Citrus Sinensis ID: 029025

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200
MLMLMQLCSQRSILSSKVLLSSFRRSFYNIDYVSAMLPLFRVSNVTVKYRFCTRFYVGVNNNMSTLSNDNASMHLRARRPYQVVVAATHDMGIGKDGKLPWNLPSDLKFFKQLTMSTSDPGKRNAVVMGRKTWESISPLYRPLPGRLNVVLTHSGSFNIASLENVEICRSIHLALELLAEPPYCSSIEKVFVIGGGQILR
cHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEccccccccEEEEEEEcccccccccccccccccccccEEEEEEEccccEEccccccccccHHHHHHHHHHcccccccccccEEEEccccccccccccccccccccEEEcccccccccccccEEEEccHHHHHHHHccccccccccEEEEEEcccccc
cHHHHHHHcHHHHHcHHHHHHHcHcccccccHHHHHccccccccccccHHHcccccHcccccccccccccccccccccccEEEEEEEccccEEEEccEcccccHHHHHHHHHHHHcccccccccEEEEEHHHHHHccHHHccccccEEEEEccccccccccEEEEEEEccHHHHHHHHHcccHHccccEEEEEEccHHcc
MLMLMQLCSQRSILSSKVLLSSFRRSFYNIDYVSAMLPLFRVSNVTVKYRFCTRFYVGvnnnmstlsndnasmhlrarrPYQVVVAAThdmgigkdgklpwnlpsdlkFFKQltmstsdpgkrnavvMGRKTWesisplyrplpgrlNVVLTHsgsfniasleNVEICRSIHLALEllaeppycssiEKVFVIGGGQILR
MLMLMQLCSQRSILSSKVLLSSFRRSFYNIDYVSAMLPLFRVSNVTVKYRFCTRFYVGVNNNMSTLSNDNASMHLRARRPYQVVVAATHDMGIGKDGKLPWNLPSDLKFFKQLtmstsdpgkrnaVVMGRKTWESISPLYRPLPGRLNVVLTHSGSFNIASLENVEICRSIHLALELLAEPPYCSSIEKVFVigggqilr
MLMLMQLCSQRSILSSKVLLSSFRRSFYNIDYVSAMLPLFRVSNVTVKYRFCTRFYVGVNNNMSTLSNDNASMHLRARRPYQVVVAATHDMGIGKDGKLPWNLPSDLKFFKQLTMSTSDPGKRNAVVMGRKTWESISPLYRPLPGRLNVVLTHSGSFNIASLENVEICRSIHLALELLAEPPYCSSIEKVFVIGGGQILR
*****QLCSQRSILSSKVLLSSFRRSFYNIDYVSAMLPLFRVSNVTVKYRFCTRFYVGVNNNMSTLS***ASMHLRARRPYQVVVAATHDMGIGKDGKLPWNLPSDLKFFKQLTM********NAVVMGRKTWESISPLYRPLPGRLNVVLTHSGSFNIASLENVEICRSIHLALELLAEPPYCSSIEKVFVIGGGQ***
*LM****CSQRSILSSKVLLSSFRRSFYNIDYVSAMLPLFRVSNVTVKYR*******************************QVVVAATHDMGIGKDGKLPWNLPSDLKFFKQLTMSTSDPGKRNAVVMGRKTWESISPLYRPLPGRLNVVLTHSGSFNIASLENVEICRSIHLALELLAEPPYCSSIEKVFVIGGGQILR
MLMLMQLCSQRSILSSKVLLSSFRRSFYNIDYVSAMLPLFRVSNVTVKYRFCTRFYVGVNNNMSTLSNDNASMHLRARRPYQVVVAATHDMGIGKDGKLPWNLPSDLKFFKQLTMSTSDPGKRNAVVMGRKTWESISPLYRPLPGRLNVVLTHSGSFNIASLENVEICRSIHLALELLAEPPYCSSIEKVFVIGGGQILR
MLMLMQLCSQRSILSSKVLLSSFRRSFYNIDYVSAMLPLFRVSNVTVKYRFCTRFYVGVNNNMSTLSNDNASMHLRARRPYQVVVAATHDMGIGKDGKLPWNLPSDLKFFKQLTMSTSDPGKRNAVVMGRKTWESISPLYRPLPGRLNVVLTHSGSFNIASLENVEICRSIHLALELLAEPPYCSSIEKVFVIGGGQILR
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLMLMQLCSQRSILSSKVLLSSFRRSFYNIDYVSAMLPLFRVSNVTVKYRFCTRFYVGVNNNMSTLSNDNASMHLRARRPYQVVVAATHDMGIGKDGKLPWNLPSDLKFFKQLTMSTSDPGKRNAVVMGRKTWESISPLYRPLPGRLNVVLTHSGSFNIASLENVEICRSIHLALELLAEPPYCSSIEKVFVIGGGQILR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query200 2.2.26 [Sep-21-2011]
P45350 528 Bifunctional dihydrofolat N/A no 0.615 0.232 0.764 1e-49
O81395 521 Bifunctional dihydrofolat N/A no 0.655 0.251 0.709 2e-49
Q05762 519 Bifunctional dihydrofolat yes no 0.685 0.263 0.683 5e-49
P51820 530 Bifunctional dihydrofolat no no 0.615 0.232 0.756 2e-48
Q05763 565 Bifunctional dihydrofolat no no 0.725 0.256 0.664 5e-48
Q2QRX6 494 Putative bifunctional dih no no 0.55 0.222 0.7 1e-41
Q27793 521 Bifunctional dihydrofolat N/A no 0.61 0.234 0.439 2e-24
P07807211 Dihydrofolate reductase O yes no 0.58 0.549 0.435 1e-23
Q93341189 Putative dihydrofolate re yes no 0.59 0.624 0.441 1e-23
Q27783 527 Bifunctional dihydrofolat N/A no 0.61 0.231 0.404 2e-22
>sp|P45350|DRTS_DAUCA Bifunctional dihydrofolate reductase-thymidylate synthase OS=Daucus carota PE=2 SV=1 Back     alignment and function desciption
 Score =  196 bits (497), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 94/123 (76%), Positives = 106/123 (86%)

Query: 78  RRPYQVVVAATHDMGIGKDGKLPWNLPSDLKFFKQLTMSTSDPGKRNAVVMGRKTWESIS 137
           +R YQVVVAAT +MGIGKDGKLPW LPSD+KFFK +TM+TSDP KRNAV+MGRKTWESI 
Sbjct: 21  QRTYQVVVAATQNMGIGKDGKLPWRLPSDMKFFKDVTMTTSDPLKRNAVIMGRKTWESIP 80

Query: 138 PLYRPLPGRLNVVLTHSGSFNIASLENVEICRSIHLALELLAEPPYCSSIEKVFVIGGGQ 197
             +RPLPGRLNVVLT SGSF+IA++ENV IC S+  ALELLA  PYC S+EKVFVIGGGQ
Sbjct: 81  IQHRPLPGRLNVVLTRSGSFDIATVENVVICGSMISALELLAGSPYCVSVEKVFVIGGGQ 140

Query: 198 ILR 200
           I R
Sbjct: 141 IYR 143
Bifunctional enzyme. Involved in de novo dTMP biosynthesis. Key enzyme in folate metabolism. Can play two different roles depending on the source of dihydrofolate: de novo synthesis of tetrahydrofolate or recycling of the dihydrofolate released as one of the end products of the TS catalyzed reaction. Catalyzes an essential reaction for de novo glycine and purine synthesis, DNA precursor synthesis, and for the conversion of dUMP to dTMP.
Daucus carota (taxid: 4039)
EC: 2EC: .EC: 1EC: .EC: 1EC: .EC: 4EC: 5
>sp|O81395|DRTS_MAIZE Bifunctional dihydrofolate reductase-thymidylate synthase OS=Zea mays GN=DRTS PE=2 SV=1 Back     alignment and function description
>sp|Q05762|DRTS1_ARATH Bifunctional dihydrofolate reductase-thymidylate synthase 1 OS=Arabidopsis thaliana GN=THY-1 PE=2 SV=2 Back     alignment and function description
>sp|P51820|DRTS_SOYBN Bifunctional dihydrofolate reductase-thymidylate synthase OS=Glycine max PE=1 SV=1 Back     alignment and function description
>sp|Q05763|DRTS2_ARATH Bifunctional dihydrofolate reductase-thymidylate synthase 2 OS=Arabidopsis thaliana GN=THY-2 PE=2 SV=2 Back     alignment and function description
>sp|Q2QRX6|DRTS_ORYSJ Putative bifunctional dihydrofolate reductase-thymidylate synthase OS=Oryza sativa subsp. japonica GN=Os12g0446900 PE=3 SV=2 Back     alignment and function description
>sp|Q27793|DRTS_TRYCR Bifunctional dihydrofolate reductase-thymidylate synthase OS=Trypanosoma cruzi PE=1 SV=2 Back     alignment and function description
>sp|P07807|DYR_YEAST Dihydrofolate reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DFR1 PE=1 SV=2 Back     alignment and function description
>sp|Q93341|DYR_CAEEL Putative dihydrofolate reductase OS=Caenorhabditis elegans GN=dhfr-1 PE=3 SV=1 Back     alignment and function description
>sp|Q27783|DRTS_TRYBB Bifunctional dihydrofolate reductase-thymidylate synthase OS=Trypanosoma brucei brucei PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query200
225458199 580 PREDICTED: bifunctional dihydrofolate re 0.88 0.303 0.651 2e-56
255538724 591 bifunctional dihydrofolate reductase-thy 0.925 0.313 0.623 1e-52
224080379 528 dihydrofolate reductase-thymidylate synt 0.7 0.265 0.716 5e-50
255543751 528 bifunctional dihydrofolate reductase-thy 0.71 0.268 0.692 2e-49
3097056 577 dihydrofolate reductase-thymidylate synt 0.775 0.268 0.632 2e-48
297744418 608 unnamed protein product [Vitis vinifera] 0.71 0.233 0.676 2e-48
225428412 524 PREDICTED: bifunctional dihydrofolate re 0.71 0.270 0.676 3e-48
449462208 527 PREDICTED: bifunctional dihydrofolate re 0.615 0.233 0.764 4e-48
357467359 504 Dihydrofolate reductase-thymidylate synt 0.745 0.295 0.633 6e-48
1169424 528 RecName: Full=Bifunctional dihydrofolate 0.615 0.232 0.764 6e-48
>gi|225458199|ref|XP_002281129.1| PREDICTED: bifunctional dihydrofolate reductase-thymidylate synthase-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  223 bits (569), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 118/181 (65%), Positives = 136/181 (75%), Gaps = 5/181 (2%)

Query: 20  LSSFRRSFYNIDYVSAMLPLFRVSNVTVKYRFCTRFYVGVNNNMSTLSNDNASMHLRARR 79
           +SSFR         SA+  LF V NV  K R  T + V   ++  +  N +A +H   +R
Sbjct: 21  ISSFRPG-----SASALSRLFTVLNVIAKRRVQTSYSVLSGDSAMSYPNGDARVHPVPQR 75

Query: 80  PYQVVVAATHDMGIGKDGKLPWNLPSDLKFFKQLTMSTSDPGKRNAVVMGRKTWESISPL 139
            YQVVVAATH MGIGKDGKLPWNLPSDLKFFK+LTM+TSDPGK+NAVVMGRKTWESI   
Sbjct: 76  TYQVVVAATHKMGIGKDGKLPWNLPSDLKFFKELTMTTSDPGKKNAVVMGRKTWESIPLN 135

Query: 140 YRPLPGRLNVVLTHSGSFNIASLENVEICRSIHLALELLAEPPYCSSIEKVFVIGGGQIL 199
           YRPLPGRLNVVLT SGSF+ A++ENV IC S+  AL+LLAE PYC SI+KVFVIGGGQIL
Sbjct: 136 YRPLPGRLNVVLTRSGSFDNATVENVVICGSMPSALKLLAESPYCLSIDKVFVIGGGQIL 195

