 ~~G~l~~~~~~a~~~~d~A~~~fqkAl~l~P~~~~y~kAle~~~k~~e~~~~l~~~~~~~~~~~~~~~~~--~~~~~~~~ 165 (200)
++|||+||..+|++.|++|..||++|++++|+|+.|+++|++..|+|++|.++++++++||+++++++++ .+.+|+||
T Consensus 81 s~A~l~~d~~~A~~~F~kA~~~FqkAv~~~P~ne~Y~ksLe~~~kap~lh~e~~~~~~~~q~~~~~~~~~~~~~~~k~kk 160 (186)
T PF06552_consen 81 SLAFLTPDTAEAEEYFEKATEYFQKAVDEDPNNELYRKSLEMAAKAPELHMEIHKQGLGQQAMGGASSSSSSAKSSKKKK 160 (186)
T ss_dssp HHHHH---HHHHHHHHHHHHHHHHHHHHH-TT-HHHHHHHHHHHTHHHHHHHHHHSSS----------------------
T ss_pred HHHhhcCChHHHHHHHHHHHHHHHHHHhcCCCcHHHHHHHHHHHhhHHHHHHHHHHHhhhhhccCCCCCCCCcccccccc
Confidence 9999999999999999999999999999999999999999999999999999999999999876653333 38899999
Q ss_pred ccchhhhhhhHHHHHHHHHHHHHHhh
Q 028992 166 SSDLKYDIFGWAILAVGIVAWVGMAN 191 (200)
Q Consensus 166 ~~~~~y~~~g~~~l~~~~~~~~~~~~ 191 (200)
+|||||||+||||||+|||+||||||
T Consensus 161 ~sd~~ydv~gwvil~~givawv~~ak 186 (186)
T PF06552_consen 161 SSDFKYDVFGWVILAVGIVAWVGMAK 186 (186)
T ss_dssp --------------------------
T ss_pred ccchhhhhcchHHHHHHHHHHHhhcC
Confidence 99999999999999999999999997
|
Most mitochondrial proteins are encoded by the nuclear genome, and are synthesised in the cytosol. TOM20 is a general import receptor that binds to mitochondrial pre-sequences in the early step of protein import into the mitochondria [].; GO: 0045040 protein import into mitochondrial outer membrane, 0005742 mitochondrial outer membrane translocase complex; PDB: 1ZU2_A. |
| >KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK15359 type III secretion system chaperone protein SscB; Provisional | Back alignment and domain information |
|---|
| >TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) | Back alignment and domain information |
|---|
| >KOG0553 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11189 lipoprotein NlpI; Provisional | Back alignment and domain information |
|---|
| >PRK15359 type III secretion system chaperone protein SscB; Provisional | Back alignment and domain information |
|---|
| >PRK12370 invasion protein regulator; Provisional | Back alignment and domain information |
|---|
| >TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD | Back alignment and domain information |
|---|
| >PRK12370 invasion protein regulator; Provisional | Back alignment and domain information |
|---|
| >PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional | Back alignment and domain information |
|---|
| >TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) | Back alignment and domain information |
|---|
| >PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional | Back alignment and domain information |
|---|
| >PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A | Back alignment and domain information |
|---|
| >PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional | Back alignment and domain information |
|---|
| >PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional | Back alignment and domain information |
|---|
| >TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW | Back alignment and domain information |
|---|
| >PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional | Back alignment and domain information |
|---|
| >PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional | Back alignment and domain information |
|---|
| >COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >KOG1125 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK15174 Vi polysaccharide export protein VexE; Provisional | Back alignment and domain information |
|---|
| >PRK11189 lipoprotein NlpI; Provisional | Back alignment and domain information |
|---|
| >TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD | Back alignment and domain information |
|---|
| >TIGR02795 tol_pal_ybgF tol-pal system protein YbgF | Back alignment and domain information |
|---|
| >PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B | Back alignment and domain information |
|---|
| >cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C | Back alignment and domain information |
|---|
| >TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW | Back alignment and domain information |
|---|
| >TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO | Back alignment and domain information |
|---|
| >PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional | Back alignment and domain information |
|---|
| >KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein | Back alignment and domain information |
|---|
| >PRK11447 cellulose synthase subunit BcsC; Provisional | Back alignment and domain information |
|---|
| >KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein | Back alignment and domain information |
|---|
| >PRK11447 cellulose synthase subunit BcsC; Provisional | Back alignment and domain information |
|---|
| >PRK15174 Vi polysaccharide export protein VexE; Provisional | Back alignment and domain information |
|---|
| >KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PRK02603 photosystem I assembly protein Ycf3; Provisional | Back alignment and domain information |
|---|
| >CHL00033 ycf3 photosystem I assembly protein Ycf3 | Back alignment and domain information |
|---|
| >PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional | Back alignment and domain information |
|---|
| >PLN02789 farnesyltranstransferase | Back alignment and domain information |
|---|
| >PRK11788 tetratricopeptide repeat protein; Provisional | Back alignment and domain information |
|---|
| >PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A | Back alignment and domain information |
|---|
| >PRK10049 pgaA outer membrane protein PgaA; Provisional | Back alignment and domain information |
|---|
| >PLN02789 farnesyltranstransferase | Back alignment and domain information |
|---|
| >COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B | Back alignment and domain information |
|---|
| >PRK11788 tetratricopeptide repeat protein; Provisional | Back alignment and domain information |
|---|
| >PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B | Back alignment and domain information |
|---|
| >PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional | Back alignment and domain information |
|---|
| >KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1125 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3060 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional | Back alignment and domain information |
|---|
| >PRK10803 tol-pal system protein YbgF; Provisional | Back alignment and domain information |
|---|
| >PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional | Back alignment and domain information |
|---|
| >KOG0553 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A | Back alignment and domain information |
|---|
| >KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13371 TPR_9: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >PRK10049 pgaA outer membrane protein PgaA; Provisional | Back alignment and domain information |
|---|
| >COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK15331 chaperone protein SicA; Provisional | Back alignment and domain information |
|---|
| >KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B | Back alignment and domain information |
|---|
| >PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A | Back alignment and domain information |
|---|
| >PRK11906 transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C | Back alignment and domain information |
|---|
| >CHL00033 ycf3 photosystem I assembly protein Ycf3 | Back alignment and domain information |
|---|
| >PRK11906 transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >TIGR02795 tol_pal_ybgF tol-pal system protein YbgF | Back alignment and domain information |
|---|
| >KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO | Back alignment and domain information |
|---|
| >PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A | Back alignment and domain information |
|---|
| >PRK10153 DNA-binding transcriptional activator CadC; Provisional | Back alignment and domain information |
|---|
| >PRK02603 photosystem I assembly protein Ycf3; Provisional | Back alignment and domain information |
|---|
| >PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H | Back alignment and domain information |
|---|
| >cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals | Back alignment and domain information |
|---|
| >PRK14574 hmsH outer membrane protein; Provisional | Back alignment and domain information |
|---|
| >KOG1129 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK10153 DNA-binding transcriptional activator CadC; Provisional | Back alignment and domain information |
|---|
| >PF13371 TPR_9: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >PF12688 TPR_5: Tetratrico peptide repeat | Back alignment and domain information |
|---|
| >cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals | Back alignment and domain information |
|---|
| >KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3060 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >TIGR00540 hemY_coli hemY protein | Back alignment and domain information |
|---|
| >KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] | Back alignment and domain information |
|---|
| >COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14574 hmsH outer membrane protein; Provisional | Back alignment and domain information |
|---|
| >KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >PF13431 TPR_17: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >KOG1129 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10747 putative protoheme IX biogenesis protein; Provisional | Back alignment and domain information |
|---|
| >KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] | Back alignment and domain information |
|---|
| >PRK10747 putative protoheme IX biogenesis protein; Provisional | Back alignment and domain information |
|---|
| >PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function | Back alignment and domain information |
|---|
| >KOG4234 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins | Back alignment and domain information |
|---|
| >KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2003 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] | Back alignment and domain information |
|---|
| >PRK10803 tol-pal system protein YbgF; Provisional | Back alignment and domain information |
|---|
| >PF13428 TPR_14: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR00540 hemY_coli hemY protein | Back alignment and domain information |
|---|
| >KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK10866 outer membrane biogenesis protein BamD; Provisional | Back alignment and domain information |
|---|
| >KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] | Back alignment and domain information |
|---|
| >KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] | Back alignment and domain information |
|---|
| >KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional | Back alignment and domain information |
|---|
| >KOG1840 consensus Kinesin light chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13512 TPR_18: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] | Back alignment and domain information |
|---|
| >KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF12688 TPR_5: Tetratrico peptide repeat | Back alignment and domain information |
|---|
| >PRK10866 outer membrane biogenesis protein BamD; Provisional | Back alignment and domain information |
|---|
| >PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A | Back alignment and domain information |
|---|
| >PF13428 TPR_14: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A | Back alignment and domain information |
|---|
| >PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional | Back alignment and domain information |
|---|
| >PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment | Back alignment and domain information |
|---|
| >PRK15331 chaperone protein SicA; Provisional | Back alignment and domain information |
|---|
| >COG1729 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi | Back alignment and domain information |
|---|
| >PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A | Back alignment and domain information |
|---|
| >PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi | Back alignment and domain information |
|---|
| >KOG4555 consensus TPR repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional | Back alignment and domain information |
|---|
| >PF13431 TPR_17: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function | Back alignment and domain information |
|---|
| >PF13512 TPR_18: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A | Back alignment and domain information |
|---|
| >COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >KOG2003 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >COG0457 NrfG FOG: TPR repeat [General function prediction only] | Back alignment and domain information |
|---|
| >COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] | Back alignment and domain information |
|---|
| >COG0457 NrfG FOG: TPR repeat [General function prediction only] | Back alignment and domain information |
|---|
| >COG1729 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG4555 consensus TPR repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment | Back alignment and domain information |
|---|
| >PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A | Back alignment and domain information |
|---|
| >KOG1840 consensus Kinesin light chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0495 consensus HAT repeat protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG4234 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] | Back alignment and domain information |
|---|
| >smart00028 TPR Tetratricopeptide repeats | Back alignment and domain information |
|---|
| >PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala | Back alignment and domain information |
|---|
| >PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A | Back alignment and domain information |
|---|
| >COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] | Back alignment and domain information |
|---|
| >KOG0495 consensus HAT repeat protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A | Back alignment and domain information |
|---|
| >KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H | Back alignment and domain information |
|---|
| >PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene | Back alignment and domain information |
|---|
| >KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins | Back alignment and domain information |
|---|
| >PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production | Back alignment and domain information |
|---|
| >COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] | Back alignment and domain information |
|---|
| >KOG3785 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala | Back alignment and domain information |
|---|
| >PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B | Back alignment and domain information |
|---|
| >KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >smart00028 TPR Tetratricopeptide repeats | Back alignment and domain information |
|---|
| >PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN03077 Protein ECB2; Provisional | Back alignment and domain information |
|---|
| >PF13281 DUF4071: Domain of unknown function (DUF4071) | Back alignment and domain information |
|---|
| >PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional | Back alignment and domain information |
|---|
| >PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A | Back alignment and domain information |
|---|
| >PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B | Back alignment and domain information |
|---|
| >KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] | Back alignment and domain information |
|---|
| >PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A | Back alignment and domain information |
|---|
| >PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional | Back alignment and domain information |
|---|
| >PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A | Back alignment and domain information |
|---|
| >COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK10941 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans | Back alignment and domain information |
|---|
| >KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG4105 ComL DNA uptake lipoprotein [General function prediction only] | Back alignment and domain information |
|---|
| >PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A | Back alignment and domain information |
|---|
| >PLN03077 Protein ECB2; Provisional | Back alignment and domain information |
|---|
| >KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A | Back alignment and domain information |
|---|
| >KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A | Back alignment and domain information |
|---|
| >COG4105 ComL DNA uptake lipoprotein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] | Back alignment and domain information |
|---|
| >PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A | Back alignment and domain information |
|---|
| >KOG4340 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4340 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] | Back alignment and domain information |
|---|
| >PLN03218 maturation of RBCL 1; Provisional | Back alignment and domain information |
|---|
| >PRK04841 transcriptional regulator MalT; Provisional | Back alignment and domain information |
|---|
| >KOG3785 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function | Back alignment and domain information |
|---|
| >PLN03218 maturation of RBCL 1; Provisional | Back alignment and domain information |
|---|
| >KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK10941 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] | Back alignment and domain information |
|---|
| >PF13281 DUF4071: Domain of unknown function (DUF4071) | Back alignment and domain information |
|---|
| >PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins | Back alignment and domain information |
|---|
| >COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] | Back alignment and domain information |
|---|
| >PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function | Back alignment and domain information |
|---|
| >KOG1310 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT | Back alignment and domain information |
|---|
| >PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A | Back alignment and domain information |
|---|
| >PRK04841 transcriptional regulator MalT; Provisional | Back alignment and domain information |
|---|
| >PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function | Back alignment and domain information |
|---|
| >KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production | Back alignment and domain information |
|---|
| >KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] | Back alignment and domain information |
|---|
| >PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4814 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF10373 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterPro: IPR018834 Est1 is a protein which recruits or activates telomerase at the site of polymerisation [, ] | Back alignment and domain information |
|---|
| >PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia | Back alignment and domain information |
|---|