Query: 200 R 200
           R
Sbjct: 196 R 196

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255538724|ref|XP_002510427.1| bifunctional dihydrofolate reductase-thymidylate synthase, putative [Ricinus communis] gi|223551128|gb|EEF52614.1| bifunctional dihydrofolate reductase-thymidylate synthase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224080379|ref|XP_002306118.1| dihydrofolate reductase-thymidylate synthase [Populus trichocarpa] gi|222849082|gb|EEE86629.1| dihydrofolate reductase-thymidylate synthase [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255543751|ref|XP_002512938.1| bifunctional dihydrofolate reductase-thymidylate synthase, putative [Ricinus communis] gi|223547949|gb|EEF49441.1| bifunctional dihydrofolate reductase-thymidylate synthase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|3097056|emb|CAA05895.1| dihydrofolate reductase-thymidylate synthetase precursor [Daucus carota] Back     alignment and taxonomy information
>gi|297744418|emb|CBI37680.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225428412|ref|XP_002280254.1| PREDICTED: bifunctional dihydrofolate reductase-thymidylate synthase-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|449462208|ref|XP_004148833.1| PREDICTED: bifunctional dihydrofolate reductase-thymidylate synthase-like [Cucumis sativus] gi|449507353|ref|XP_004163007.1| PREDICTED: bifunctional dihydrofolate reductase-thymidylate synthase-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|357467359|ref|XP_003603964.1| Dihydrofolate reductase-thymidylate synthase [Medicago truncatula] gi|355493012|gb|AES74215.1| Dihydrofolate reductase-thymidylate synthase [Medicago truncatula] Back     alignment and taxonomy information
>gi|1169424|sp|P45350.1|DRTS_DAUCA RecName: Full=Bifunctional dihydrofolate reductase-thymidylate synthase; Short=DHFR-TS; Includes: RecName: Full=Dihydrofolate reductase; Includes: RecName: Full=Thymidylate synthase gi|288615|emb|CAA78954.1| dihydrofolate reductase-thymidylate synthetase [Daucus carota] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query200
TAIR|locus:2042649 519 THY-1 "thymidylate synthase 1" 0.685 0.263 0.683 1e-45
TAIR|locus:2139544 565 THY-2 "thymidylate synthase 2" 0.84 0.297 0.604 1.3e-45
TAIR|locus:2049389 492 AT2G21550 [Arabidopsis thalian 0.665 0.270 0.607 8.9e-38
SGD|S000005762211 DFR1 "Dihydrofolate reductase 0.58 0.549 0.435 8.7e-24
WB|WBGene00007974189 dhfr-1 [Caenorhabditis elegans 0.59 0.624 0.441 7.8e-23
CGD|CAL0002575192 DFR1 [Candida albicans (taxid: 0.545 0.567 0.444 2.4e-21
UNIPROTKB|Q5A5E0192 DFR1 "Putative uncharacterized 0.545 0.567 0.444 2.4e-21
FB|FBgn0004087182 Dhfr "Dihydrofolate reductase" 0.565 0.620 0.394 5.1e-19
RGD|2500187 Dhfr "dihydrofolate reductase" 0.59 0.631 0.396 5.1e-19
MGI|MGI:94890187 Dhfr "dihydrofolate reductase" 0.59 0.631 0.388 8.3e-19
TAIR|locus:2042649 THY-1 "thymidylate synthase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 480 (174.0 bits), Expect = 1.0e-45, P = 1.0e-45
 Identities = 95/139 (68%), Positives = 111/139 (79%)

Query:    64 STLSNDNASMHLRA--RRPYQVVVAATHDMGIGKDGKLPWNLPSDLKFFKQLTMSTSDPG 121
             +T  ND+ +  L +  +R YQVVVAAT +MGIGKDGKLPWNLP+DLKFFK +T++TSD  
Sbjct:     3 TTTLNDSVTTTLASEPQRTYQVVVAATKEMGIGKDGKLPWNLPTDLKFFKDITLTTSDSS 62

Query:   122 KRNAVVMGRKTWESISPLYRPLPGRLNVVLTHSGSFNIASLENVEICRSIHLALELLAEP 181
             K+NAVVMGRKTWESI   YRPL GRLNVVLT SG F+IA+ ENV  C S+  AL+LLA P
Sbjct:    63 KKNAVVMGRKTWESIPIKYRPLSGRLNVVLTRSGGFDIANTENVVTCSSVDSALDLLAAP 122

Query:   182 PYCSSIEKVFVIGGGQILR 200
             PYC SIE+VFVIGGG ILR
Sbjct:   123 PYCLSIERVFVIGGGDILR 141
GO:0004146 "dihydrofolate reductase activity" evidence=IEA;ISS
GO:0004799 "thymidylate synthase activity" evidence=IEA;ISS
GO:0005737 "cytoplasm" evidence=ISM
GO:0006231 "dTMP biosynthetic process" evidence=IEA
GO:0006545 "glycine biosynthetic process" evidence=IEA
GO:0006730 "one-carbon metabolic process" evidence=IEA
GO:0009165 "nucleotide biosynthetic process" evidence=IEA
GO:0016491 "oxidoreductase activity" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0005829 "cytosol" evidence=IDA
GO:0009257 "10-formyltetrahydrofolate biosynthetic process" evidence=ISS
TAIR|locus:2139544 THY-2 "thymidylate synthase 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2049389 AT2G21550 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
SGD|S000005762 DFR1 "Dihydrofolate reductase involved in tetrahydrofolate biosynthesis" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
WB|WBGene00007974 dhfr-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
CGD|CAL0002575 DFR1 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
UNIPROTKB|Q5A5E0 DFR1 "Putative uncharacterized protein DFR1" [Candida albicans SC5314 (taxid:237561)] Back     alignment and assigned GO terms
FB|FBgn0004087 Dhfr "Dihydrofolate reductase" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
RGD|2500 Dhfr "dihydrofolate reductase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:94890 Dhfr "dihydrofolate reductase" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.5.1.30.737
3rd Layer1.5.10.691

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00014567001
SubName- Full=Chromosome chr18 scaffold_1, whole genome shotgun sequence; (193 aa)
(Vitis vinifera)
Predicted Functional Partners:
GSVIVG00036344001
RecName- Full=Thymidylate synthase; EC=2.1.1.45; (284 aa)
•••  •• 0.983
GSVIVG00014568001
RecName- Full=Thymidylate synthase; EC=2.1.1.45; (284 aa)
•••  •• 0.981
GSVIVG00030018001
SubName- Full=Chromosome chr1 scaffold_5, whole genome shotgun sequence; (483 aa)
•     • 0.825
GSVIVG00024726001
SubName- Full=Chromosome chr6 scaffold_3, whole genome shotgun sequence; (594 aa)
•    •• 0.781
GSVIVG00032399001
SubName- Full=Chromosome chr4 scaffold_6, whole genome shotgun sequence; (228 aa)
•     • 0.730
GSVIVG00022341001
SubName- Full=Chromosome chr14 scaffold_26, whole genome shotgun sequence; (392 aa)
•     • 0.635
GSVIVG00006492001
SubName- Full=Chromosome undetermined scaffold_171, whole genome shotgun sequence; (536 aa)
•    •• 0.608
GSVIVG00005777001
SubName- Full=Chromosome chr3 scaffold_158, whole genome shotgun sequence; (214 aa)
•     • 0.604
GSVIVG00019349001
RecName- Full=Ribonucleoside-diphosphate reductase; EC=1.17.4.1;; Provides the precursors neces [...] (790 aa)
   •  • 0.594
GSVIVG00032161001
RecName- Full=Serine hydroxymethyltransferase; EC=2.1.2.1;; Interconversion of serine and glyci [...] (428 aa)
     •• 0.568

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query200
cd00209158 cd00209, DHFR, Dihydrofolate reductase (DHFR) 3e-44
pfam00186159 pfam00186, DHFR_1, Dihydrofolate reductase 2e-39
PTZ00164 514 PTZ00164, PTZ00164, bifunctional dihydrofolate red 8e-37
COG0262167 COG0262, FolA, Dihydrofolate reductase [Coenzyme m 2e-31
PRK10769159 PRK10769, folA, dihydrofolate reductase; Provision 6e-22
>gnl|CDD|238127 cd00209, DHFR, Dihydrofolate reductase (DHFR) Back     alignment and domain information 
 Score =  144 bits (365), Expect = 3e-44
 Identities = 53/117 (45%), Positives = 70/117 (59%), Gaps = 16/117 (13%)

Query: 84  VVAATHDMGIGKDGKLPWNLPSDLKFFKQLTMSTSDPGKRNAVVMGRKTWESISPLYRPL 143
           +VA   +  IGKD KLPW+LP DLK FK+ T         N V+MGRKT+ESI    RPL
Sbjct: 4   IVAVDENGVIGKDNKLPWHLPEDLKHFKKTTTG-------NPVIMGRKTFESIPR--RPL 54

Query: 144 PGRLNVVLTHSGSFNIASLENVEICRSIHLALELLAEPPYCSSIEKVFVIGGGQILR 200
           PGR N+VL+    +  A  E VE+  S+  ALEL        ++E++FVIGG +I +
Sbjct: 55  PGRTNIVLSRQLDYQDA--EGVEVVHSLEEALELAEN-----TVEEIFVIGGAEIYK 104

Reduces 7,8-dihydrofolate to 5,6,7,8-tetrahydrofolate with NADPH as a cofactor. This is an essential step in the biosynthesis of deoxythymidine phosphate since 5,6,7,8-tetrahydrofolate is required to regenerate 5,10-methylenetetrahydrofolate which is then utilized by thymidylate synthase. Inhibition of DHFR interrupts thymidilate synthesis and DNA replication, inhibitors of DHFR (such as Methotrexate) are used in cancer chemotherapy. 5,6,7,8-tetrahydrofolate also is involved in glycine, serine, and threonine metabolism and aminoacyl-tRNA biosynthesis. Length = 158
>gnl|CDD|215777 pfam00186, DHFR_1, Dihydrofolate reductase Back     alignment and domain information
>gnl|CDD|240299 PTZ00164, PTZ00164, bifunctional dihydrofolate reductase-thymidylate synthase; Provisional Back     alignment and domain information
>gnl|CDD|223340 COG0262, FolA, Dihydrofolate reductase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|182714 PRK10769, folA, dihydrofolate reductase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 200
KOG1324190 consensus Dihydrofolate reductase [Coenzyme transp 100.0
PF00186161 DHFR_1: Dihydrofolate reductase; InterPro: IPR0017 99.97
PRK10769159 folA dihydrofolate reductase; Provisional 99.96
COG0262167 FolA Dihydrofolate reductase [Coenzyme metabolism] 99.95
PTZ00164 514 bifunctional dihydrofolate reductase-thymidylate s 99.94
PRK00478 505 scpA segregation and condensation protein A/unknow 99.92
cd00209158 DHFR Dihydrofolate reductase (DHFR). Reduces 7,8-d 99.92
PF01872200 RibD_C: RibD C-terminal domain; InterPro: IPR00273 99.23
TIGR00227216 ribD_Cterm riboflavin-specific deaminase C-termina 98.87
TIGR00326344 eubact_ribD riboflavin biosynthesis protein RibD. 98.75
PRK05625217 5-amino-6-(5-phosphoribosylamino)uracil reductase; 98.71
PRK14059 251 hypothetical protein; Provisional 97.29
TIGR01508210 rib_reduct_arch 2,5-diamino-6-hydroxy-4-(5-phospho 97.09
PRK14719 360 bifunctional RNAse/5-amino-6-(5-phosphoribosylamin 97.0
PRK10786367 ribD bifunctional diaminohydroxyphosphoribosylamin 96.59
COG1985218 RibD Pyrimidine reductase, riboflavin biosynthesis 95.52
PLN02807380 diaminohydroxyphosphoribosylaminopyrimidine deamin 90.92
>KOG1324 consensus Dihydrofolate reductase [Coenzyme transport and metabolism] Back     alignment and domain information 
Probab=100.00  E-value=1.2e-33  Score=235.16  Aligned_cols=123  Identities=55%  Similarity=0.938  Sum_probs=115.2