| >KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG2796 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF04190 DUF410: Protein of unknown function (DUF410) ; InterPro: IPR007317 This is a family of conserved eukaryotic proteins with undetermined function | Back alignment and domain information |
|---|
| >PF07720 TPR_3: Tetratricopeptide repeat; InterPro: IPR011716 This entry includes tetratricopeptide-like repeats found in the LcrH/SycD-like chaperones [] | Back alignment and domain information |
|---|
| >PF12862 Apc5: Anaphase-promoting complex subunit 5 | Back alignment and domain information |
|---|
| >COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene | Back alignment and domain information |
|---|
| >KOG2796 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >COG5191 Uncharacterized conserved protein, contains HAT (Half-A-TPR) repeat [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases | Back alignment and domain information |
|---|
| >KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK13184 pknD serine/threonine-protein kinase; Reviewed | Back alignment and domain information |
|---|
| >PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >COG2976 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2471 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length | Back alignment and domain information |
|---|
| >KOG2610 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG2912 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0529 consensus Protein geranylgeranyltransferase type II, alpha subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] | Back alignment and domain information |
|---|
| >PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models | Back alignment and domain information |
|---|
| >PF10373 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterPro: IPR018834 Est1 is a protein which recruits or activates telomerase at the site of polymerisation [, ] | Back alignment and domain information |
|---|
| >PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia | Back alignment and domain information |
|---|
| >KOG2610 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG5191 Uncharacterized conserved protein, contains HAT (Half-A-TPR) repeat [General function prediction only] | Back alignment and domain information |
|---|
| >PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases | Back alignment and domain information |
|---|
| >COG2912 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2047 consensus mRNA splicing factor [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] | Back alignment and domain information |
|---|
| >PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed | Back alignment and domain information |
|---|
| >PF12862 Apc5: Anaphase-promoting complex subunit 5 | Back alignment and domain information |
|---|
| >PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] | Back alignment and domain information |
|---|
| >COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PTZ00441 sporozoite surface protein 2 (SSP2); Provisional | Back alignment and domain information |
|---|
| >KOG2047 consensus mRNA splicing factor [RNA processing and modification] | Back alignment and domain information |
|---|
| >TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK | Back alignment and domain information |
|---|
| >KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0530 consensus Protein farnesyltransferase, alpha subunit/protein geranylgeranyltransferase type I, alpha subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >smart00386 HAT HAT (Half-A-TPR) repeats | Back alignment and domain information |
|---|
| >KOG0546 consensus HSP90 co-chaperone CPR7/Cyclophilin [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG3898 Uncharacterized membrane-bound protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2471 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] | Back alignment and domain information |
|---|
| >PF09797 NatB_MDM20: N-acetyltransferase B complex (NatB) non catalytic subunit; InterPro: IPR019183 This is the non-catalytic subunit of the N-terminal acetyltransferase B complex (NatB) | Back alignment and domain information |
|---|
| >PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans | Back alignment and domain information |
|---|
| >KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane | Back alignment and domain information |
|---|
| >KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] | Back alignment and domain information |
|---|
| >COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG4455 ImpE Protein of avirulence locus involved in temperature-dependent protein secretion [General function prediction only] | Back alignment and domain information |
|---|
| >PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function | Back alignment and domain information |
|---|
| >smart00299 CLH Clathrin heavy chain repeat homology | Back alignment and domain information |
|---|
| >PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models | Back alignment and domain information |
|---|
| >KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] | Back alignment and domain information |
|---|
| >smart00671 SEL1 Sel1-like repeats | Back alignment and domain information |
|---|
| >PF11846 DUF3366: Domain of unknown function (DUF3366); InterPro: IPR021797 This domain is functionally uncharacterised | Back alignment and domain information |
|---|
| >smart00386 HAT HAT (Half-A-TPR) repeats | Back alignment and domain information |
|---|
| >KOG0529 consensus Protein geranylgeranyltransferase type II, alpha subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 200 | ||||
| 1zu2_A | 158 | Solution Nmr Structure Of The Plant Tom20 Mitochond | 3e-44 | ||
| 1na0_A | 125 | Design Of Stable Alpha-Helical Arrays From An Ideal | 2e-04 |
| >pdb|1ZU2|A Chain A, Solution Nmr Structure Of The Plant Tom20 Mitochondrial Import Receptor From Arabidopsis Thaliana Length = 158 | Back alignment and structure |
|
| >pdb|1NA0|A Chain A, Design Of Stable Alpha-Helical Arrays From An Idealized Tpr Motif Length = 125 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 200 | |||
| 1zu2_A | 158 | Mitochondrial import receptor subunit TOM20-3; TPR | 1e-57 | |
| 3gyz_A | 151 | Chaperone protein IPGC; asymmetric homodimer, tetr | 1e-08 | |
| 3urz_A | 208 | Uncharacterized protein; tetratricopeptide repeats | 4e-08 | |
| 3urz_A | 208 | Uncharacterized protein; tetratricopeptide repeats | 4e-06 | |
| 3urz_A | 208 | Uncharacterized protein; tetratricopeptide repeats | 7e-06 | |
| 2pl2_A | 217 | Hypothetical conserved protein TTC0263; TPR, prote | 4e-07 | |
| 2pl2_A | 217 | Hypothetical conserved protein TTC0263; TPR, prote | 1e-04 | |
| 2e2e_A | 177 | Formate-dependent nitrite reductase complex NRFG; | 9e-07 | |
| 2xcb_A | 142 | PCRH, regulatory protein PCRH; protein transport, | 2e-06 | |
| 2xcb_A | 142 | PCRH, regulatory protein PCRH; protein transport, | 2e-04 | |
| 4gcn_A | 127 | Protein STI-1; structural genomics, PSI-biology, m | 2e-06 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 4e-06 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 7e-05 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 4e-06 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 5e-06 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 3e-05 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 5e-05 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 1e-04 | |
| 2kat_A | 115 | Uncharacterized protein; NESG, structure, structur | 5e-06 | |
| 2kat_A | 115 | Uncharacterized protein; NESG, structure, structur | 2e-04 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 7e-06 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 9e-05 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 2e-04 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 5e-04 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 6e-04 | |
| 2vgx_A | 148 | Chaperone SYCD; alternative dimer assembly, tetrat | 9e-06 | |
| 2vgx_A | 148 | Chaperone SYCD; alternative dimer assembly, tetrat | 9e-05 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 1e-05 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 6e-05 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 8e-05 | |
| 2kc7_A | 99 | BFR218_protein; tetratricopeptide repeat, all-alph | 1e-05 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 1e-05 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 2e-05 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 3e-05 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 8e-05 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 9e-05 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 1e-04 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 1e-04 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 1e-04 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 4e-04 | |
| 1elr_A | 131 | TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp | 2e-05 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 2e-05 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 5e-05 | |
| 1hxi_A | 121 | PEX5, peroxisome targeting signal 1 receptor PEX5; | 2e-05 | |
| 1hxi_A | 121 | PEX5, peroxisome targeting signal 1 receptor PEX5; | 2e-04 | |
| 3k9i_A | 117 | BH0479 protein; putative protein binding protein, | 3e-05 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 3e-05 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 4e-05 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 8e-04 | |
| 3v6t_A | 499 | DHAX3; tandem repeats, DNA specific binding protei | 4e-05 | |
| 3v6t_A | 499 | DHAX3; tandem repeats, DNA specific binding protei | 6e-05 | |
| 3v6t_A | 499 | DHAX3; tandem repeats, DNA specific binding protei | 7e-05 | |
| 3v6t_A | 499 | DHAX3; tandem repeats, DNA specific binding protei | 8e-04 | |
| 4abn_A | 474 | Tetratricopeptide repeat protein 5; P53 cofactor, | 4e-05 | |