Q ss_pred             CccEEEEEEEeCCCeeecCCCCCCcChhhHHHHHHHhhCCCCCCCccEEEEchhhhhhhcCCCCCCCCCeEEEEcCCCCC
Q 029025           78 RRPYQVVVAATHDMGIGKDGKLPWNLPSDLKFFKQLTMSTSDPGKRNAVVMGRKTWESISPLYRPLPGRLNVVLTHSGSF  157 (200)
Q Consensus        78 mrkI~livAvSlDG~IG~~G~LpW~l~eD~~fF~~~T~~~~~p~k~daVIMGRkTyEsi~~~~~pl~~r~~IVlSrt~~~  157 (200)
                      |+.+.++||++.+++||++|+|||+++.|++||++.|+.+++|+|.++|||||||||++|.+.+||++|.|||+||+...
T Consensus         1 ~~~~~~Vva~~~~mGIGk~g~LPW~lpsemkyF~~vT~~tsd~~k~NaViMGRKtweSiP~k~RPL~gRiNiVLSR~~~~   80 (190)
T KOG1324|consen    1 MRLLNLVVALSPNMGIGKNGDLPWPLPSEMKYFRRVTTSTSDPSKKNAVIMGRKTWESIPEKFRPLPGRINVVLSRSLKE   80 (190)
T ss_pred             CceeEEEEEEccccCcccCCCCCCCCHHHHHHHHHHhhccCCcccceeEEecccccccCCcccCCCCCceEEEEecccCc
Confidence            57889999999999999999999999999999999999999999999999999999999999999999999999999886


Q ss_pred             cccCCCCeEEeCCHHHHHHHhcCCCCCCCCCcEEEEeCccccC
Q 029025          158 NIASLENVEICRSIHLALELLAEPPYCSSIEKVFVIGGGQILR  200 (200)
Q Consensus       158 ~~~~~~~v~V~~sl~eaI~~Lk~~~~~~~~kdI~ViGGa~IY~  200 (200)
                      +....++++++.+++.|++.|.++|.+.+.+.|||+||+++|+
T Consensus        81 ~~~~t~~~~~~~slesAl~lL~~pp~~~~ve~vfvIGG~~vy~  123 (190)
T KOG1324|consen   81 DFAPTENVFLSSSLESALDLLEEPPSSNSVEMVFVIGGSEVYS  123 (190)
T ss_pred             CcCCccCEEEeccHHHHHHhhcCCccccceeEEEEEcCHHHHH
Confidence            5444567999999999999999998888889999999999984

>PF00186 DHFR_1: Dihydrofolate reductase; InterPro: IPR001796 Dihydrofolate reductase (DHFR) (1 Back     alignment and domain information
>PRK10769 folA dihydrofolate reductase; Provisional Back     alignment and domain information
>COG0262 FolA Dihydrofolate reductase [Coenzyme metabolism] Back     alignment and domain information
>PTZ00164 bifunctional dihydrofolate reductase-thymidylate synthase; Provisional Back     alignment and domain information
>PRK00478 scpA segregation and condensation protein A/unknown domain fusion protein; Provisional Back     alignment and domain information
>cd00209 DHFR Dihydrofolate reductase (DHFR) Back     alignment and domain information
>PF01872 RibD_C: RibD C-terminal domain; InterPro: IPR002734 This domain is found in the C terminus of the bifunctional deaminase-reductase of Escherichia coli, Bacillus subtilis and other bacteria in combination with IPR002125 from INTERPRO that catalyses the second and third steps in the biosynthesis of riboflavin, i Back     alignment and domain information
>TIGR00227 ribD_Cterm riboflavin-specific deaminase C-terminal domain Back     alignment and domain information
>TIGR00326 eubact_ribD riboflavin biosynthesis protein RibD Back     alignment and domain information
>PRK05625 5-amino-6-(5-phosphoribosylamino)uracil reductase; Validated Back     alignment and domain information
>PRK14059 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01508 rib_reduct_arch 2,5-diamino-6-hydroxy-4-(5-phosphoribosylamino)pyrimidine 1'-reductase, archaeal Back     alignment and domain information
>PRK14719 bifunctional RNAse/5-amino-6-(5-phosphoribosylamino)uracil reductase; Provisional Back     alignment and domain information
>PRK10786 ribD bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase; Provisional Back     alignment and domain information
>COG1985 RibD Pyrimidine reductase, riboflavin biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PLN02807 diaminohydroxyphosphoribosylaminopyrimidine deaminase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query200
3inv_A 521 Trypanosoma Cruzi Dihydrofolate Reductase-Thymidyla 2e-25
2h2q_A 521 Crystal Structure Of Trypanosoma Cruzi Dihydrofolat 3e-25
3qfx_A241 Trypanosoma Brucei Dihydrofolate Reductase Pyrimeth 1e-23
3rg9_A240 Trypanosoma Brucei Dihydrofolate Reductase (Tbdhfr) 1e-23
1ai9_A192 Candida Albicans Dihydrofolate Reductase Length = 1 1e-22
3cse_A227 Candida Glabrata Dihydrofolate Reductase Complexed 5e-21
3ro9_A225 Candida Glabrata Dihydrofolate Reductase Complexed 6e-21
2fzj_A186 New Insights Into Dhfr Interactions: Analysis Of Pn 9e-19
3k45_A186 Alternate Binding Modes Observed For The E- And Z-I 9e-19
3ghv_A186 Human Dihydrofolate Reductase Q35kN64F DOUBLE MUTAN 2e-18
1u70_A186 Understanding The Role Of Leu22 Variants In Methotr 4e-18
3l3r_A186 Structural, Computational And Kinetic Data For Anti 8e-18
1dr1_A189 2.2 Angstroms Crystal Structure Of Chicken Liver Di 9e-18
3f8y_A187 Correlations Of Human Dihydrofolate Reductase With 9e-18
3oaf_A186 Structural And Kinetic Data For Antifolate Interact 9e-18
1cd2_A206 Ligand Induced Conformational Changes In The Crysta 9e-18
3f91_A187 Structural Data For Human Active Site Mutant Enzyme 9e-18
1vj3_A205 Structural Studies On Bio-Active Compounds. Crystal 1e-17
3hj3_A 521 Crystal Structure Of The Chts-Dhfr F207a Non-Active 2e-17
1mvs_A187 Analysis Of Two Polymorphic Forms Of A Pyrido[2,3- 2e-17
3dl5_A 521 Crystal Structure Of The A287f Active Site Mutant O 2e-17
3nxo_A186 Perferential Selection Of Isomer Binding From Chira 2e-17
1qzf_A 521 Crystal Structure Of Dhfr-Ts From Cryptosporidium H 2e-17
1dhf_A186 Crystal Structures Of Recombinant Human Dihydrofola 2e-17
2oip_A 519 Crystal Structure Of The S290g Active Site Mutant O 2e-17
3dl6_A 521 Crystal Structure Of The A287fS290G ACTIVE SITE MUT 2e-17
3f8z_A187 Human Dihydrofolate Reductase Structural Data With 3e-17
3ghc_A186 Design, Synthesis, And X-Ray Crystal Structure Of C 4e-17
3eig_A186 Crystal Structure Of A Methotrexate-Resistant Mutan 5e-17
1dlr_A186 Methotrexate-Resistant Variants Of Human Dihydrofol 5e-17
1hfq_A186 Comparison Of Ternary Crystal Complexes Of Human Di 5e-17
1boz_A186 Structure-Based Design And Synthesis Of Lipophilic 6e-17
1dls_A186 Methotrexate-Resistant Variants Of Human Dihydrofol 8e-17
1u71_A186 Understanding The Role Of Leu22 Variants In Methotr 1e-16
1zdr_A164 Dhfr From Bacillus Stearothermophilus Length = 164 2e-16
3jw3_A168 Crystal Structure Of Bacillus Anthracis (F96i) Dihy 3e-16
3jw5_A168 Crystal Structure Of Bacillus Anthracis (Y102f) Dih 7e-16
3jvx_A168 Crystal Structure Of Bacillus Anthracis Dihydrofola 8e-16
3e0b_A166 Bacillus Anthracis Dihydrofolate Reductase Complexe 8e-16
2qk8_A162 Crystal Structure Of The Anthrax Drug Target, Bacil 8e-16
3fl8_A166 Crystal Structure Of B. Anthracis Dihydrofolate Red 9e-16
3s9u_A165 Bacillus Anthracis Dihydrofolate Reductase Bound To 9e-16
2kgk_A172 Solution Structure Of Bacillus Anthracis Dihydrofol 9e-16
2w3v_A167 Mycobacterium Avium Dihydrofolate Reductase Complex 1e-14
1df7_A159 Dihydrofolate Reductase Of Mycobacterium Tuberculos 6e-14
2cig_A159 Dihydrofolate Reductase From Mycobacterium Tubercul 2e-13
3q1h_A163 Crystal Structure Of Dihydrofolate Reductase From Y 4e-13
4dfr_A159 Crystal Structures Of Escherichia Coli And Lactobac 6e-13
3drc_A159 Investigation Of The Functional Role Of Tryptophan- 6e-13
1dds_A159 Molecule: Dihydrofolate Reductase (E.C.1.5.1.3) Com 6e-13
2inq_B159 Neutron Crystal Structure Of Escherichia Coli Dihyd 6e-13
2d0k_A159 Methionine-Free Mutant Of Escherichia Coli Dihydrof 8e-13
3lg4_A168 Staphylococcus Aureus V31y, F92i Mutant Dihydrofola 8e-13
1dra_A159 Crystal Structure Of Unliganded Escherichia Coli Di 2e-12
2w9s_A161 Staphylococcus Aureus S1:dhfr In Complex With Trime 3e-12
1dhj_A159 Long-Range Structural Effects In A Second-Site Reve 4e-12
1dhi_A159 Long-Range Structural Effects In A Second-Site Reve 4e-12
3ia4_A162 Moritella Profunda Dihydrofolate Reductase (Dhfr) I 5e-12
2zza_A162 Moritella Profunda Dihydrofolate Reductase Complex 5e-12
3f0u_X157 Staphylococcus Aureus F98y Mutant Dihydrofolate Red 7e-12
3m09_A161 F98y Tmp-Resistant Dihydrofolate Reductase From Sta 8e-12
3fy8_X158 Crystal Structure Of Staph. Aureus Dhfr Complexed W 8e-12
4fgg_A163 S. Aureus Dihydrofolate Reductase Co-crystallized W 8e-12
3f0b_X157 Staphylococcus Aureus Dihydrofolate Reductase Compl 8e-12
3sqy_X167 S. Aureus Dihydrofolate Reductase Complexed With No 8e-12
3sgy_A167 Staphylococcus Aureus Dihydrofolate Reductase Compl 8e-12
3fyv_X158 Staph. Aureus Dhfr Complexed With Nadph And Ar-102 8e-12
3sr5_X166 S. Aureus Dihydrofolate Reductase Complexed With No 8e-12
3m08_A161 Wild Type Dihydrofolate Reductase From Staphylococc 8e-12
2w9g_A159 Wild-Type Staphylococcus Aureus Dhfr In Complex Wit 9e-12
1drb_A159 Crystal Structure Of Unliganded Escherichia Coli Di 1e-11
2drc_A159 Investigation Of The Functional Role Of Tryptophan- 1e-11
3i8a_X157 Staphylococcus Aureus H30n, F98y Dihydrofolate Redu 1e-11
3tq8_A178 Structure Of The Dihydrofolate Reductase (Fola) Fro 3e-11
3ql0_A160 Crystal Structure Of N23ppS148A MUTANT OF E. COLI D 1e-10
1lud_A162 Solution Structure Of Dihydrofolate Reductase Compl 2e-10
3dfr_A162 Crystal Structures Of Escherichia Coli And Lactobac 3e-10
2bla_A238 Sp21 Double Mutant P. Vivax Dihydrofolate Reductase 5e-08
2bl9_A238 X-Ray Crystal Structure Of Plasmodium Vivax Dihydro 6e-08
3ix9_A190 Crystal Structure Of Streptococcus Pneumoniae Dihyd 7e-08
1j3i_A 280 Wild-Type Plasmodium Falciparum Dihydrofolate Reduc 9e-08
1j3j_A 280 Double Mutant (C59r+s108n) Plasmodium Falciparum Di 1e-07
3um5_A 608 Double Mutant (A16v+s108t) Plasmodium Falciparum Di 2e-07
1j3k_A 280 Quadruple Mutant (n51i+c59r+s108n+i164l) Plasmodium 3e-07
3qgt_A 608 Crystal Structure Of Wild-Type Pfdhfr-Ts Complexed 6e-07
3jsu_A 608 Quadruple Mutant(N51i+c59r+s108n+i164l) Plasmodium 1e-06
2jyb_A162 Binary Hvdhfr1:folate Complex Length = 162 4e-06
3i3r_A 511 X-Ray Structure Dihydrofolate ReductaseTHYMIDYLATE 4e-06
1vdr_A162 Dihydrofolate Reductase Length = 162 4e-06
3nrr_A 515 Co-Crystal Structure Of Dihydrofolate Reductase-Thy 5e-06
>pdb|3INV|A Chain A, Trypanosoma Cruzi Dihydrofolate Reductase-Thymidylate Synthase Complexed With Nadph, Dump And C-448 Antifolate Length = 521 Back     alignment and structure 
Iteration: 1

 Score =  112 bits (279), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 62/141 (43%), Positives = 78/141 (55%), Gaps = 19/141 (13%)
Query: 77  ARRPYQVVVAATHDMGIGKDGKLPWNLPSDLKFFKQLTMS------TSDPGKRNAVVMGR 130
           A R + +VVA     GIG    +PWN+P D+KFF+ LT           P KRNAVVMGR
Sbjct: 19  ALRAFSLVVAVDEHGGIGDGRSIPWNVPEDMKFFRDLTTKLRGKNVKPSPAKRNAVVMGR 78
Query: 131 KTWESISPLYRPLPGRLNVVLTHS-------------GSFNIASLENVEICRSIHLALEL 177
           KTW+SI P +RPLPGRLNVVL+ +                N+ +   V +   +  AL L
Sbjct: 79  KTWDSIPPKFRPLPGRLNVVLSSTLTTQHLLDGLPDEEKRNLHADSIVAVNGGLEQALRL 138
Query: 178 LAEPPYCSSIEKVFVIGGGQI 198
           LA P Y  SIE V+ IGGG +
Sbjct: 139 LASPNYTPSIETVYCIGGGSV 159
>pdb|2H2Q|A Chain A, Crystal Structure Of Trypanosoma Cruzi Dihydrofolate Reductase- Thymidylate Synthase Length = 521 Back     alignment and structure
>pdb|3QFX|A Chain A, Trypanosoma Brucei Dihydrofolate Reductase Pyrimethamine Complex Length = 241 Back     alignment and structure
>pdb|3RG9|A Chain A, Trypanosoma Brucei Dihydrofolate Reductase (Tbdhfr) In Complex With Wr99210 Length = 240 Back     alignment and structure
>pdb|1AI9|A Chain A, Candida Albicans Dihydrofolate Reductase Length = 192 Back     alignment and structure
>pdb|3CSE|A Chain A, Candida Glabrata Dihydrofolate Reductase Complexed With Nadph And 2,4-Diamino-5-(3-(2,5-Dimethoxyphenyl)prop-1- Ynyl)-6-Ethylpyrimidine (Ucp120b) Length = 227 Back     alignment and structure
>pdb|3RO9|A Chain A, Candida Glabrata Dihydrofolate Reductase Complexed With Nadph And 6- Ethyl-5-[(3r)-3-[3-Methoxy-5-(Pyridin-4-Yl)phenyl]but-1- Yn-1- Yl]pyrimidine-2,4-Diamine (Ucp1006) Length = 225 Back     alignment and structure
>pdb|2FZJ|A Chain A, New Insights Into Dhfr Interactions: Analysis Of Pneumocystis Carinii And Mouse Dhfr Complexes With Nadph And Two Highly Potent Trimethoprim Derivatives Length = 186 Back     alignment and structure
>pdb|3K45|A Chain A, Alternate Binding Modes Observed For The E- And Z-Isomers Of 2,4- Diaminofuro[2,3d]pyrimidines As Ternary Complexes With Nadph And Mouse Dihydrofolate Reductase Length = 186 Back     alignment and structure
>pdb|3GHV|A Chain A, Human Dihydrofolate Reductase Q35kN64F DOUBLE MUTANT INHIBITOR Complex Length = 186 Back     alignment and structure
>pdb|1U70|A Chain A, Understanding The Role Of Leu22 Variants In Methotrexate Resistance: Comparison Of Wild-Type And Leu22arg Variant Mouse And Human Dihydrofolate Reductase Length = 186 Back     alignment and structure
>pdb|3L3R|A Chain A, Structural, Computational And Kinetic Data For Antifolate Interactions Against Pneumocystis Jirovecii, Pneumocystis Carinii And Human Dihydrofolate Reductase And Their Active Site Mutants Length = 186 Back     alignment and structure
>pdb|1DR1|A Chain A, 2.2 Angstroms Crystal Structure Of Chicken Liver Dihydrofolate Reductase Complexed With Nadp+ And Biopterin Length = 189 Back     alignment and structure
>pdb|3F8Y|A Chain A, Correlations Of Human Dihydrofolate Reductase With Structural Data For Human Active Site Mutant Enzyme Complexes Length = 187 Back     alignment and structure
>pdb|3OAF|A Chain A, Structural And Kinetic Data For Antifolate Interactions Against Pneumocystis Jirovecii, Pneumocystis Carinii And Human Dihydrofolate Reductase And Thier Active Site Mutants Length = 186 Back     alignment and structure
>pdb|1CD2|A Chain A, Ligand Induced Conformational Changes In The Crystal Structures Of Pneumocystis Carinii Dihydrofolate Reductase Complexes With Folate And Nadp+ Length = 206 Back     alignment and structure
>pdb|3F91|A Chain A, Structural Data For Human Active Site Mutant Enzyme Complexes Length = 187 Back     alignment and structure
>pdb|1VJ3|A Chain A, Structural Studies On Bio-Active Compounds. Crystal Structure And Molecular Modeling Studies On The Pneumocystis Carinii Dihydrofolate Reductase Cofactor Complex With Tab, A Highly Selective Antifolate Length = 205 Back     alignment and structure
>pdb|3HJ3|A Chain A, Crystal Structure Of The Chts-Dhfr F207a Non-Active Site Mut Length = 521 Back     alignment and structure
>pdb|1MVS|A Chain A, Analysis Of Two Polymorphic Forms Of A Pyrido[2,3- D]pyrimidine N9-C10 Reverse-Bridge Antifolate Binary Complex With Human Dihydrofolate Reductase Length = 187 Back     alignment and structure
>pdb|3DL5|A Chain A, Crystal Structure Of The A287f Active Site Mutant Of Ts- Dhfr From Cryptosporidium Hominis Length = 521 Back     alignment and structure
>pdb|3NXO|A Chain A, Perferential Selection Of Isomer Binding From Chiral Mixtures: Alternate Binding Modes Observed For The E- And Z-Isomers Of A Series Of 5-Substituted 2,4-Diaminofuro[2,3-D]pyrimidines As Ternary Complexes With Nadph And Human Dihydrofolate Reductase Length = 186 Back     alignment and structure
>pdb|1QZF|A Chain A, Crystal Structure Of Dhfr-Ts From Cryptosporidium Hominis Length = 521 Back     alignment and structure
>pdb|1DHF|A Chain A, Crystal Structures Of Recombinant Human Dihydrofolate Reductase Complexed With Folate And 5-Deazofolate Length = 186 Back     alignment and structure
>pdb|2OIP|A Chain A, Crystal Structure Of The S290g Active Site Mutant Of Ts- Dhfr From Cryptosporidium Hominis Length = 519 Back     alignment and structure
>pdb|3DL6|A Chain A, Crystal Structure Of The A287fS290G ACTIVE SITE MUTANT OF Ts-Dhfr From Cryptosporidium Hominis Length = 521 Back     alignment and structure
>pdb|3F8Z|A Chain A, Human Dihydrofolate Reductase Structural Data With Active Site Mutant Enzyme Complexes Length = 187 Back     alignment and structure
>pdb|3GHC|A Chain A, Design, Synthesis, And X-Ray Crystal Structure Of Classical And Nonclassical 2-Amino-4-Oxo-5-Substituted-6-Thieno[2,3- D]pyrimidines As Dual Thymidylate Synthase And Dihydrofolate Reductase Inhibitors And As Potential Antitumor Agenst Length = 186 Back     alignment and structure
>pdb|3EIG|A Chain A, Crystal Structure Of A Methotrexate-Resistant Mutant Of Human Dihydrofolate Reductase Length = 186 Back     alignment and structure
>pdb|1DLR|A Chain A, Methotrexate-Resistant Variants Of Human Dihydrofolate Reductase With Substitution Of Leucine 22: Kinetics, Crystallography And Potential As Selectable Markers Length = 186 Back     alignment and structure
>pdb|1HFQ|A Chain A, Comparison Of Ternary Crystal Complexes Of Human Dihydrofolate Reductase With Nadph And A Classical Antitumor Furopyrimdine Length = 186 Back     alignment and structure
>pdb|1BOZ|A Chain A, Structure-Based Design And Synthesis Of Lipophilic 2,4- Diamino-6-Substituted Quinazolines And Their Evaluation As Inhibitors Of Dihydrofolate Reductase And Potential Antitumor Agents Length = 186 Back     alignment and structure
>pdb|1DLS|A Chain A, Methotrexate-Resistant Variants Of Human Dihydrofolate Reductase With Substitution Of Leucine 22: Kinetics, Crystallography And Potential As Selectable Markers Length = 186 Back     alignment and structure
>pdb|1U71|A Chain A, Understanding The Role Of Leu22 Variants In Methotrexate Resistance: Comparison Of Wild-type And Leu22arg Variant Mouse And Human Dihydrofolate Reductase Ternary Crystal Complexes With Methotrexate And Nadph Length = 186 Back     alignment and structure
>pdb|1ZDR|A Chain A, Dhfr From Bacillus Stearothermophilus Length = 164 Back     alignment and structure
>pdb|3JW3|A Chain A, Crystal Structure Of Bacillus Anthracis (F96i) Dihydrofolate Reductase Complexed With Nadph And Trimethoprim Length = 168 Back     alignment and structure
>pdb|3JW5|A Chain A, Crystal Structure Of Bacillus Anthracis (Y102f) Dihydrofolate Reductase Complexed With Nadph And Trimethoprim Length = 168 Back     alignment and structure
>pdb|3JVX|A Chain A, Crystal Structure Of Bacillus Anthracis Dihydrofolate Reductase Complexed With Nadph And 2,4-Diamino-5-(3-(3,4,5-Trimethoxyphenyl) Prop-1-Ynyl)-6-Ethylpyrimidine (Ucp120a) Length = 168 Back     alignment and structure
>pdb|3E0B|A Chain A, Bacillus Anthracis Dihydrofolate Reductase Complexed With Nadph And 2,4-Diamino-5-(3-(2,5-Dimethoxyphenyl)prop-1- Ynyl)-6-Ethylpyrimidine (Ucp120b) Length = 166 Back     alignment and structure
>pdb|2QK8|A Chain A, Crystal Structure Of The Anthrax Drug Target, Bacillus Anthracis Dihydrofolate Reductase Length = 162 Back     alignment and structure
>pdb|3FL8|A Chain A, Crystal Structure Of B. Anthracis Dihydrofolate Reductase (Dhfr) With Rab1, A Tmp-Dihydrophthalazine Derivative Length = 166 Back     alignment and structure
>pdb|3S9U|A Chain A, Bacillus Anthracis Dihydrofolate Reductase Bound To Propargyl-Linked Tmp Analog, Ucp120j Length = 165 Back     alignment and structure
>pdb|2KGK|A Chain A, Solution Structure Of Bacillus Anthracis Dihydrofolate Reductase Length = 172 Back     alignment and structure
>pdb|2W3V|A Chain A, Mycobacterium Avium Dihydrofolate Reductase Complexed With Nadph And Trimethoprim Length = 167 Back     alignment and structure
>pdb|1DF7|A Chain A, Dihydrofolate Reductase Of Mycobacterium Tuberculosis Complexed With Nadph And Methotrexate Length = 159 Back     alignment and structure
>pdb|2CIG|A Chain A, Dihydrofolate Reductase From Mycobacterium Tuberculosis Inhibited By The Acyclic 4r Isomer Of Inh-Nadp A Derivative Of The Prodrug Isoniazid Length = 159 Back     alignment and structure
>pdb|3Q1H|A Chain A, Crystal Structure Of Dihydrofolate Reductase From Yersinia Pestis Length = 163 Back     alignment and structure
>pdb|4DFR|A Chain A, Crystal Structures Of Escherichia Coli And Lactobacillus Casei Dihydrofolate Reductase Refined At 1.7 Angstroms Resolution. I. General Features And Binding Of Methotrexate Length = 159 Back     alignment and structure