| 4abn_A | 474 | Tetratricopeptide repeat protein 5; P53 cofactor, | 5e-05 | |
| 4g1t_A | 472 | Interferon-induced protein with tetratricopeptide | 6e-05 | |
| 4g1t_A | 472 | Interferon-induced protein with tetratricopeptide | 7e-05 | |
| 3tax_A | 723 | UDP-N-acetylglucosamine--peptide N- acetylglucosam | 7e-05 | |
| 3tax_A | 723 | UDP-N-acetylglucosamine--peptide N- acetylglucosam | 1e-04 | |
| 2vsy_A | 568 | XCC0866; transferase, glycosyl transferase, GT-B, | 9e-05 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 1e-04 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-04 | |
| 2ho1_A | 252 | Type 4 fimbrial biogenesis protein PILF; type IV p | 2e-04 | |
| 2ho1_A | 252 | Type 4 fimbrial biogenesis protein PILF; type IV p | 3e-04 | |
| 3ma5_A | 100 | Tetratricopeptide repeat domain protein; NESG, str | 2e-04 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 2e-04 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 3e-04 | |
| 2vq2_A | 225 | PILW, putative fimbrial biogenesis and twitching m | 2e-04 | |
| 2vq2_A | 225 | PILW, putative fimbrial biogenesis and twitching m | 3e-04 | |
| 2vq2_A | 225 | PILW, putative fimbrial biogenesis and twitching m | 5e-04 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 2e-04 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 6e-04 | |
| 2fo7_A | 136 | Synthetic consensus TPR protein; tetratricopeptide | 2e-04 | |
| 1fch_A | 368 | Peroxisomal targeting signal 1 receptor; protein-p | 3e-04 | |
| 2vyi_A | 131 | SGTA protein; chaperone, TPR repeat, phosphoprotei | 3e-04 | |
| 1xnf_A | 275 | Lipoprotein NLPI; TPR, tetratricopeptide, structur | 4e-04 | |
| 3ro2_A | 338 | PINS homolog, G-protein-signaling modulator 2; TPR | 7e-04 |
| >1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Length = 158 | Back alignment and structure |
|---|
Score = 178 bits (451), Expect = 1e-57
Identities = 83/146 (56%), Positives = 110/146 (75%)
Query: 3 FSQSDFDRLLLSEHNRKTAEANYAKDPLDADNLTRWGEALLELSQFESVSDSKKIINEAI 62
++++FDR+LL E R+ AE Y +PLDADNLTRWG LLELSQF S+SD+K++I EAI
Sbjct: 7 DTETEFDRILLFEQIRQDAENTYKSNPLDADNLTRWGGVLLELSQFHSISDAKQMIQEAI 66
Query: 63 SKFEEALVIDPAKHYTLWSLGNAHTSCGFLTADLSEAKGDFDKASECFQRAVDEEPTNEL 122
+KFEEAL+IDP K +W +GNA+TS FLT D +EAK +FD A++ FQ+AVDE+P N
Sbjct: 67 TKFEEALLIDPKKDEAVWCIGNAYTSFAFLTPDETEAKHNFDLATQFFQQAVDEQPDNTH 126
Query: 123 YQKSLEVSTKAPELHMELHKHGINQQ 148
Y KSLE++ KAP+LH E +K G+
Sbjct: 127 YLKSLEMTAKAPQLHAEAYKQGLGGS 152
|
| >3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 | Back alignment and structure |
|---|
| >3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 | Back alignment and structure |
|---|
| >3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 | Back alignment and structure |
|---|
| >3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 | Back alignment and structure |
|---|
| >2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 | Back alignment and structure |
|---|
| >2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 | Back alignment and structure |
|---|
| >2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 | Back alignment and structure |
|---|
| >2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 | Back alignment and structure |
|---|
| >2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 | Back alignment and structure |
|---|
| >4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Length = 127 | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 | Back alignment and structure |
|---|
| >2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 | Back alignment and structure |
|---|
| >2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 | Back alignment and structure |
|---|
| >2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 | Back alignment and structure |
|---|
| >2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 | Back alignment and structure |
|---|
| >2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Length = 99 | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 | Back alignment and structure |
|---|
| >1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Length = 131 | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 | Back alignment and structure |
|---|
| >1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 | Back alignment and structure |
|---|
| >1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 | Back alignment and structure |
|---|
| >3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 | Back alignment and structure |
|---|
| >3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 | Back alignment and structure |
|---|
| >3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 | Back alignment and structure |
|---|
| >3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 | Back alignment and structure |
|---|
| >3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 | Back alignment and structure |
|---|
| >4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 | Back alignment and structure |
|---|
| >4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 | Back alignment and structure |
|---|
| >4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 | Back alignment and structure |
|---|
| >4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 | Back alignment and structure |
|---|
| >3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 | Back alignment and structure |
|---|
| >3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 | Back alignment and structure |
|---|
| >2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 | Back alignment and structure |
|---|
| >2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 | Back alignment and structure |
|---|
| >3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 | Back alignment and structure |
|---|
| >2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 | Back alignment and structure |
|---|
| >2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 | Back alignment and structure |
|---|
| >2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 | Back alignment and structure |
|---|
| >2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 | Back alignment and structure |
|---|
| >1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 | Back alignment and structure |
|---|
| >2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 | Back alignment and structure |
|---|
| >1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 | Back alignment and structure |
|---|
| >3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 200 | |||
| 1zu2_A | 158 | Mitochondrial import receptor subunit TOM20-3; TPR | 100.0 | |
| 4gco_A | 126 | Protein STI-1; structural genomics, PSI-biology, m | 99.79 | |
| 4ga2_A | 150 | E3 SUMO-protein ligase ranbp2; TPR motif, nuclear | 99.78 | |
| 4gyw_A | 723 | UDP-N-acetylglucosamine--peptide N- acetylglucosam | 99.77 | |
| 2pl2_A | 217 | Hypothetical conserved protein TTC0263; TPR, prote | 99.76 | |
| 2h6f_A | 382 | Protein farnesyltransferase/geranylgeranyltransfer | 99.75 | |
| 3gyz_A | 151 | Chaperone protein IPGC; asymmetric homodimer, tetr | 99.75 | |
| 2pl2_A | 217 | Hypothetical conserved protein TTC0263; TPR, prote | 99.75 | |
| 4gco_A | 126 | Protein STI-1; structural genomics, PSI-biology, m | 99.74 | |
| 3vtx_A | 184 | MAMA; tetratricopeptide repeats (TPR) containing p | 99.73 | |
| 2h6f_A | 382 | Protein farnesyltransferase/geranylgeranyltransfer | 99.7 | |
| 4ga2_A | 150 | E3 SUMO-protein ligase ranbp2; TPR motif, nuclear | 99.7 | |
| 3upv_A | 126 | Heat shock protein STI1; TPR-fold, adaptor protein | 99.69 | |
| 4i17_A | 228 | Hypothetical protein; TPR repeats protein, structu | 99.69 | |
| 3gyz_A | 151 | Chaperone protein IPGC; asymmetric homodimer, tetr | 99.68 | |
| 2vgx_A | 148 | Chaperone SYCD; alternative dimer assembly, tetrat | 99.68 | |
| 1hxi_A | 121 | PEX5, peroxisome targeting signal 1 receptor PEX5; | 99.67 | |
| 2xcb_A | 142 | PCRH, regulatory protein PCRH; protein transport, | 99.67 | |
| 3sz7_A | 164 | HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G | 99.67 | |
| 4gcn_A | 127 | Protein STI-1; structural genomics, PSI-biology, m | 99.67 | |
| 3vtx_A | 184 | MAMA; tetratricopeptide repeats (TPR) containing p | 99.66 | |
| 3k9i_A | 117 | BH0479 protein; putative protein binding protein, | 99.65 | |
| 2hr2_A | 159 | Hypothetical protein; alpha-alpha superhelix fold, | 99.65 | |
| 3urz_A | 208 | Uncharacterized protein; tetratricopeptide repeats | 99.64 | |
| 3rkv_A | 162 | Putative peptidylprolyl isomerase; structural geno | 99.63 | |
| 2vgx_A | 148 | Chaperone SYCD; alternative dimer assembly, tetrat | 99.62 | |
| 4i17_A | 228 | Hypothetical protein; TPR repeats protein, structu | 99.61 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 99.61 | |
| 4gyw_A | 723 | UDP-N-acetylglucosamine--peptide N- acetylglucosam | 99.61 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 99.6 | |
| 1elw_A | 118 | TPR1-domain of HOP; HOP, TPR-domain, peptide-compl | 99.59 | |
| 2xcb_A | 142 | PCRH, regulatory protein PCRH; protein transport, | 99.59 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 99.59 | |
| 3q49_B | 137 | STIP1 homology and U box-containing protein 1; E3 | 99.59 | |
| 2pzi_A | 681 | Probable serine/threonine-protein kinase PKNG; ATP | 99.58 | |
| 2lni_A | 133 | Stress-induced-phosphoprotein 1; structural genomi | 99.58 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 99.58 | |
| 2xev_A | 129 | YBGF; tetratricopeptide, alpha-helical, metal bind | 99.58 | |
| 3as5_A | 186 | MAMA; tetratricopeptide repeats (TPR) containing p | 99.58 | |
| 1a17_A | 166 | Serine/threonine protein phosphatase 5; hydrolase, | 99.58 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 99.57 | |
| 2dba_A | 148 | Smooth muscle cell associated protein-1, isoform 2 | 99.56 | |
| 2vyi_A | 131 | SGTA protein; chaperone, TPR repeat, phosphoprotei | 99.56 | |
| 3urz_A | 208 | Uncharacterized protein; tetratricopeptide repeats | 99.56 | |