>pdb|3DRC|A Chain A, Investigation Of The Functional Role Of Tryptophan-22 In Escherichia Coli Dihydrofolate Reductase By Site-Directed Mutagenesis Length = 159 Back     alignment and structure
>pdb|1DDS|A Chain A, Molecule: Dihydrofolate Reductase (E.C.1.5.1.3) Complexed With Methotrexate Length = 159 Back     alignment and structure
>pdb|2INQ|B Chain B, Neutron Crystal Structure Of Escherichia Coli Dihydrofolate Reductase Bound To The Anti-Cancer Drug, Methotrexate Length = 159 Back     alignment and structure
>pdb|2D0K|A Chain A, Methionine-Free Mutant Of Escherichia Coli Dihydrofolate Reductase Length = 159 Back     alignment and structure
>pdb|3LG4|A Chain A, Staphylococcus Aureus V31y, F92i Mutant Dihydrofolate Reductase Complexed With Nadph And 5-[(3s)-3-(5-Methoxy-2',6'-Dimethylbiphenyl- 3-Yl)but-1-Yn-1-Yl]-6-Methylpyrimidine-2,4-Diamine Length = 168 Back     alignment and structure
>pdb|1DRA|A Chain A, Crystal Structure Of Unliganded Escherichia Coli Dihydrofolate Reductase. Ligand-Induced Conformational Changes And Cooperativity In Binding Length = 159 Back     alignment and structure
>pdb|2W9S|A Chain A, Staphylococcus Aureus S1:dhfr In Complex With Trimethoprim Length = 161 Back     alignment and structure
>pdb|1DHJ|A Chain A, Long-Range Structural Effects In A Second-Site Revertant Of A Mutant Dihydrofolate Reductase Length = 159 Back     alignment and structure
>pdb|1DHI|A Chain A, Long-Range Structural Effects In A Second-Site Revertant Of A Mutant Dihydrofolate Reductase Length = 159 Back     alignment and structure
>pdb|3IA4|A Chain A, Moritella Profunda Dihydrofolate Reductase (Dhfr) In Complex With Nadph And Methotrexate (Mtx) Length = 162 Back     alignment and structure
>pdb|2ZZA|A Chain A, Moritella Profunda Dihydrofolate Reductase Complex With Nadp+ And Folate Length = 162 Back     alignment and structure
>pdb|3F0U|X Chain X, Staphylococcus Aureus F98y Mutant Dihydrofolate Reductase Complexed With Nadph And 2,4-Diamino-5-[3-(3-Methoxy-5- Phenylphenyl)but-1-Ynyl]-6-Methylpyrimidine Length = 157 Back     alignment and structure
>pdb|3M09|A Chain A, F98y Tmp-Resistant Dihydrofolate Reductase From Staphylococcus Aureus With Inhibitor Rab1 Length = 161 Back     alignment and structure
>pdb|3FY8|X Chain X, Crystal Structure Of Staph. Aureus Dhfr Complexed With Nadph And Ar-101 Length = 158 Back     alignment and structure
>pdb|4FGG|A Chain A, S. Aureus Dihydrofolate Reductase Co-crystallized With Propyl-dap Isobutenyl-dihydrophthalazine Inhibitor Length = 163 Back     alignment and structure
>pdb|3F0B|X Chain X, Staphylococcus Aureus Dihydrofolate Reductase Complexed With Nadph And 2,4-Diamino-5-[3-(3-Methoxy-5-Phenylphenyl) But-1-Ynyl]-6-Methylpyrimidine Length = 157 Back     alignment and structure
>pdb|3SQY|X Chain X, S. Aureus Dihydrofolate Reductase Complexed With Novel 7-Aryl-2,4- Diaminoquinazolines Length = 167 Back     alignment and structure
>pdb|3SGY|A Chain A, Staphylococcus Aureus Dihydrofolate Reductase Complexed With Nadph And 6-Ethyl-5-[(3s)-3-[3-Methoxy-5-(Pyridin-4-Yl)phenyl]but- 1-Yn-1- Yl]pyrimidine-2,4-Diamine (Ucp1006) Length = 167 Back     alignment and structure
>pdb|3FYV|X Chain X, Staph. Aureus Dhfr Complexed With Nadph And Ar-102 Length = 158 Back     alignment and structure
>pdb|3SR5|X Chain X, S. Aureus Dihydrofolate Reductase Complexed With Novel 7-Aryl-2,4- Diaminoquinazolines Length = 166 Back     alignment and structure
>pdb|3M08|A Chain A, Wild Type Dihydrofolate Reductase From Staphylococcus Aureus With Inhibitor Rab1 Length = 161 Back     alignment and structure
>pdb|2W9G|A Chain A, Wild-Type Staphylococcus Aureus Dhfr In Complex With Nadph And Trimethoprim Length = 159 Back     alignment and structure
>pdb|1DRB|A Chain A, Crystal Structure Of Unliganded Escherichia Coli Dihydrofolate Reductase. Ligand-Induced Conformational Changes And Cooperativity In Binding Length = 159 Back     alignment and structure
>pdb|2DRC|A Chain A, Investigation Of The Functional Role Of Tryptophan-22 In Escherichia Coli Dihydrofolate Reductase By Site-Directed Mutagenesis Length = 159 Back     alignment and structure
>pdb|3I8A|X Chain X, Staphylococcus Aureus H30n, F98y Dihydrofolate Reductase Complexed With Nadph And 2,4-Diamino-5-(3-(2,5- Dimethoxyphenyl)prop-1-Ynyl)-6-Ethylpyrimidine (Ucp120b) Length = 157 Back     alignment and structure
>pdb|3TQ8|A Chain A, Structure Of The Dihydrofolate Reductase (Fola) From Coxiella Burnetii In Complex With Trimethoprim Length = 178 Back     alignment and structure
>pdb|3QL0|A Chain A, Crystal Structure Of N23ppS148A MUTANT OF E. COLI DIHYDROFOLATE Reductase Length = 160 Back     alignment and structure
>pdb|1LUD|A Chain A, Solution Structure Of Dihydrofolate Reductase Complexed With Trimethoprim And Nadph, 24 Structures Length = 162 Back     alignment and structure
>pdb|3DFR|A Chain A, Crystal Structures Of Escherichia Coli And Lactobacillus Casei Dihydrofolate Reductase Refined At 1.7 Angstroms Resolution. I. General Features And Binding Of Methotrexate Length = 162 Back     alignment and structure
>pdb|2BLA|A Chain A, Sp21 Double Mutant P. Vivax Dihydrofolate Reductase In Complex With Pyrimethamine Length = 238 Back     alignment and structure
>pdb|2BL9|A Chain A, X-Ray Crystal Structure Of Plasmodium Vivax Dihydrofolate Reductase In Complex With Pyrimethamine And Its Derivative Length = 238 Back     alignment and structure
>pdb|3IX9|A Chain A, Crystal Structure Of Streptococcus Pneumoniae Dihydrofolate Reductase - Sp9 Mutant Length = 190 Back     alignment and structure
>pdb|1J3I|A Chain A, Wild-Type Plasmodium Falciparum Dihydrofolate Reductase- Thymidylate Synthase (Pfdhfr-Ts) Complexed With Wr99210, Nadph, And Dump Length = 280 Back     alignment and structure
>pdb|1J3J|A Chain A, Double Mutant (C59r+s108n) Plasmodium Falciparum Dihydrofolate Reductase-Thymidylate Synthase (Pfdhfr-Ts) Complexed With Pyrimethamine, Nadph, And Dump Length = 280 Back     alignment and structure
>pdb|3UM5|A Chain A, Double Mutant (A16v+s108t) Plasmodium Falciparum Dihydrofolate Reductase-Thymidylate Synthase (Pfdhfr-Ts-T994) COMPLEXED WITH Pyrimethamine, Nadph, And Dump Length = 608 Back     alignment and structure
>pdb|1J3K|A Chain A, Quadruple Mutant (n51i+c59r+s108n+i164l) Plasmodium Falciparum Dihydrofolate Reductase-thymidylate Synthase (pfdhfr-ts) Complexed With Wr99210, Nadph, And Dump Length = 280 Back     alignment and structure
>pdb|3QGT|A Chain A, Crystal Structure Of Wild-Type Pfdhfr-Ts Complexed With Nadph, Dump And Pyrimethamine Length = 608 Back     alignment and structure
>pdb|3JSU|A Chain A, Quadruple Mutant(N51i+c59r+s108n+i164l) Plasmodium Falciparum Dihydrofolate Reductase-Thymidylate Synthase(Pfdhfr-Ts) Complexed With Qn254, Nadph, And Dump Length = 608 Back     alignment and structure
>pdb|2JYB|A Chain A, Binary Hvdhfr1:folate Complex Length = 162 Back     alignment and structure
>pdb|3I3R|A Chain A, X-Ray Structure Dihydrofolate ReductaseTHYMIDYLATE SYNTHASE FROM Babesia Bovis At 2.35a Resolution Length = 511 Back     alignment and structure
>pdb|1VDR|A Chain A, Dihydrofolate Reductase Length = 162 Back     alignment and structure
>pdb|3NRR|A Chain A, Co-Crystal Structure Of Dihydrofolate Reductase-Thymidylate Synthase From Babesia Bovis With Dump, Raltitrexed And Nadp Length = 515 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query200
3cse_A227 Dihydrofolate reductase; protein-ligand complex, o 1e-59
3irm_A 521 Bifunctional dihydrofolate reductase-thymidylate; 6e-59
3hj3_A 521 Chain A, crystal structure of DHFR; TS, enzyme, cr 8e-59
3rg9_A240 Bifunctional dihydrofolate reductase-thymidylate; 1e-58
3nzb_X206 Dihydrofolate reductase; pneumocystius carinii DHF 3e-58
1kmv_A186 DHFR, dihydrofolate reductase; oxidoreductase, ant 1e-57
1aoe_A192 DHFR, dihydrofolate reductase; oxidoreductase, ant 9e-57
3nrr_A 515 Dihydrofolate reductase-thymidylate synthase; stru 7e-53
2w3w_A167 Dihydrofolate reductase; nonclassical antifolates, 2e-45
1j3k_A 280 Bifunctional dihydrofolate reductase-thymidylate s 5e-45
3dfr_A162 Dihydrofolate reductase; oxido-reductase; HET: NDP 9e-44
1df7_A159 DHFR, dihydrofolate reductase; structure-based inh 1e-43
1zdr_A164 Dihydrofolate reductase; DHFR, NADP, oxidoreductas 3e-43
3ia4_A162 Dihydrofolate reductase; NADPH, methotrexate, oxid 8e-43
3tq8_A178 Dihydrofolate reductase; oxidoreductase-oxidoreduc 1e-42
3s9u_A165 Dihydrofolate reductase; oxidoreductase; HET: NAP 2e-42
3dau_A159 Dihydrofolate reductase; oxidoreductase, pseudo-ro 2e-42
2bl9_A238 Dihydrofolate reductase-thymidylate synthase; plam 2e-42
3qg2_A 608 Bifunctional dihydrofolate reductase-thymidylate; 4e-42
3ix9_A190 Dihydrofolate reductase; central beta sheet surrou 4e-41
2w9h_A159 DHFR, dihydrofolate reductase; oxidoreductase, one 6e-41
1vdr_A162 DHFR, dihydrofolate reductase; oxidoreductase, hal 3e-39
1juv_A193 DHFR, dihydrofolate reductase; complexed with NADP 6e-36
1cz3_A168 Dihydrofolate reductase; dimer, hyperthermophIle, 1e-30
2xw7_A178 Dihydrofolate reductase; oxidoreductase, NADPH; HE 5e-05
3jtw_A178 Dihydrofolate reductase; YP_805003.1, structural G 5e-04
>3cse_A Dihydrofolate reductase; protein-ligand complex, oxidoreductase; HET: NAP N22; 1.60A {Candida glabrata} PDB: 3eej_A* 3eek_A* 3eel_A* 3eem_A* 3qlx_A* 3qly_A* 3qlz_A* Length = 227 Back     alignment and structure
 Score =  185 bits (471), Expect = 1e-59
 Identities = 47/118 (39%), Positives = 73/118 (61%), Gaps = 2/118 (1%)