| 2vq2_A | 225 | PILW, putative fimbrial biogenesis and twitching m | 99.56 | |
| 1fch_A | 368 | Peroxisomal targeting signal 1 receptor; protein-p | 99.55 | |
| 2pzi_A | 681 | Probable serine/threonine-protein kinase PKNG; ATP | 99.55 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 99.55 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 99.55 | |
| 3upv_A | 126 | Heat shock protein STI1; TPR-fold, adaptor protein | 99.55 | |
| 4abn_A | 474 | Tetratricopeptide repeat protein 5; P53 cofactor, | 99.54 | |
| 2vsy_A | 568 | XCC0866; transferase, glycosyl transferase, GT-B, | 99.54 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 99.54 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 99.54 | |
| 2kck_A | 112 | TPR repeat; tetratricopeptide repeat, structural g | 99.54 | |
| 1na0_A | 125 | Designed protein CTPR3; de novo protein; HET: IPT; | 99.54 | |
| 1fch_A | 368 | Peroxisomal targeting signal 1 receptor; protein-p | 99.53 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 99.53 | |
| 4abn_A | 474 | Tetratricopeptide repeat protein 5; P53 cofactor, | 99.53 | |
| 1xnf_A | 275 | Lipoprotein NLPI; TPR, tetratricopeptide, structur | 99.53 | |
| 2e2e_A | 177 | Formate-dependent nitrite reductase complex NRFG; | 99.53 | |
| 2ho1_A | 252 | Type 4 fimbrial biogenesis protein PILF; type IV p | 99.52 | |
| 1p5q_A | 336 | FKBP52, FK506-binding protein 4; isomerase; 2.80A | 99.52 | |
| 2fbn_A | 198 | 70 kDa peptidylprolyl isomerase, putative; sulfur | 99.52 | |
| 2kat_A | 115 | Uncharacterized protein; NESG, structure, structur | 99.51 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 99.51 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 99.51 | |
| 1p5q_A | 336 | FKBP52, FK506-binding protein 4; isomerase; 2.80A | 99.51 | |
| 3sz7_A | 164 | HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G | 99.51 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 99.51 | |
| 2ond_A | 308 | Cleavage stimulation factor 77 kDa subunit; HAT do | 99.51 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 99.51 | |
| 3qky_A | 261 | Outer membrane assembly lipoprotein YFIO; membrane | 99.51 | |
| 2ho1_A | 252 | Type 4 fimbrial biogenesis protein PILF; type IV p | 99.5 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 99.49 | |
| 4g1t_A | 472 | Interferon-induced protein with tetratricopeptide | 99.49 | |
| 2fo7_A | 136 | Synthetic consensus TPR protein; tetratricopeptide | 99.49 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 99.49 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 99.48 | |
| 4gcn_A | 127 | Protein STI-1; structural genomics, PSI-biology, m | 99.48 | |
| 2vq2_A | 225 | PILW, putative fimbrial biogenesis and twitching m | 99.48 | |
| 2vsy_A | 568 | XCC0866; transferase, glycosyl transferase, GT-B, | 99.48 | |
| 1elr_A | 131 | TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp | 99.48 | |
| 3as5_A | 186 | MAMA; tetratricopeptide repeats (TPR) containing p | 99.48 | |
| 1xnf_A | 275 | Lipoprotein NLPI; TPR, tetratricopeptide, structur | 99.47 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 99.47 | |
| 2if4_A | 338 | ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, | 99.47 | |
| 1hh8_A | 213 | P67PHOX, NCF-2, neutrophil cytosol factor 2; cell | 99.47 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 99.45 | |
| 2yhc_A | 225 | BAMD, UPF0169 lipoprotein YFIO; essential BAM comp | 99.45 | |
| 4g1t_A | 472 | Interferon-induced protein with tetratricopeptide | 99.45 | |
| 1na0_A | 125 | Designed protein CTPR3; de novo protein; HET: IPT; | 99.45 | |
| 1hh8_A | 213 | P67PHOX, NCF-2, neutrophil cytosol factor 2; cell | 99.44 | |
| 1kt0_A | 457 | FKBP51, 51 kDa FK506-binding protein; FKBP-like pp | 99.44 | |
| 2vyi_A | 131 | SGTA protein; chaperone, TPR repeat, phosphoprotei | 99.44 | |
| 3q49_B | 137 | STIP1 homology and U box-containing protein 1; E3 | 99.44 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 99.44 | |
| 3ma5_A | 100 | Tetratricopeptide repeat domain protein; NESG, str | 99.44 | |
| 2e2e_A | 177 | Formate-dependent nitrite reductase complex NRFG; | 99.42 | |
| 3qou_A | 287 | Protein YBBN; thioredoxin-like fold, tetratricopep | 99.42 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 99.42 | |
| 2r5s_A | 176 | Uncharacterized protein VP0806; APC090868.1, vibri | 99.41 | |
| 1hxi_A | 121 | PEX5, peroxisome targeting signal 1 receptor PEX5; | 99.41 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 99.41 | |
| 1ihg_A | 370 | Cyclophilin 40; ppiase immunophilin tetratricopept | 99.41 | |
| 2fbn_A | 198 | 70 kDa peptidylprolyl isomerase, putative; sulfur | 99.41 | |
| 3mkr_A | 291 | Coatomer subunit epsilon; tetratricopeptide repeat | 99.41 | |
| 1kt0_A | 457 | FKBP51, 51 kDa FK506-binding protein; FKBP-like pp | 99.4 | |
| 2fo7_A | 136 | Synthetic consensus TPR protein; tetratricopeptide | 99.4 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 99.4 | |
| 3mkr_A | 291 | Coatomer subunit epsilon; tetratricopeptide repeat | 99.4 | |
| 2dba_A | 148 | Smooth muscle cell associated protein-1, isoform 2 | 99.4 | |
| 1elw_A | 118 | TPR1-domain of HOP; HOP, TPR-domain, peptide-compl | 99.39 | |
| 1wao_1 | 477 | Serine/threonine protein phosphatase 5; hydrolase, | 99.39 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 99.38 | |
| 3qou_A | 287 | Protein YBBN; thioredoxin-like fold, tetratricopep | 99.37 | |
| 2ond_A | 308 | Cleavage stimulation factor 77 kDa subunit; HAT do | 99.37 | |
| 1na3_A | 91 | Designed protein CTPR2; de novo protein; HET: IPT; | 99.37 | |
| 3qky_A | 261 | Outer membrane assembly lipoprotein YFIO; membrane | 99.35 | |
| 2r5s_A | 176 | Uncharacterized protein VP0806; APC090868.1, vibri | 99.34 | |
| 2hr2_A | 159 | Hypothetical protein; alpha-alpha superhelix fold, | 99.33 | |
| 3rkv_A | 162 | Putative peptidylprolyl isomerase; structural geno | 99.32 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 99.32 | |
| 2kck_A | 112 | TPR repeat; tetratricopeptide repeat, structural g | 99.31 | |
| 1qqe_A | 292 | Vesicular transport protein SEC17; helix-turn-heli | 99.3 | |
| 2l6j_A | 111 | TPR repeat-containing protein associated with HSP; | 99.29 | |
| 1a17_A | 166 | Serine/threonine protein phosphatase 5; hydrolase, | 99.29 | |
| 1qqe_A | 292 | Vesicular transport protein SEC17; helix-turn-heli | 99.27 | |
| 2l6j_A | 111 | TPR repeat-containing protein associated with HSP; | 99.26 | |
| 3bee_A | 93 | Putative YFRE protein; putaive YFRE protein, struc | 99.25 | |
| 2kc7_A | 99 | BFR218_protein; tetratricopeptide repeat, all-alph | 99.25 | |
| 1elr_A | 131 | TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp | 99.24 | |
| 2xev_A | 129 | YBGF; tetratricopeptide, alpha-helical, metal bind | 99.23 | |
| 2yhc_A | 225 | BAMD, UPF0169 lipoprotein YFIO; essential BAM comp | 99.21 | |
| 2lni_A | 133 | Stress-induced-phosphoprotein 1; structural genomi | 99.21 | |
| 3edt_B | 283 | KLC 2, kinesin light chain 2; superhelical, struct | 99.2 | |
| 1na3_A | 91 | Designed protein CTPR2; de novo protein; HET: IPT; | 99.2 | |
| 3edt_B | 283 | KLC 2, kinesin light chain 2; superhelical, struct | 99.19 | |
| 2kc7_A | 99 | BFR218_protein; tetratricopeptide repeat, all-alph | 99.17 | |
| 2ooe_A | 530 | Cleavage stimulation factor 77 kDa subunit; HAT do | 99.17 | |
| 1zu2_A | 158 | Mitochondrial import receptor subunit TOM20-3; TPR | 99.17 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 99.16 | |
| 3nf1_A | 311 | KLC 1, kinesin light chain 1; TPR, structural geno | 99.14 | |
| 1pc2_A | 152 | Mitochondria fission protein; unknown function; NM | 99.13 | |
| 1ouv_A | 273 | Conserved hypothetical secreted protein; TPR repea | 99.12 | |
| 3nf1_A | 311 | KLC 1, kinesin light chain 1; TPR, structural geno | 99.12 | |
| 1ouv_A | 273 | Conserved hypothetical secreted protein; TPR repea | 99.1 | |
| 2ooe_A | 530 | Cleavage stimulation factor 77 kDa subunit; HAT do | 99.09 | |
| 3ulq_A | 383 | Response regulator aspartate phosphatase F; tetrat | 99.09 | |
| 1ihg_A | 370 | Cyclophilin 40; ppiase immunophilin tetratricopept | 99.08 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 99.07 | |
| 3k9i_A | 117 | BH0479 protein; putative protein binding protein, | 99.07 | |
| 3dra_A | 306 | Protein farnesyltransferase/geranylgeranyltransfer | 99.06 | |
| 4a1s_A | 411 | PINS, partner of inscuteable; cell cycle, LGN, mit | 99.05 | |
| 3dra_A | 306 | Protein farnesyltransferase/geranylgeranyltransfer | 99.05 | |
| 3rjv_A | 212 | Putative SEL1 repeat protein; alpha-alpha superhel | 99.04 | |
| 2qfc_A | 293 | PLCR protein; TPR, HTH, transcription regulation; | 99.03 | |
| 1wao_1 | 477 | Serine/threonine protein phosphatase 5; hydrolase, | 99.02 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 99.0 | |
| 2if4_A | 338 | ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, | 98.99 | |
| 2ifu_A | 307 | Gamma-SNAP; membrane fusion, snare complex disasse | 98.99 | |
| 3ulq_A | 383 | Response regulator aspartate phosphatase F; tetrat | 98.99 | |
| 3dss_A | 331 | Geranylgeranyl transferase type-2 subunit alpha; p | 98.99 | |
| 3ro2_A | 338 | PINS homolog, G-protein-signaling modulator 2; TPR | 98.98 | |
| 3sf4_A | 406 | G-protein-signaling modulator 2; tetratricopeptide | 98.98 | |
| 3sf4_A | 406 | G-protein-signaling modulator 2; tetratricopeptide | 98.96 | |
| 3q15_A | 378 | PSP28, response regulator aspartate phosphatase H; | 98.95 | |
| 3u3w_A | 293 | Transcriptional activator PLCR protein; ternary co | 98.94 | |
| 4a1s_A | 411 | PINS, partner of inscuteable; cell cycle, LGN, mit | 98.94 | |
| 3ro3_A | 164 | PINS homolog, G-protein-signaling modulator 2; asy | 98.92 | |
| 3dss_A | 331 | Geranylgeranyl transferase type-2 subunit alpha; p | 98.92 | |
| 2ifu_A | 307 | Gamma-SNAP; membrane fusion, snare complex disasse | 98.91 | |
| 2kat_A | 115 | Uncharacterized protein; NESG, structure, structur | 98.91 | |
| 3q7a_A | 349 | Farnesyltransferase alpha subunit; protein prenylt | 98.91 | |
| 2qfc_A | 293 | PLCR protein; TPR, HTH, transcription regulation; | 98.88 | |
| 3gw4_A | 203 | Uncharacterized protein; structural genomics, PSI- | 98.86 | |
| 3u3w_A | 293 | Transcriptional activator PLCR protein; ternary co | 98.86 | |
| 3q15_A | 378 | PSP28, response regulator aspartate phosphatase H; | 98.86 | |
| 3q7a_A | 349 | Farnesyltransferase alpha subunit; protein prenylt | 98.85 | |
| 4f3v_A | 282 | ESX-1 secretion system protein ECCA1; tetratricope | 98.85 | |
| 3ro2_A | 338 | PINS homolog, G-protein-signaling modulator 2; TPR | 98.84 | |
| 3gw4_A | 203 | Uncharacterized protein; structural genomics, PSI- | 98.81 | |
| 3u64_A | 301 | Protein TP_0956; tetratrico peptide repeat, protei | 98.8 | |
| 3ro3_A | 164 | PINS homolog, G-protein-signaling modulator 2; asy | 98.79 | |
| 4f3v_A | 282 | ESX-1 secretion system protein ECCA1; tetratricope | 98.77 | |
| 2v5f_A | 104 | Prolyl 4-hydroxylase subunit alpha-1; endoplasmic | 98.75 | |
| 3u64_A | 301 | Protein TP_0956; tetratrico peptide repeat, protei | 98.72 | |
| 3ly7_A | 372 | Transcriptional activator CADC; alpha/beta domain, | 98.71 | |
| 3e4b_A | 452 | ALGK; tetratricopeptide repeat, superhelix, algina | 98.69 | |
| 1hz4_A | 373 | MALT regulatory protein; two-helix bundles, helix | 98.67 | |
| 3rjv_A | 212 | Putative SEL1 repeat protein; alpha-alpha superhel | 98.67 | |
| 3n71_A | 490 | Histone lysine methyltransferase SMYD1; heart deve | 98.64 | |
| 1klx_A | 138 | Cysteine rich protein B; structural genomics, heli | 98.63 | |
| 3qwp_A | 429 | SET and MYND domain-containing protein 3; SMYD3,SE | 98.62 | |
| 3ma5_A | 100 | Tetratricopeptide repeat domain protein; NESG, str | 98.58 | |
| 3qww_A | 433 | SET and MYND domain-containing protein 2; methyltr | 98.57 | |
| 1klx_A | 138 | Cysteine rich protein B; structural genomics, heli | 98.54 | |
| 1nzn_A | 126 | CGI-135 protein, fission protein FIS1P; TPR, unkno | 98.52 | |
| 2xm6_A | 490 | Protein corresponding to locus C5321 from CFT073 s | 98.52 | |
| 2xm6_A | 490 | Protein corresponding to locus C5321 from CFT073 s | 98.5 | |
| 3e4b_A | 452 | ALGK; tetratricopeptide repeat, superhelix, algina | 98.46 | |
| 1hz4_A | 373 | MALT regulatory protein; two-helix bundles, helix | 98.44 | |
| 2v5f_A | 104 | Prolyl 4-hydroxylase subunit alpha-1; endoplasmic | 98.3 | |
| 1xi4_A | 1630 | Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle | 98.18 | |
| 1y8m_A | 144 | FIS1; mitochondria, unknown function; NMR {Sacchar | 98.13 | |
| 3bee_A | 93 | Putative YFRE protein; putaive YFRE protein, struc | 98.04 | |
| 3mv2_B | 310 | Coatomer subunit epsilon; vesicular membrane coat | 98.02 | |
| 3o48_A | 134 | Mitochondria fission 1 protein; tetratricopeptide | 98.01 | |
| 3ly7_A | 372 | Transcriptional activator CADC; alpha/beta domain, | 97.97 | |
| 4b4t_Q | 434 | 26S proteasome regulatory subunit RPN6; hydrolase, | 97.94 | |
| 3mv2_B | 310 | Coatomer subunit epsilon; vesicular membrane coat | 97.91 | |
| 1xi4_A | 1630 | Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle | 97.79 | |
| 1b89_A | 449 | Protein (clathrin heavy chain); triskelion, coated | 97.77 | |
| 1pc2_A | 152 | Mitochondria fission protein; unknown function; NM | 97.75 | |
| 4b4t_Q | 434 | 26S proteasome regulatory subunit RPN6; hydrolase, | 97.74 | |
| 3n71_A | 490 | Histone lysine methyltransferase SMYD1; heart deve | 97.56 | |
| 4e6h_A | 679 | MRNA 3'-END-processing protein RNA14; HAT domain, | 97.51 | |
| 1b89_A | 449 | Protein (clathrin heavy chain); triskelion, coated | 97.49 | |
| 4e6h_A | 679 | MRNA 3'-END-processing protein RNA14; HAT domain, | 97.45 | |
| 3qww_A | 433 | SET and MYND domain-containing protein 2; methyltr | 97.15 | |
| 2uy1_A | 493 | Cleavage stimulation factor 77; RNA-binding protei | 96.76 | |
| 3qwp_A | 429 | SET and MYND domain-containing protein 3; SMYD3,SE | 96.72 | |
| 3ffl_A | 167 | Anaphase-promoting complex subunit 7; tetratricope | 96.61 | |
| 1nzn_A | 126 | CGI-135 protein, fission protein FIS1P; TPR, unkno | 96.16 | |
| 3o48_A | 134 | Mitochondria fission 1 protein; tetratricopeptide | 95.87 | |
| 2uy1_A | 493 | Cleavage stimulation factor 77; RNA-binding protei | 95.83 | |
| 1ya0_A | 497 | SMG-7 transcript variant 2; alpha-helical repeat, | 95.69 | |
| 3ffl_A | 167 | Anaphase-promoting complex subunit 7; tetratricope | 95.61 | |
| 1y8m_A | 144 | FIS1; mitochondria, unknown function; NMR {Sacchar | 95.58 | |
| 1zbp_A | 273 | Hypothetical protein VPA1032; alpha-beta protein, | 95.39 | |
| 2ff4_A | 388 | Probable regulatory protein EMBR; winged-helix, te | 95.18 | |
| 4h7y_A | 161 | Dual specificity protein kinase TTK; mitotic check | 94.06 | |
| 1zbp_A | 273 | Hypothetical protein VPA1032; alpha-beta protein, | 94.05 | |
| 4gns_B | 754 | Protein CSD3, chitin biosynthesis protein CHS6; FN | 92.58 | |
| 3mkq_A | 814 | Coatomer beta'-subunit; beta-propeller, alpha-sole | 92.47 | |
| 3kae_A | 242 | CDC27, possible protein of nuclear scaffold; tetra | 91.42 | |
| 1ya0_A | 497 | SMG-7 transcript variant 2; alpha-helical repeat, | 90.48 | |
| 4g26_A | 501 | Pentatricopeptide repeat-containing protein AT2G3 | 90.42 | |
| 3lpz_A | 336 | GET4 (YOR164C homolog); protein targeting, tail-an | 90.38 | |
| 4g26_A | 501 | Pentatricopeptide repeat-containing protein AT2G3 | 90.36 | |
| 3mkq_B | 177 | Coatomer subunit alpha; beta-propeller, alpha-sole | 90.29 | |
| 4h7y_A | 161 | Dual specificity protein kinase TTK; mitotic check | 87.55 | |
| 2wpv_A | 312 | GET4, UPF0363 protein YOR164C; golgi-ER traffickin | 86.53 | |
| 4gns_B | 754 | Protein CSD3, chitin biosynthesis protein CHS6; FN | 85.24 | |
| 3mkq_A | 814 | Coatomer beta'-subunit; beta-propeller, alpha-sole | 83.66 | |
| 3mkq_B | 177 | Coatomer subunit alpha; beta-propeller, alpha-sole | 81.74 |
| >1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 | Back alignment and structure |
|---|
Probab=100.00 E-value=4.3e-36 Score=240.83 Aligned_cols=144 Identities=58% Similarity=0.921 Sum_probs=141.4
Q ss_pred CCCChhHHHHhchHHHHHHHHHHHHhhCCCCHHHHHHHHHHHHHhcCCcccccccccHHHHHHHHHHHHHhCCCCHHHHH
Q 028992 1 MEFSQSDFDRLLLSEHNRKTAEANYAKDPLDADNLTRWGEALLELSQFESVSDSKKIINEAISKFEEALVIDPAKHYTLW 80 (200)
Q Consensus 1 ~~~~~~~~~~l~~fe~A~~~~e~a~~~~P~d~~~l~~lG~al~~l~~~~~~~~~~~~~~eAi~~le~AL~ldP~~~~a~~ 80 (200)
||| +.|++|+.+||+|++.++++++++|+++++|++||.+|..+++++.+.++++++++||.+|++||++||+++++||
T Consensus 6 ~~~-~~~~~r~~~feeA~~~~~~Ai~l~P~~aea~~n~G~~l~~l~~~~~g~~al~~~~eAi~~le~AL~ldP~~~~A~~ 84 (158)
T 1zu2_A 6 MDT-ETEFDRILLFEQIRQDAENTYKSNPLDADNLTRWGGVLLELSQFHSISDAKQMIQEAITKFEEALLIDPKKDEAVW 84 (158)
T ss_dssp CSC-CCSHHHHHHHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHHHHSCHHHHHHHHHHHHHHHHHHHHHCTTCHHHHH
T ss_pred ccc-ccHHHHHhHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHhcccchhhhhHhHHHHHHHHHHHHHHhCcCcHHHHH
Confidence 899 7899999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHhcCcccCChHHhhcCHHHHHHHHHHHHHhCCCCHHHHHHHHhCCCChHHHHHHHHHHH
Q 028992 81 SLGNAHTSCGFLTADLSEAKGDFDKASECFQRAVDEEPTNELYQKSLEVSTKAPELHMELHKHGI 145 (200)
Q Consensus 81 ~LG~a~~~~G~l~~~~~~a~~~~d~A~~~fqkAl~l~P~~~~y~kAle~~~k~~e~~~~l~~~~~ 145 (200)
+||++|+++|+|+|+.+++.++|++|++||++|++++|++..|++++++.+++|++|++++++++
T Consensus 85 ~LG~ay~~lg~l~P~~~~a~g~~~eA~~~~~kAl~l~P~~~~y~~al~~~~ka~el~~~~~~~~~ 149 (158)
T 1zu2_A 85 CIGNAYTSFAFLTPDETEAKHNFDLATQFFQQAVDEQPDNTHYLKSLEMTAKAPQLHAEAYKQGL 149 (158)
T ss_dssp HHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHCTTCHHHHHHHHHHHTHHHHHHHHHHSSS
T ss_pred HHHHHHHHhcccCcchhhhhccHHHHHHHHHHHHHhCCCCHHHHHHHHHHHhCHhccCccccccc
Confidence 99999999999999999999999999999999999999999999999999999999999999854
|
| >4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* | Back alignment and structure |
|---|
| >4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* | Back alignment and structure |
|---|
| >2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... | Back alignment and structure |
|---|
| >3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A | Back alignment and structure |
|---|
| >2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} | Back alignment and structure |
|---|
| >4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A | Back alignment and structure |
|---|
| >2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... | Back alignment and structure |
|---|
| >4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* | Back alignment and structure |
|---|
| >3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A | Back alignment and structure |
|---|
| >2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* | Back alignment and structure |
|---|
| >1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A | Back alignment and structure |
|---|
| >3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} | Back alignment and structure |
|---|
| >4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A | Back alignment and structure |
|---|
| >3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} | Back alignment and structure |
|---|
| >2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 | Back alignment and structure |
|---|
| >3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* | Back alignment and structure |
|---|
| >4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* | Back alignment and structure |
|---|
| >2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} | Back alignment and structure |
|---|
| >3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A | Back alignment and structure |
|---|
| >1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} | Back alignment and structure |
|---|
| >1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A | Back alignment and structure |
|---|
| >2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} | Back alignment and structure |