Query: 83  VVVAATHDMGIGKDGKLPWNLPSDLKFFKQLTMSTSDPGKRNAVVMGRKTWESISPLYRP 142
           +V A   +MGIG  G LPW L  ++K+F+++T  T+D  K+N V+MGRKTWESI   +RP
Sbjct: 9   IVAALLPEMGIGFQGNLPWRLAKEMKYFREVTTLTNDNSKQNVVIMGRKTWESIPQKFRP 68

Query: 143 LPGRLNVVLTHSGSFNIASL-ENVEICRSIHLALELLAE-PPYCSSIEKVFVIGGGQI 198
           LP R+NVV++ S    +  + + +    S+   L  L       + IE++++IGGG+I
Sbjct: 69  LPKRINVVVSRSFDGELRKVEDGIYHSNSLRNCLTALQSSLANENKIERIYIIGGGEI 126
>3irm_A Bifunctional dihydrofolate reductase-thymidylate; DHFR-TS antifolate complex, methyltransfe multifunctional enzyme, NADP; HET: 1CY; 2.10A {Trypanosoma cruzi} PDB: 3inv_A* 3irn_A* 3iro_A* 2h2q_A* 3cl9_A* 3clb_A* 3hbb_A* 3kjs_A* Length = 521 Back     alignment and structure
>3hj3_A Chain A, crystal structure of DHFR; TS, enzyme, crossover, non-active site, oxidoreductase; HET: UMP CB3 MTX NDP; 2.70A {Cryptosporidium hominis} PDB: 1qzf_A* 1sej_A* 3dl5_A* 3dl6_A* 2oip_A* Length = 521 Back     alignment and structure
>3rg9_A Bifunctional dihydrofolate reductase-thymidylate; oxidoreductase, oxidoreductase-oxidoreductase inhibitor complex; HET: NDP WRA; 2.00A {Trypanosoma brucei rhodesiense} PDB: 3qfx_A* Length = 240 Back     alignment and structure
>3nzb_X Dihydrofolate reductase; pneumocystius carinii DHFR inhibitor complexes, oxidoreducta oxidoreductase-oxidoreductase inhibitor complex; HET: D2N NAP; 1.45A {Pneumocystis carinii} PDB: 1daj_A* 1cd2_A* 1e26_A* 1klk_A* 1ly3_A* 1ly4_A* 1s3y_A* 2cd2_A* 2fzh_A* 1dyr_A* 3cd2_A* 3nz6_X* 3nz9_X* 3nza_X* 2fzi_A* 3nzc_X* 3td8_A* 4cd2_A* 1vj3_A* Length = 206 Back     alignment and structure
>1kmv_A DHFR, dihydrofolate reductase; oxidoreductase, antiparasitic drugs, lipophilic antifolates; HET: LII NDP; 1.05A {Homo sapiens} SCOP: c.71.1.1 PDB: 1dhf_A* 1hfr_A* 1drf_A* 1kms_A* 1ohj_A* 1ohk_A* 1pd8_A* 1pd9_A* 1pdb_A 1s3u_A* 1s3v_A* 1s3w_A* 1u72_A* 1yho_A* 2c2s_A* 2c2t_A* 2dhf_A* 3ghw_A* 3ntz_A* 3nu0_A* ... Length = 186 Back     alignment and structure
>1aoe_A DHFR, dihydrofolate reductase; oxidoreductase, antifungal target; HET: NDP GW3; 1.60A {Candida albicans} SCOP: c.71.1.1 PDB: 1ai9_A* 1ia1_A* 1ia2_A* 1ia3_A* 1ia4_A* 1m78_A* 1m79_A* 1m7a_A* 3qlr_A* 3qls_A* 3qlw_A* Length = 192 Back     alignment and structure
>3nrr_A Dihydrofolate reductase-thymidylate synthase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, niaid, DHFR; HET: NAP D16 UMP; 1.80A {Babesia bovis} PDB: 3kjr_A* 3i3r_A* 3k2h_A* Length = 515 Back     alignment and structure
>2w3w_A Dihydrofolate reductase; nonclassical antifolates, one-carbon metabolism, lipophilic antifolates, NADP, oxidoreductase; HET: VG9 NDP; 1.60A {Mycobacterium avium} PDB: 2w3v_A* Length = 167 Back     alignment and structure
>1j3k_A Bifunctional dihydrofolate reductase-thymidylate synthase; oxidoreductase, transferase; HET: WRA NDP UMP; 2.10A {Plasmodium falciparum} SCOP: c.71.1.1 PDB: 3dg8_A* 1j3j_A* 1j3i_A* 3dga_A* Length = 280 Back     alignment and structure
>3dfr_A Dihydrofolate reductase; oxido-reductase; HET: NDP MTX; 1.70A {Lactobacillus casei} SCOP: c.71.1.1 PDB: 1ao8_A* 1bzf_A* 1dis_A* 1diu_A* 1lud_A* 2hm9_A* 2hqp_A* 2l28_A 2lf1_A* Length = 162 Back     alignment and structure
>1df7_A DHFR, dihydrofolate reductase; structure-based inhibitor design, folateanalogs, rossmann fold; HET: NDP MTX; 1.70A {Mycobacterium tuberculosis} SCOP: c.71.1.1 PDB: 1dg5_A* 1dg7_A* 1dg8_A* 2cig_A* Length = 159 Back     alignment and structure
>1zdr_A Dihydrofolate reductase; DHFR, NADP, oxidoreductase; 2.00A {Geobacillus stearothermophilus} Length = 164 Back     alignment and structure
>3ia4_A Dihydrofolate reductase; NADPH, methotrexate, oxidoreductase; HET: NDP MTX; 1.70A {Moritella profunda} PDB: 3ia5_A 2zza_A* Length = 162 Back     alignment and structure
>3tq8_A Dihydrofolate reductase; oxidoreductase-oxidoreductase inhib complex; HET: NDP TOP; 1.90A {Coxiella burnetii} PDB: 3tq9_A* 3tqa_A* 3tqb_A* Length = 178 Back     alignment and structure
>3s9u_A Dihydrofolate reductase; oxidoreductase; HET: NAP 5DR; 1.90A {Bacillus anthracis} PDB: 3sa1_A* 3sa2_A* 3sai_A* 3e0b_A* 3jvx_A* 3jwm_A* 3jwk_A* 3jw5_A* 3jwf_A* 3jwc_A* 3jw3_A* 3dat_A* 2qk8_A* 3fl8_A* 3fl9_A* 2kgk_A* Length = 165 Back     alignment and structure
>3dau_A Dihydrofolate reductase; oxidoreductase, pseudo-rossmann fold, adenine nucleotide BIN domain, antibiotic resistance, methotrexate resistance; HET: MTX NAP; 1.50A {Escherichia coli} PDB: 1ddr_A* 1dds_A* 3k74_A 1ra9_A* 1dre_A* 1drh_A* 1dyi_A* 1dyh_A* 1jol_A* 1jom_A* 1ra1_A* 1dyj_A* 1ra3_A* 1ra8_A* 1ra2_A* 1rb2_A* 1rb3_A* 1rc4_A* 1rd7_A* 1re7_A* ... Length = 159 Back     alignment and structure
>2bl9_A Dihydrofolate reductase-thymidylate synthase; plamodium vivax, pyrimethamine, malaria, drug resistance, oxidoreductase; HET: NDP CP6; 1.9A {Plasmodium vivax} PDB: 2blb_A* 2blc_A* 2bla_A* Length = 238 Back     alignment and structure
>3qg2_A Bifunctional dihydrofolate reductase-thymidylate; pyrimethamine, antifolate resistance, oxidoreductase, transferase; HET: CP6 NDP UMP; 2.30A {Plasmodium falciparum} PDB: 3jsu_A* 3qgt_A* Length = 608 Back     alignment and structure
>3ix9_A Dihydrofolate reductase; central beta sheet surrounded by 4 alpha helices, oxidoreductase; HET: NDP MTX; 1.95A {Streptococcus pneumoniae} Length = 190 Back     alignment and structure
>2w9h_A DHFR, dihydrofolate reductase; oxidoreductase, one-carbon metabolism; HET: TOP; 1.48A {Staphylococcus aureus} PDB: 2w9g_A* 3sqy_X* 3srq_X* 3srr_X* 3srs_X* 3sru_X* 3srw_X* 3frd_X* 3fre_X* 3frf_X* 3fyv_X* 3fyw_X* 3sr5_X* 3frb_X* 3fra_X* 3fy8_X* 3fy9_X* 3fq0_A* 3f0b_X* 3f0s_X* ... Length = 159 Back     alignment and structure
>1vdr_A DHFR, dihydrofolate reductase; oxidoreductase, halophilic enzyme; 2.55A {Haloferax volcanii} SCOP: c.71.1.1 PDB: 2ith_A 2jyb_A Length = 162 Back     alignment and structure
>1juv_A DHFR, dihydrofolate reductase; complexed with NADPH, oxidoreductase; HET: NDP; 1.70A {Enterobacteria phage T4} SCOP: c.71.1.1 Length = 193 Back     alignment and structure
>1cz3_A Dihydrofolate reductase; dimer, hyperthermophIle, oxidoreductase; 2.10A {Thermotoga maritima} SCOP: c.71.1.1 PDB: 1d1g_A* Length = 168 Back     alignment and structure
>2xw7_A Dihydrofolate reductase; oxidoreductase, NADPH; HET: PG4 NDP; 2.00A {Mycobacterium smegmatis} Length = 178 Back     alignment and structure
>3jtw_A Dihydrofolate reductase; YP_805003.1, structural GE joint center for structural genomics, JCSG, protein structu initiative; 1.90A {Pediococcus pentosaceus atcc 25745} Length = 178 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query200
3rg9_A240 Bifunctional dihydrofolate reductase-thymidylate; 99.97
3nzb_X206 Dihydrofolate reductase; pneumocystius carinii DHF 99.97
3ix9_A190 Dihydrofolate reductase; central beta sheet surrou 99.97
3ia4_A162 Dihydrofolate reductase; NADPH, methotrexate, oxid 99.97
3tq8_A178 Dihydrofolate reductase; oxidoreductase-oxidoreduc 99.97
3s9u_A165 Dihydrofolate reductase; oxidoreductase; HET: NAP 99.97
1kmv_A186 DHFR, dihydrofolate reductase; oxidoreductase, ant 99.97
3dau_A159 Dihydrofolate reductase; oxidoreductase, pseudo-ro 99.97
3dfr_A162 Dihydrofolate reductase; oxido-reductase; HET: NDP 99.96
3irm_A 521 Bifunctional dihydrofolate reductase-thymidylate; 99.96
1vdr_A162 DHFR, dihydrofolate reductase; oxidoreductase, hal 99.96
2w3w_A167 Dihydrofolate reductase; nonclassical antifolates, 99.96
1zdr_A164 Dihydrofolate reductase; DHFR, NADP, oxidoreductas 99.96
3nrr_A 515 Dihydrofolate reductase-thymidylate synthase; stru 99.95
2w9h_A159 DHFR, dihydrofolate reductase; oxidoreductase, one 99.95
3cse_A227 Dihydrofolate reductase; protein-ligand complex, o 99.95
1df7_A159 DHFR, dihydrofolate reductase; structure-based inh 99.95
1aoe_A192 DHFR, dihydrofolate reductase; oxidoreductase, ant 99.95
3hj3_A 521 Chain A, crystal structure of DHFR; TS, enzyme, cr 99.95
2bl9_A238 Dihydrofolate reductase-thymidylate synthase; plam 99.94
1j3k_A 280 Bifunctional dihydrofolate reductase-thymidylate s 99.94
3qg2_A 608 Bifunctional dihydrofolate reductase-thymidylate; 99.93
1juv_A193 DHFR, dihydrofolate reductase; complexed with NADP 99.93
3jtw_A178 Dihydrofolate reductase; YP_805003.1, structural G 99.9
1cz3_A168 Dihydrofolate reductase; dimer, hyperthermophIle, 99.88
3ky8_A197 Putative riboflavin biosynthesis protein; structur 99.83
2xw7_A178 Dihydrofolate reductase; oxidoreductase, NADPH; HE 99.8
2gd9_A189 Hypothetical protein YYAP; structural genomics, jo 99.77
3kgy_A231 Bifunctional deaminase-reductase domain protein; p 99.67
2b3z_A373 Riboflavin biosynthesis protein RIBD; alpha/beta/a 99.31
2azn_A219 HTP reductase, putative 5-amino-6-(5-phosphoribosy 99.21
2hxv_A360 Diaminohydroxyphosphoribosylaminopyrimidine deami 99.08
2g6v_A402 Riboflavin biosynthesis protein RIBD; RIBD APO str 98.94
2p4g_A 270 Hypothetical protein; pyrimidine reductase-like pr 98.59
>3rg9_A Bifunctional dihydrofolate reductase-thymidylate; oxidoreductase, oxidoreductase-oxidoreductase inhibitor complex; HET: NDP WRA; 2.00A {Trypanosoma brucei rhodesiense} PDB: 3qfx_A* Back     alignment and structure
Probab=99.97  E-value=4.7e-33  Score=239.86  Aligned_cols=125  Identities=46%  Similarity=0.827  Sum_probs=105.7

Q ss_pred             CCCccEEEEEEEeCCCeeecCCCCCCcChhhHHHHHHHhhC------CCCCCCccEEEEchhhhhhhcCCCCCCCCCeEE
Q 029025           76 RARRPYQVVVAATHDMGIGKDGKLPWNLPSDLKFFKQLTMS------TSDPGKRNAVVMGRKTWESISPLYRPLPGRLNV  149 (200)
Q Consensus        76 ~~mrkI~livAvSlDG~IG~~G~LpW~l~eD~~fF~~~T~~------~~~p~k~daVIMGRkTyEsi~~~~~pl~~r~~I  149 (200)
                      ..||+|++|+|+++||+||++|+|||++++|++||+++|.+      ..+|++.++|||||||||++|.+.+|||+|.+|
T Consensus        24 ~~mr~i~lIvA~s~ng~IG~~g~LPW~lp~Dm~~Fk~~T~g~p~~~~~~~~~~~naVIMGRKT~ESip~~~rPLp~R~nI  103 (240)
T 3rg9_A           24 PPLRPFSVVVASDEKGGIGDGGTIPWEIPEDMQYFRRVTTNLRGKNVKPSPSKRNAVVMGRKTWDSLPPKFRPLSNRLNV  103 (240)
T ss_dssp             CCCCCEEEEEEEETTCEEESSSSCSCCCHHHHHHHHHHHHCCSSSSCCCBTTBEEEEEEEHHHHHHSCGGGSSCTTSEEE
T ss_pred             CCCCeEEEEEEECCCCcEECCCCcCCCCHHHHHHHHHHHcCCcccccccccccCcEEEEehhHHhhhhhhccCCCCCeEE
Confidence            34999999999999999999999999999999999999998      467788899999999999998655799999999


Q ss_pred             EEcCCCCCcc-------------cCCCCeEEeCCHHHHHHHhcCCCCCCCCCcEEEEeCccccC
Q 029025          150 VLTHSGSFNI-------------ASLENVEICRSIHLALELLAEPPYCSSIEKVFVIGGGQILR  200 (200)
Q Consensus       150 VlSrt~~~~~-------------~~~~~v~V~~sl~eaI~~Lk~~~~~~~~kdI~ViGGa~IY~  200 (200)
                      ||||+.....             ...+++.+++|++++++.+++.+...++++|||+||++||+
T Consensus       104 VlSr~~~~~~~~~~~~~~~~~~~~~~~~v~v~~sl~eal~~l~~~~~~~~~~~I~VIGGa~IY~  167 (240)
T 3rg9_A          104 VLSRSATKEQLLAGIPDPIKRAEAANDVVAVNGGLEDALRMLVSKEHTSSIETVFCIGGGTIYK  167 (240)
T ss_dssp             EECSSCCHHHHHTTCSSHHHHHHHGGGEEEESSCHHHHHHHTTSHHHHHHEEEEEECCCHHHHH
T ss_pred             EEccCcccccccccccccccccccCCCCEEEECCHHHHHHHHhccccccCCCeEEEECCHHHHH
Confidence            9999875420             00346899999999999998741001157999999999984
>3nzb_X Dihydrofolate reductase; pneumocystius carinii DHFR inhibitor complexes, oxidoreducta oxidoreductase-oxidoreductase inhibitor complex; HET: D2N NAP; 1.45A {Pneumocystis carinii} SCOP: c.71.1.1 PDB: 1daj_A* 1cd2_A* 1e26_A* 1klk_A* 1ly3_A* 1ly4_A* 1s3y_A* 2cd2_A* 2fzh_A* 1dyr_A* 3cd2_A* 3nz6_X* 3nz9_X* 3nza_X* 2fzi_A* 3nzc_X* 3td8_A* 4cd2_A* 1vj3_A* Back     alignment and structure
>3ix9_A Dihydrofolate reductase; central beta sheet surrounded by 4 alpha helices, oxidoreductase; HET: NDP MTX; 1.95A {Streptococcus pneumoniae} Back     alignment and structure
>3ia4_A Dihydrofolate reductase; NADPH, methotrexate, oxidoreductase; HET: NDP MTX; 1.70A {Moritella profunda} SCOP: c.71.1.0 PDB: 3ia5_A 2zza_A* Back     alignment and structure
>3tq8_A Dihydrofolate reductase; oxidoreductase-oxidoreductase inhib complex; HET: NDP TOP; 1.90A {Coxiella burnetii} SCOP: c.71.1.0 PDB: 3tq9_A* 3tqa_A* 3tqb_A* Back     alignment and structure
>3s9u_A Dihydrofolate reductase; oxidoreductase; HET: NAP 5DR; 1.90A {Bacillus anthracis} PDB: 3sa1_A* 3sa2_A* 3sai_A* 3e0b_A* 3jvx_A* 3jwm_A* 3jwk_A* 3jw5_A* 3jwf_A* 3jwc_A* 3jw3_A* 3dat_A* 2qk8_A* 3fl8_A* 3fl9_A* 2kgk_A* Back     alignment and structure
>1kmv_A DHFR, dihydrofolate reductase; oxidoreductase, antiparasitic drugs, lipophilic antifolates; HET: LII NDP; 1.05A {Homo sapiens} SCOP: c.71.1.1 PDB: 1dhf_A* 1hfr_A* 1drf_A* 1kms_A* 1ohj_A* 1ohk_A* 1pd8_A* 1pd9_A* 1pdb_A 1s3u_A* 1s3v_A* 1s3w_A* 1u72_A* 1yho_A* 2c2s_A* 2c2t_A* 2dhf_A* 3ghw_A* 3ntz_A* 3nu0_A* ... Back     alignment and structure
>3dau_A Dihydrofolate reductase; oxidoreductase, pseudo-rossmann fold, adenine nucleotide BIN domain, antibiotic resistance, methotrexate resistance; HET: MTX NAP; 1.50A {Escherichia coli} SCOP: c.71.1.1 PDB: 1ddr_A* 1dds_A* 3k74_A 1ra9_A* 1dre_A* 1drh_A* 1dyi_A* 1dyh_A* 1jol_A* 1jom_A* 1ra1_A* 1dyj_A* 1ra3_A* 1ra8_A* 1ra2_A* 1rb2_A* 1rb3_A* 1rc4_A* 1rd7_A* 1re7_A* ... Back     alignment and structure
>3dfr_A Dihydrofolate reductase; oxido-reductase; HET: NDP MTX; 1.70A {Lactobacillus casei} SCOP: c.71.1.1 PDB: 1ao8_A* 1bzf_A* 1dis_A* 1diu_A* 1lud_A* 2hm9_A* 2hqp_A* 2l28_A 2lf1_A* Back     alignment and structure
>3irm_A Bifunctional dihydrofolate reductase-thymidylate; DHFR-TS antifolate complex, methyltransfe multifunctional enzyme, NADP; HET: 1CY; 2.10A {Trypanosoma cruzi} PDB: 3inv_A* 3irn_A* 3iro_A* 2h2q_A* 3cl9_A* 3clb_A* 3hbb_A* 3kjs_A* Back     alignment and structure
>1vdr_A DHFR, dihydrofolate reductase; oxidoreductase, halophilic enzyme; 2.55A {Haloferax volcanii} SCOP: c.71.1.1 PDB: 2ith_A 2jyb_A Back     alignment and structure
>2w3w_A Dihydrofolate reductase; nonclassical antifolates, one-carbon metabolism, lipophilic antifolates, NADP, oxidoreductase; HET: VG9 NDP; 1.60A {Mycobacterium avium} PDB: 2w3v_A* Back     alignment and structure
>1zdr_A Dihydrofolate reductase; DHFR, NADP, oxidoreductase; 2.00A {Geobacillus stearothermophilus} Back     alignment and structure
>3nrr_A Dihydrofolate reductase-thymidylate synthase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, niaid, DHFR; HET: NAP D16 UMP; 1.80A {Babesia bovis} PDB: 3kjr_A* 3i3r_A* 3k2h_A* Back     alignment and structure
>2w9h_A DHFR, dihydrofolate reductase; oxidoreductase, one-carbon metabolism; HET: TOP; 1.48A {Staphylococcus aureus} PDB: 2w9g_A* 3sqy_X* 3srq_X* 3srr_X* 3srs_X* 3sru_X* 3srw_X* 3frd_X* 3fre_X* 3frf_X* 3fyv_X* 3fyw_X* 3sr5_X* 3frb_X* 3fra_X* 3fy8_X* 3fy9_X* 3fq0_A* 3f0b_X* 3f0s_X* ... Back     alignment and structure
>3cse_A Dihydrofolate reductase; protein-ligand complex, oxidoreductase; HET: NAP N22; 1.60A {Candida glabrata} PDB: 3eej_A* 3eek_A* 3eel_A* 3eem_A* 3qlx_A* 3qly_A* 3qlz_A* Back     alignment and structure
>1df7_A DHFR, dihydrofolate reductase; structure-based inhibitor design, folateanalogs, rossmann fold; HET: NDP MTX; 1.70A {Mycobacterium tuberculosis} SCOP: c.71.1.1 PDB: 1dg5_A* 1dg7_A* 1dg8_A* 2cig_A* Back     alignment and structure
>1aoe_A DHFR, dihydrofolate reductase; oxidoreductase, antifungal target; HET: NDP GW3; 1.60A {Candida albicans} SCOP: c.71.1.1 PDB: 1ai9_A* 1ia1_A* 1ia2_A* 1ia3_A* 1ia4_A* 1m78_A* 1m79_A* 1m7a_A* 3qlr_A* 3qls_A* 3qlw_A* Back     alignment and structure
>3hj3_A Chain A, crystal structure of DHFR; TS, enzyme, crossover, non-active site, oxidoreductase; HET: UMP CB3 MTX NDP; 2.70A {Cryptosporidium hominis} PDB: 1qzf_A* 1sej_A* 3dl5_A* 3dl6_A* 2oip_A* Back     alignment and structure
>2bl9_A Dihydrofolate reductase-thymidylate synthase; plamodium vivax, pyrimethamine, malaria, drug resistance, oxidoreductase; HET: NDP CP6; 1.9A {Plasmodium vivax} PDB: 2blb_A* 2blc_A* 2bla_A* Back     alignment and structure
>1j3k_A Bifunctional dihydrofolate reductase-thymidylate synthase; oxidoreductase, transferase; HET: WRA NDP UMP; 2.10A {Plasmodium falciparum} SCOP: c.71.1.1 PDB: 3dg8_A* 1j3j_A* 1j3i_A* 3dga_A* Back     alignment and structure
>3qg2_A Bifunctional dihydrofolate reductase-thymidylate; pyrimethamine, antifolate resistance, oxidoreductase, transferase; HET: CP6 NDP UMP; 2.30A {Plasmodium falciparum} PDB: 3jsu_A* 4dp3_A* 4dph_A* 3qgt_A* 3um8_A* 4dpd_A* 3um5_A* 3um6_A* Back     alignment and structure
>1juv_A DHFR, dihydrofolate reductase; complexed with NADPH, oxidoreductase; HET: NDP; 1.70A {Enterobacteria phage T4} SCOP: c.71.1.1 Back     alignment and structure
>3jtw_A Dihydrofolate reductase; YP_805003.1, structural GE joint center for structural genomics, JCSG, protein structu initiative; 1.90A {Pediococcus pentosaceus atcc 25745} Back     alignment and structure
>1cz3_A Dihydrofolate reductase; dimer, hyperthermophIle, oxidoreductase; 2.10A {Thermotoga maritima} SCOP: c.71.1.1 PDB: 1d1g_A* Back     alignment and structure
>3ky8_A Putative riboflavin biosynthesis protein; structural genomic center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE UNL; 2.12A {Shewanella loihica} Back     alignment and structure
>2xw7_A Dihydrofolate reductase; oxidoreductase, NADPH; HET: PG4 NDP; 2.00A {Mycobacterium smegmatis} Back     alignment and structure
>2gd9_A Hypothetical protein YYAP; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, oxidoreductase; 2.30A {Bacillus subtilis} Back     alignment and structure
>3kgy_A Bifunctional deaminase-reductase domain protein; putative dihydrofolate reductase, structural genomics; HET: MSE NDP; 1.50A {Chloroflexus aurantiacus j-10-fl} Back     alignment and structure
>2b3z_A Riboflavin biosynthesis protein RIBD; alpha/beta/alpha, deaminase domain and reductase domain, hydrolase, oxidoreductase; 2.41A {Bacillus subtilis} SCOP: c.71.1.2 c.97.1.2 PDB: 2d5n_A* 3ex8_A* Back     alignment and structure
>2azn_A HTP reductase, putative 5-amino-6-(5-phosphoribosylamino)uracil; oxidoreductase; HET: MA5 NAP EPE; 2.70A {Methanocaldococcus jannaschii} SCOP: c.71.1.2 Back     alignment and structure
>2hxv_A Diaminohydroxyphosphoribosylaminopyrimidine deami amino-6-(5-phosphoribosylamino)uracil...; oxidoreductase, structural genomics; HET: NDP; 1.80A {Thermotoga maritima} SCOP: c.71.1.2 c.97.1.2 Back     alignment and structure
>2g6v_A Riboflavin biosynthesis protein RIBD; RIBD APO structure, structural genomics, structural proteomi europe, spine, hydrolase, oxidoreductase; 2.60A {Escherichia coli} PDB: 2obc_A* 2o7p_A* Back     alignment and structure
>2p4g_A Hypothetical protein; pyrimidine reductase-like protein, structural genomics, JOIN for structural genomics, JCSG; 2.30A {Corynebacterium diphtheriae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 200
d2fzia1206 c.71.1.1 (A:1-206) Dihydrofolate reductases, eukar 2e-32
d1kmva_186 c.71.1.1 (A:) Dihydrofolate reductases, eukaryotic 1e-31
d1aoea_192 c.71.1.1 (A:) Dihydrofolate reductases, eukaryotic 9e-31
d1seja1178 c.71.1.1 (A:3-180) Bifunctional enzyme dihydrofola 9e-31
d1juva_193 c.71.1.1 (A:) Dihydrofolate reductase, prokaryotic 3e-30
d1df7a_159 c.71.1.1 (A:) Dihydrofolate reductase, prokaryotic 4e-24
d1j3ka_231 c.71.1.1 (A:) Bifunctional enzyme dihydrofolate re 2e-22
d1ra9a_159 c.71.1.1 (A:) Dihydrofolate reductase, prokaryotic 3e-22
d1vdra_157 c.71.1.1 (A:) Dihydrofolate reductase, prokaryotic 4e-21
d3dfra_162 c.71.1.1 (A:) Dihydrofolate reductase, prokaryotic 3e-20
d1d1ga_164 c.71.1.1 (A:) Dihydrofolate reductase, prokaryotic 8e-13
>d2fzia1 c.71.1.1 (A:1-206) Dihydrofolate reductases, eukaryotic type {Fungus (Pneumocystis carinii) [TaxId: 4754]} Length = 206 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Dihydrofolate reductase-like
superfamily: Dihydrofolate reductase-like
family: Dihydrofolate reductases
domain: Dihydrofolate reductases, eukaryotic type
species: Fungus (Pneumocystis carinii) [TaxId: 4754]