|---|
| >2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A | Back alignment and structure |
|---|
| >1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} | Back alignment and structure |
|---|
| >4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} | Back alignment and structure |
|---|
| >1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} | Back alignment and structure |
|---|
| >2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A | Back alignment and structure |
|---|
| >1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A | Back alignment and structure |
|---|
| >2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A | Back alignment and structure |
|---|
| >3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A | Back alignment and structure |
|---|
| >2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} | Back alignment and structure |
|---|
| >2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} | Back alignment and structure |
|---|
| >4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} | Back alignment and structure |
|---|
| >2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* | Back alignment and structure |
|---|
| >1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A | Back alignment and structure |
|---|
| >3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A | Back alignment and structure |
|---|
| >1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A | Back alignment and structure |
|---|
| >2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A | Back alignment and structure |
|---|
| >2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A | Back alignment and structure |
|---|
| >4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A | Back alignment and structure |
|---|
| >1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* | Back alignment and structure |
|---|
| >1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A | Back alignment and structure |
|---|
| >2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A | Back alignment and structure |
|---|
| >2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} | Back alignment and structure |
|---|
| >3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A | Back alignment and structure |
|---|
| >2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A | Back alignment and structure |
|---|
| >1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A | Back alignment and structure |
|---|
| >2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} | Back alignment and structure |
|---|
| >1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A | Back alignment and structure |
|---|
| >2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} | Back alignment and structure |
|---|
| >2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* | Back alignment and structure |
|---|
| >2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A | Back alignment and structure |
|---|
| >3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} | Back alignment and structure |
|---|
| >2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 | Back alignment and structure |
|---|
| >3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A | Back alignment and structure |
|---|
| >1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} | Back alignment and structure |
|---|
| >1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A | Back alignment and structure |
|---|
| >2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} | Back alignment and structure |
|---|
| >2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A | Back alignment and structure |
|---|
| >2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A | Back alignment and structure |
|---|
| >1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A | Back alignment and structure |
|---|
| >3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A | Back alignment and structure |
|---|
| >2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} | Back alignment and structure |
|---|
| >2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 | Back alignment and structure |
|---|
| >3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 | Back alignment and structure |
|---|
| >2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} | Back alignment and structure |
|---|
| >3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} | Back alignment and structure |
|---|
| >4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} | Back alignment and structure |
|---|
| >3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} | Back alignment and structure |
|---|
| >1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} | Back alignment and structure |
|---|
| >3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* | Back alignment and structure |
|---|
| >3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A | Back alignment and structure |
|---|
| >4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} | Back alignment and structure |
|---|
| >3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* | Back alignment and structure |
|---|
| >2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} | Back alignment and structure |
|---|
| >2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} | Back alignment and structure |
|---|
| >3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* | Back alignment and structure |
|---|
| >2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} | Back alignment and structure |
|---|
| >3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} | Back alignment and structure |
|---|
| >3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A | Back alignment and structure |
|---|
| >3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* | Back alignment and structure |
|---|
| >4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} | Back alignment and structure |
|---|
| >3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* | Back alignment and structure |
|---|
| >3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} | Back alignment and structure |
|---|
| >4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A | Back alignment and structure |
|---|
| >3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* | Back alignment and structure |
|---|
| >3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A | Back alignment and structure |
|---|
| >3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} | Back alignment and structure |
|---|
| >1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 | Back alignment and structure |
|---|
| >3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 | Back alignment and structure |
|---|
| >3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* | Back alignment and structure |
|---|
| >3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A | Back alignment and structure |
|---|
| >3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* | Back alignment and structure |
|---|
| >1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 | Back alignment and structure |
|---|
| >1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A | Back alignment and structure |
|---|
| >2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} | Back alignment and structure |
|---|
| >2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} | Back alignment and structure |
|---|
| >3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} | Back alignment and structure |
|---|
| >1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 | Back alignment and structure |
|---|
| >2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A | Back alignment and structure |
|---|
| >1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A | Back alignment and structure |
|---|
| >1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B | Back alignment and structure |
|---|
| >3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A | Back alignment and structure |
|---|
| >3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A | Back alignment and structure |
|---|
| >4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B | Back alignment and structure |
|---|
| >1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A | Back alignment and structure |
|---|
| >1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 | Back alignment and structure |
|---|
| >1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A | Back alignment and structure |
|---|
| >1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 | Back alignment and structure |
|---|
| >4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A | Back alignment and structure |
|---|
| >3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* | Back alignment and structure |
|---|
| >2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B | Back alignment and structure |
|---|
| >3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* | Back alignment and structure |
|---|
| >3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A | Back alignment and structure |
|---|
| >3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A | Back alignment and structure |
|---|
| >2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B | Back alignment and structure |
|---|
| >1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 | Back alignment and structure |
|---|
| >2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* | Back alignment and structure |
|---|
| >4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A | Back alignment and structure |
|---|
| >1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 | Back alignment and structure |
|---|
| >4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A | Back alignment and structure |
|---|
| >3kae_A CDC27, possible protein of nuclear scaffold; tetratricopeptide repeat protein, protein binding; 2.30A {Encephalitozoon cuniculi} | Back alignment and structure |
|---|
| >1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A | Back alignment and structure |
|---|
| >3lpz_A GET4 (YOR164C homolog); protein targeting, tail-anchored protein biogenesis, GET PAT GET5 binding, protein transport; 1.98A {Chaetomium thermophilum} | Back alignment and structure |
|---|
| >4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A | Back alignment and structure |
|---|
| >3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A | Back alignment and structure |
|---|
| >2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A | Back alignment and structure |
|---|
| >4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A | Back alignment and structure |
|---|
| >3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 200 | ||||
| d1zu2a1 | 145 | a.118.8.1 (A:1-145) Mitochondrial import receptor | 4e-13 | |
| d1w3ba_ | 388 | a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, | 3e-04 | |
| d1w3ba_ | 388 | a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, | 6e-04 | |
| d1w3ba_ | 388 | a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, | 0.004 | |
| d2pqrb1 | 124 | a.118.8.1 (B:5-128) Mitochondria fission protein F | 0.001 |
| >d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 145 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: alpha-alpha superhelix superfamily: TPR-like family: Tetratricopeptide repeat (TPR) domain: Mitochondrial import receptor subunit tom20-3 species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]
Score = 62.2 bits (149), Expect = 4e-13
Identities = 83/141 (58%), Positives = 109/141 (77%)
Query: 5 QSDFDRLLLSEHNRKTAEANYAKDPLDADNLTRWGEALLELSQFESVSDSKKIINEAISK 64
+++FDR+LL E R+ AE Y +PLDADNLTRWG LLELSQF S+SD+K++I EAI+K
Sbjct: 4 ETEFDRILLFEQIRQDAENTYKSNPLDADNLTRWGGVLLELSQFHSISDAKQMIQEAITK 63
Query: 65 FEEALVIDPAKHYTLWSLGNAHTSCGFLTADLSEAKGDFDKASECFQRAVDEEPTNELYQ 124
FEEAL+IDP K +W +GNA+TS FLT D +EAK +FD A++ FQ+AVDE+P N Y
Sbjct: 64 FEEALLIDPKKDEAVWCIGNAYTSFAFLTPDETEAKHNFDLATQFFQQAVDEQPDNTHYL 123
Query: 125 KSLEVSTKAPELHMELHKHGI 145
KSLE++ KAP+LH E +K G+
Sbjct: 124 KSLEMTAKAPQLHAEAYKQGL 144
|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 | Back information, alignment and structure |
|---|
| >d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 124 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 200 | |||
| d1zu2a1 | 145 | Mitochondrial import receptor subunit tom20-3 {Tha | 99.96 | |
| d1elwa_ | 117 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 99.75 | |
| d1xnfa_ | 259 | Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | 99.72 | |
| d1a17a_ | 159 | Protein phosphatase 5 {Human (Homo sapiens) [TaxId | 99.71 | |
| d2c2la1 | 201 | STIP1 homology and U box-containing protein 1, STU | 99.7 | |
| d1w3ba_ | 388 | O-GlcNAc transferase p110 subunit, OGT {Human (Hom | 99.7 | |
| d2h6fa1 | 315 | Protein farnesyltransferase alpha-subunit {Human ( | 99.68 | |
| d1nzna_ | 122 | Mitochondria fission protein Fis1 {Human (Homo sap | 99.67 | |
| d2h6fa1 | 315 | Protein farnesyltransferase alpha-subunit {Human ( | 99.62 | |
| d1fcha_ | 323 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 99.61 | |
| d1w3ba_ | 388 | O-GlcNAc transferase p110 subunit, OGT {Human (Hom | 99.61 | |
| d1hxia_ | 112 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 99.6 | |
| d1xnfa_ | 259 | Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | 99.59 | |
| d1elra_ | 128 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 99.57 | |
| d1fcha_ | 323 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 99.57 | |
| d1ihga1 | 169 | Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | 99.57 | |
| d1p5qa1 | 170 | FKBP52 (FKBP4), C-terminal domain {Human (Homo sap | 99.55 | |
| d1hh8a_ | 192 | Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H | 99.54 | |
| d2fbna1 | 153 | Putative 70 kda peptidylprolyl isomerase PFL2275c | 99.54 | |
| d1elwa_ | 117 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 99.53 | |
| d1kt1a1 | 168 | FKBP51, C-terminal domain {Monkey (Saimiri bolivie | 99.5 | |
| d1a17a_ | 159 | Protein phosphatase 5 {Human (Homo sapiens) [TaxId | 99.48 | |
| d2c2la1 | 201 | STIP1 homology and U box-containing protein 1, STU | 99.47 | |
| d1dcea1 | 334 | Rab geranylgeranyltransferase alpha-subunit, N-ter | 99.47 | |
| d1hh8a_ | 192 | Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H | 99.4 | |
| d1hxia_ | 112 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 99.35 | |
| d1zu2a1 | 145 | Mitochondrial import receptor subunit tom20-3 {Tha | 99.34 | |
| d1tjca_ | 95 | Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human | 99.32 | |
| d1elra_ | 128 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 99.29 | |
| d2hr2a1 | 156 | Hypothetical protein CT2138 {Chlorobium tepidum [T | 99.28 | |
| d1ya0a1 | 497 | SMG-7 {Human (Homo sapiens) [TaxId: 9606]} | 99.22 | |
| d1p5qa1 | 170 | FKBP52 (FKBP4), C-terminal domain {Human (Homo sap | 99.17 | |
| d1dcea1 | 334 | Rab geranylgeranyltransferase alpha-subunit, N-ter | 99.12 | |
| d1nzna_ | 122 | Mitochondria fission protein Fis1 {Human (Homo sap | 99.08 | |
| d2fbna1 | 153 | Putative 70 kda peptidylprolyl isomerase PFL2275c | 99.08 | |
| d1ihga1 | 169 | Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | 99.07 | |
| d2ff4a2 | 179 | Probable regulatory protein EmbR, middle domain {M | 99.05 | |
| d2pqrb1 | 124 | Mitochondria fission protein Fis1 {Baker's yeast ( | 99.05 | |
| d1tjca_ | 95 | Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human | 99.04 | |
| d1kt1a1 | 168 | FKBP51, C-terminal domain {Monkey (Saimiri bolivie | 99.01 | |
| d1ya0a1 | 497 | SMG-7 {Human (Homo sapiens) [TaxId: 9606]} | 98.94 | |
| d2onda1 | 308 | Cleavage stimulation factor 77 kDa subunit CSTF3 { | 98.91 | |
| d1zbpa1 | 264 | Hypothetical protein VPA1032 {Vibrio parahaemolyti | 98.91 | |
| d1qqea_ | 290 | Vesicular transport protein sec17 {Baker's yeast ( | 98.78 | |
| d2hr2a1 | 156 | Hypothetical protein CT2138 {Chlorobium tepidum [T | 98.74 | |
| d1qqea_ | 290 | Vesicular transport protein sec17 {Baker's yeast ( | 98.69 | |
| d2onda1 | 308 | Cleavage stimulation factor 77 kDa subunit CSTF3 { | 98.63 | |
| d1hz4a_ | 366 | Transcription factor MalT domain III {Escherichia | 98.46 | |
| d1hz4a_ | 366 | Transcription factor MalT domain III {Escherichia | 98.41 | |
| d1zbpa1 | 264 | Hypothetical protein VPA1032 {Vibrio parahaemolyti | 98.35 | |
| d2ff4a2 | 179 | Probable regulatory protein EmbR, middle domain {M | 98.23 | |
| d2pqrb1 | 124 | Mitochondria fission protein Fis1 {Baker's yeast ( | 98.01 | |
| d1klxa_ | 133 | Cysteine rich protein B (HcpB) {Helicobacter pylor | 97.93 | |
| d1ouva_ | 265 | Cysteine rich protein C (HcpC) {Helicobacter pylor | 97.69 | |
| d1ouva_ | 265 | Cysteine rich protein C (HcpC) {Helicobacter pylor | 97.63 | |
| d1klxa_ | 133 | Cysteine rich protein B (HcpB) {Helicobacter pylor | 97.41 | |
| d2crba1 | 83 | Nuclear receptor binding factor 2, NRBF2, N-termin | 81.94 |
| >d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: alpha-alpha superhelix superfamily: TPR-like family: Tetratricopeptide repeat (TPR) domain: Mitochondrial import receptor subunit tom20-3 species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]
Probab=99.96 E-value=6.1e-30 Score=197.78 Aligned_cols=144 Identities=58% Similarity=0.921 Sum_probs=138.4
Q ss_pred CCCChhHHHHhchHHHHHHHHHHHHhhCCCCHHHHHHHHHHHHHhcCCcccccccccHHHHHHHHHHHHHhCCCCHHHHH
Q 028992 1 MEFSQSDFDRLLLSEHNRKTAEANYAKDPLDADNLTRWGEALLELSQFESVSDSKKIINEAISKFEEALVIDPAKHYTLW 80 (200)
Q Consensus 1 ~~~~~~~~~~l~~fe~A~~~~e~a~~~~P~d~~~l~~lG~al~~l~~~~~~~~~~~~~~eAi~~le~AL~ldP~~~~a~~ 80 (200)
||. .++++|+.+|++|++.++++++++|++++++++||.+|..++++..+.+.++++++|+..|++|+++||+++++|+
T Consensus 1 ~d~-~~~~~r~~~fe~A~~~~e~al~~~P~~~~~~~~~g~~l~~~~~~~~~~e~~~~~~~Ai~~~~kAl~l~P~~~~a~~ 79 (145)
T d1zu2a1 1 MDT-ETEFDRILLFEQIRQDAENTYKSNPLDADNLTRWGGVLLELSQFHSISDAKQMIQEAITKFEEALLIDPKKDEAVW 79 (145)
T ss_dssp CSC-CCSHHHHHHHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHHHHSCHHHHHHHHHHHHHHHHHHHHHCTTCHHHHH
T ss_pred CCh-hHHHHHHccHHHHHHHHHHHHhhCCcchHHHHHHHHHHHHhhhhhhhhHHHHHHHHHHHHHHHHHHhcchhhHHHh
Confidence 555 6789999999999999999999999999999999999999999988888999999999999999999999999999
Q ss_pred HHHHHHHhcCcccCChHHhhcCHHHHHHHHHHHHHhCCCCHHHHHHHHhCCCChHHHHHHHHHHH
Q 028992 81 SLGNAHTSCGFLTADLSEAKGDFDKASECFQRAVDEEPTNELYQKSLEVSTKAPELHMELHKHGI 145 (200)
Q Consensus 81 ~LG~a~~~~G~l~~~~~~a~~~~d~A~~~fqkAl~l~P~~~~y~kAle~~~k~~e~~~~l~~~~~ 145 (200)
++|++|..+|+++++...+.++|++|+++|++|++++|++..|+++|++..++|++|.++.++++
T Consensus 80 ~lG~~y~~~g~~~~~~~~~~~~~~~A~~~~~kal~l~P~~~~~~~~L~~~~ka~~~~~e~~k~~~ 144 (145)
T d1zu2a1 80 CIGNAYTSFAFLTPDETEAKHNFDLATQFFQQAVDEQPDNTHYLKSLEMTAKAPQLHAEAYKQGL 144 (145)
T ss_dssp HHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHCTTCHHHHHHHHHHHTHHHHHHHHHHSSS
T ss_pred hHHHHHHHcccchhhHHHHHHhHHHhhhhhhcccccCCCHHHHHHHHHHHHHHHHHHHHHHHHhc
Confidence 99999999999999999999999999999999999999999999999999999999999987765
|
| >d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} | Back information, alignment and structure |
|---|
| >d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} | Back information, alignment and structure |
|---|
| >d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} | Back information, alignment and structure |
|---|
| >d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} | Back information, alignment and structure |
|---|
| >d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} | Back information, alignment and structure |
|---|
| >d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} | Back information, alignment and structure |
|---|
| >d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d2crba1 a.7.16.1 (A:8-90) Nuclear receptor binding factor 2, NRBF2, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|