 Score =  113 bits (284), Expect = 2e-32
 Identities = 43/130 (33%), Positives = 68/130 (52%), Gaps = 4/130 (3%)

Query: 75  LRARRPYQVVVAATHDMGIGKDGKLPWNLPSDLKFFKQLTM---STSDPGKRNAVVMGRK 131
           +  ++   ++VA T   GIG+   LPW L  ++ +FK++T    +       N V+MGRK
Sbjct: 1   MNQQKSLTLIVALTTSYGIGRSNSLPWKLKKEISYFKRVTSFVPTFDSFESMNVVLMGRK 60

Query: 132 TWESISPLYRPLPGRLNVVLTHSGSFNIASLENVEICRSIHL-ALELLAEPPYCSSIEKV 190
           TWESI   +RPL GR+NVV+T + S ++ +  +        L  L           I ++
Sbjct: 61  TWESIPLQFRPLKGRINVVITRNESLDLGNGIHSAKSLDHALELLYRTYGSESSVQINRI 120

Query: 191 FVIGGGQILR 200
           FVIGG Q+ +
Sbjct: 121 FVIGGAQLYK 130
>d1kmva_ c.71.1.1 (A:) Dihydrofolate reductases, eukaryotic type {Human (Homo sapiens) [TaxId: 9606]} Length = 186 Back     information, alignment and structure
>d1aoea_ c.71.1.1 (A:) Dihydrofolate reductases, eukaryotic type {Yeast (Candida albicans) [TaxId: 5476]} Length = 192 Back     information, alignment and structure
>d1seja1 c.71.1.1 (A:3-180) Bifunctional enzyme dihydrofolate reductase-thymidylate synthase, DFR domain {Cryptosporidium hominis [TaxId: 237895]} Length = 178 Back     information, alignment and structure
>d1juva_ c.71.1.1 (A:) Dihydrofolate reductase, prokaryotic type {Bacteriophage T4 [TaxId: 10665]} Length = 193 Back     information, alignment and structure
>d1df7a_ c.71.1.1 (A:) Dihydrofolate reductase, prokaryotic type {Mycobacterium tuberculosis [TaxId: 1773]} Length = 159 Back     information, alignment and structure
>d1j3ka_ c.71.1.1 (A:) Bifunctional enzyme dihydrofolate reductase-thymidylate synthase, DFR domain {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 231 Back     information, alignment and structure
>d1ra9a_ c.71.1.1 (A:) Dihydrofolate reductase, prokaryotic type {Escherichia coli [TaxId: 562]} Length = 159 Back     information, alignment and structure
>d1vdra_ c.71.1.1 (A:) Dihydrofolate reductase, prokaryotic type {Haloferax volcanii [TaxId: 2246]} Length = 157 Back     information, alignment and structure
>d3dfra_ c.71.1.1 (A:) Dihydrofolate reductase, prokaryotic type {Lactobacillus casei [TaxId: 1582]} Length = 162 Back     information, alignment and structure
>d1d1ga_ c.71.1.1 (A:) Dihydrofolate reductase, prokaryotic type {Thermotoga maritima [TaxId: 2336]} Length = 164 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query200
d1kmva_186 Dihydrofolate reductases, eukaryotic type {Human ( 99.97
d2fzia1206 Dihydrofolate reductases, eukaryotic type {Fungus 99.97
d1seja1178 Bifunctional enzyme dihydrofolate reductase-thymid 99.97
d1aoea_192 Dihydrofolate reductases, eukaryotic type {Yeast ( 99.97
d3dfra_162 Dihydrofolate reductase, prokaryotic type {Lactoba 99.97
d1vdra_157 Dihydrofolate reductase, prokaryotic type {Halofer 99.96
d1df7a_159 Dihydrofolate reductase, prokaryotic type {Mycobac 99.96
d1ra9a_159 Dihydrofolate reductase, prokaryotic type {Escheri 99.95
d1juva_193 Dihydrofolate reductase, prokaryotic type {Bacteri 99.94
d1j3ka_231 Bifunctional enzyme dihydrofolate reductase-thymid 99.94
d1d1ga_164 Dihydrofolate reductase, prokaryotic type {Thermot 99.93
d2hxva1198 Riboflavin biosynthesis protein RibD {Thermotoga m 98.68
d2azna1219 HTP reductase {Methanococcus jannaschii [TaxId: 21 98.38
d2b3za1214 Riboflavin biosynthesis protein RibD {Bacillus sub 97.63
>d1kmva_ c.71.1.1 (A:) Dihydrofolate reductases, eukaryotic type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Dihydrofolate reductase-like
superfamily: Dihydrofolate reductase-like
family: Dihydrofolate reductases
domain: Dihydrofolate reductases, eukaryotic type
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.97  E-value=6e-32  Score=221.44  Aligned_cols=121  Identities=36%  Similarity=0.684  Sum_probs=106.1

Q ss_pred             CccEEEEEEEeCCCeeecCCCCCC-cChhhHHHHHHHhhCCCCCCCccEEEEchhhhhhhcCCCCCCCCCeEEEEcCCCC
Q 029025           78 RRPYQVVVAATHDMGIGKDGKLPW-NLPSDLKFFKQLTMSTSDPGKRNAVVMGRKTWESISPLYRPLPGRLNVVLTHSGS  156 (200)
Q Consensus        78 mrkI~livAvSlDG~IG~~G~LpW-~l~eD~~fF~~~T~~~~~p~k~daVIMGRkTyEsi~~~~~pl~~r~~IVlSrt~~  156 (200)
                      |-.+++|+|++.||+||++|+||| ++|+|++||+++|++..++++.++|||||||||++|....|||+|.+||+||+..
T Consensus         1 ~~~~~~IvA~~~n~~IG~~g~LPW~~~~~D~~~Fk~~T~~~~~~~~~~~vIMGrkT~eSlp~~~~pLp~R~niVlSr~~~   80 (186)
T d1kmva_           1 VGSLNCIVAVSQNMGIGKNGDLPWPPLRNEFRYFQRMTTTSSVEGKQNLVIMGKKTWFSIPEKNRPLKGRINLVLSRELK   80 (186)
T ss_dssp             CCCEEEEEEECTTCEEEBTTBCSSCCCHHHHHHHHHHHHCCSSTTCEEEEEEEHHHHHHSCGGGCSCTTSEEEEECSSCS
T ss_pred             CCcEEEEEEECCCCcccCCCcCCCCCCHHHHHHHHHHhCCCCCCCCceEEEEeecccccccccCcccCCceEEEEecccc
Confidence            346899999999999999999999 8999999999999988888889999999999999987668999999999999976


Q ss_pred             CcccCCCCeEEeCCHHHHHHHhcCCCCCCCCCcEEEEeCccccC
Q 029025          157 FNIASLENVEICRSIHLALELLAEPPYCSSIEKVFVIGGGQILR  200 (200)
Q Consensus       157 ~~~~~~~~v~V~~sl~eaI~~Lk~~~~~~~~kdI~ViGGa~IY~  200 (200)
                      ...  .+++.+..+++++++.+++.+.....++|||+||++||+
T Consensus        81 ~~~--~~~~~~~~s~~~~~~~~~~~~~~~~~~~i~IiGG~~iY~  122 (186)
T d1kmva_          81 EPP--QGAHFLSRSLDDALKLTEQPELANKVDMVWIVGGSSVYK  122 (186)
T ss_dssp             SCC--TTCSEEESSHHHHHHHHTSTTTTTTEEEEEECCCHHHHH
T ss_pred             ccc--ccceeeccCHHHHHHHhhhHhhccCCCeEEEEccHHHHH
Confidence            542  345688899999999998764444567899999999984
>d2fzia1 c.71.1.1 (A:1-206) Dihydrofolate reductases, eukaryotic type {Fungus (Pneumocystis carinii) [TaxId: 4754]} Back     information, alignment and structure
>d1seja1 c.71.1.1 (A:3-180) Bifunctional enzyme dihydrofolate reductase-thymidylate synthase, DFR domain {Cryptosporidium hominis [TaxId: 237895]} Back     information, alignment and structure
>d1aoea_ c.71.1.1 (A:) Dihydrofolate reductases, eukaryotic type {Yeast (Candida albicans) [TaxId: 5476]} Back     information, alignment and structure
>d3dfra_ c.71.1.1 (A:) Dihydrofolate reductase, prokaryotic type {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1vdra_ c.71.1.1 (A:) Dihydrofolate reductase, prokaryotic type {Haloferax volcanii [TaxId: 2246]} Back     information, alignment and structure
>d1df7a_ c.71.1.1 (A:) Dihydrofolate reductase, prokaryotic type {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ra9a_ c.71.1.1 (A:) Dihydrofolate reductase, prokaryotic type {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1juva_ c.71.1.1 (A:) Dihydrofolate reductase, prokaryotic type {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1j3ka_ c.71.1.1 (A:) Bifunctional enzyme dihydrofolate reductase-thymidylate synthase, DFR domain {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1d1ga_ c.71.1.1 (A:) Dihydrofolate reductase, prokaryotic type {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2hxva1 c.71.1.2 (A:148-345) Riboflavin biosynthesis protein RibD {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2azna1 c.71.1.2 (A:6-224) HTP reductase {Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2b3za1 c.71.1.2 (A:146-359) Riboflavin biosynthesis protein RibD {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure