Citrus Sinensis ID: 029075

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------20
MGVDYYKILGVDRNAKDDDLKKAYRKLAMKWHPDKNPNNKKDAETKFKQISEAYEVLSDPQKRAVYDQYGEEGLKGQMPPPDAGGPGGASFFSTGEGPTSFRFNPRSADDIFAEFFGFSHPFGGMGGGGGGMRGSRFAGGLFGDDMFGPFGEGGGGSMGGGGARKAPPIENKLPCSLEDLYKGTTKKMKISREIADISG
cccccHHHHcccccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHccccccccccccccccccccccccccccccccccccccHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEcccHHHHHccccEEEEEEEEEccccc
ccccHHHHccccccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHcHcccccccccccccccccccccccccccccEEEccccHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccHccccccHHHHHcccccEEEEEEEcccccc
mgvdyykilgvdrnakddDLKKAYRKLAMKwhpdknpnnkkdAETKFKQISEAYEvlsdpqkravydqygeeglkgqmpppdaggpggasffstgegptsfrfnprsaddifaeffgfshpfggmggggggmrgsrfagglfgddmfgpfgeggggsmggggarkappienklpcsledlyKGTTKKMKISREIADISG
mgvdyykilgvdrnakdddLKKAYRKLAmkwhpdknpnnkkdAETKFKQISEAyevlsdpqkrAVYDQYGEEGLKGQMPPPDAGGPGGASFFSTGEGPTSFRFNPRSADDIFAEFFGFSHPFGGMGGGGGGMRGSRFAGGLFGDDMFGPFGEGGGGSMGGGGARKAPPIENKLPCSLEdlykgttkkmkisreiadisg
MGVDYYKILGVDRNAKDDDLKKAYRKLAMKWHPDKNPNNKKDAETKFKQISEAYEVLSDPQKRAVYDQYGEEGLKGQMpppdaggpggaSFFSTGEGPTSFRFNPRSADDIFAEffgfshpfggmggggggmrgsrfaggLFgddmfgpfgeggggsmggggARKAPPIENKLPCSLEDLYKGTTKKMKISREIADISG
***DYYKILGVDR***********************************************************************************************DDIFAEFFGFS********************************************************************************
MGVDYYKILGVDRNAKDDDLKKAYRKLAMKWHPDKNPNN**DAETKFKQISEAYEVLSDPQKRAVYDQYGEE************************GPTSFRFNPRSADDIFAEFFGFSHPF*************************************************KLPCSLEDLYKGTTKKMKISREIADI**
MGVDYYKILGVDRNAKDDDLKKAYRKLAMKWHPDKNPNNKKDAETKFKQISEAYEVLSDPQKRAVYDQYGEEGLKGQMPPPDAGGPGGASFFSTGEGPTSFRFNPRSADDIFAEFFGFSHPFGGMGGGGGGMRGSRFAGGLFGDDMFGPFGEGGGGSMGGGGARKAPPIENKLPCSLEDLYKGTTKKMKISREIADISG
*GVDYYKILGVDRNAKDDDLKKAYRKLAMKWHPDKNPNNKKDAETKFKQISEAYEVLSDPQKRAVYDQYGEEGLKGQMP******PGGASFFSTGEGPTSFRFNPRSADDIFAEFFGFSHPFGGMGGGGGGMRGSRFAGGLFGDDMF*******************PPIENKLPCSLEDLYKGTTKKMKISREIA****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGVDYYKILGVDRNAKDDDLKKAYRKLAMKWHPDKNPNNKKDAETKFKQISEAYEVLSDPQKRAVYDQYGEEGLKGQMPPPDAGGPGGASFFSTGEGPTSFRFNPRSADDIFAEFFGFSHPFGGMGGGGGGMRGSRFAGGLFGDDMFGPFGEGGGGSMGGGGARKAPPIENKLPCSLEDLYKGTTKKMKISREIADISG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query199 2.2.26 [Sep-21-2011]
Q24133 334 DnaJ protein homolog 1 OS no no 0.859 0.511 0.477 5e-32
Q5FWN8250 DnaJ homolog subfamily B N/A no 0.547 0.436 0.558 2e-31
Q9D832 337 DnaJ homolog subfamily B yes no 0.874 0.516 0.453 3e-31
Q2KIT4 337 DnaJ homolog subfamily B yes no 0.864 0.510 0.434 8e-31
Q9UDY4 337 DnaJ homolog subfamily B yes no 0.874 0.516 0.443 2e-30
Q5R8J8 337 DnaJ homolog subfamily B yes no 0.874 0.516 0.443 2e-30
Q5XGU5245 DnaJ homolog subfamily B N/A no 0.703 0.571 0.484 5e-30
Q3MI00 340 DnaJ homolog subfamily B no no 0.879 0.514 0.435 7e-30
O89114 348 DnaJ homolog subfamily B no no 0.889 0.508 0.426 9e-30
O75953 348 DnaJ homolog subfamily B no no 0.889 0.508 0.421 2e-29
>sp|Q24133|DNAJ1_DROME DnaJ protein homolog 1 OS=Drosophila melanogaster GN=DnaJ-1 PE=1 SV=3 Back     alignment and function desciption
 Score =  137 bits (344), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 97/203 (47%), Positives = 124/203 (61%), Gaps = 32/203 (15%)

Query: 1   MGVDYYKILGVDRNAKDDDLKKAYRKLAMKWHPDKNPNNKKDAETKFKQISEAYEVLSDP 60
           MG D+YKILG++R A DD++KKAYRKLA+K+HPDKN + +  AE +FK+I+EAYEVLSD 
Sbjct: 1   MGKDFYKILGLERKASDDEIKKAYRKLALKYHPDKNKSPQ--AEERFKEIAEAYEVLSDK 58

Query: 61  QKRAVYDQYGEEGLKGQMPPPDAGGPGGASFFSTGEGPTSFRFNPRSADDIFAEFFGFSH 120
           +KR ++D YGE+GLKG  P PD GG  GA  +        F  +PR+    FA+FFG S 
Sbjct: 59  KKRDIFDNYGEDGLKGGQPGPDGGGQPGAYTY-------QFHGDPRAT---FAQFFGSSD 108

Query: 121 PFGGMGGGGGGMRGSRFAGG-------LF----GDDMFGPFGEGGGGSMGGGGARKAPPI 169
           PFG    GG  M    F+GG       +F    GDDMF                ++ PPI
Sbjct: 109 PFGAFFTGGDNM----FSGGQGGNTNEIFWNIGGDDMF-----AFNAQAPSRKRQQDPPI 159

Query: 170 ENKLPCSLEDLYKGTTKKMKISR 192
           E+ L  SLE++ KG  KKMKISR
Sbjct: 160 EHDLFVSLEEVDKGCIKKMKISR 182

Drosophila melanogaster (taxid: 7227)
>sp|Q5FWN8|DNJ6A_XENLA DnaJ homolog subfamily B member 6-A OS=Xenopus laevis GN=dnajb6-a PE=2 SV=1 Back     alignment and function description
>sp|Q9D832|DNJB4_MOUSE DnaJ homolog subfamily B member 4 OS=Mus musculus GN=Dnajb4 PE=2 SV=1 Back     alignment and function description
>sp|Q2KIT4|DNJB4_BOVIN DnaJ homolog subfamily B member 4 OS=Bos taurus GN=DNAJB4 PE=2 SV=1 Back     alignment and function description
>sp|Q9UDY4|DNJB4_HUMAN DnaJ homolog subfamily B member 4 OS=Homo sapiens GN=DNAJB4 PE=1 SV=1 Back     alignment and function description
>sp|Q5R8J8|DNJB4_PONAB DnaJ homolog subfamily B member 4 OS=Pongo abelii GN=DNAJB4 PE=2 SV=1 Back     alignment and function description
>sp|Q5XGU5|DNJ6B_XENLA DnaJ homolog subfamily B member 6-B OS=Xenopus laevis GN=dnajb6-b PE=2 SV=1 Back     alignment and function description
>sp|Q3MI00|DNJB1_BOVIN DnaJ homolog subfamily B member 1 OS=Bos taurus GN=DNAJB1 PE=2 SV=3 Back     alignment and function description
>sp|O89114|DNJB5_MOUSE DnaJ homolog subfamily B member 5 OS=Mus musculus GN=Dnajb5 PE=2 SV=1 Back     alignment and function description
>sp|O75953|DNJB5_HUMAN DnaJ homolog subfamily B member 5 OS=Homo sapiens GN=DNAJB5 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query199
449453551 339 PREDICTED: dnaJ homolog subfamily B memb 0.969 0.569 0.76 8e-85
356517478 352 PREDICTED: dnaJ homolog subfamily B memb 1.0 0.565 0.800 1e-82
359806164 349 uncharacterized protein LOC100778672 [Gl 1.0 0.570 0.803 1e-82
357474457 347 Chaperone protein dnaJ [Medicago truncat 1.0 0.573 0.78 4e-82
388507166 347 unknown [Medicago truncatula] 1.0 0.573 0.78 5e-82
359483831 342 PREDICTED: dnaJ homolog subfamily B memb 0.984 0.573 0.795 1e-80
297836810 339 DNAJ heat shock family protein [Arabidop 0.964 0.566 0.806 3e-79
359483833 350 PREDICTED: dnaJ homolog subfamily B memb 0.984 0.56 0.764 2e-78
15225377 337 DNAJ heat shock protein-like protein [Ar 0.954 0.563 0.792 1e-77
449441664 342 PREDICTED: dnaJ homolog subfamily B memb 0.974 0.567 0.738 9e-76
>gi|449453551|ref|XP_004144520.1| PREDICTED: dnaJ homolog subfamily B member 13-like [Cucumis sativus] gi|449529892|ref|XP_004171932.1| PREDICTED: dnaJ homolog subfamily B member 13-like [Cucumis sativus] Back     alignment and taxonomy information
 Score =  318 bits (815), Expect = 8e-85,   Method: Compositional matrix adjust.
 Identities = 152/200 (76%), Positives = 173/200 (86%), Gaps = 7/200 (3%)

Query: 1   MGVDYYKILGVDRNAKDDDLKKAYRKLAMKWHPDKNPNNKKDAETKFKQISEAYEVLSDP 60
           MG+DYYK+L VDRNAKDDDLKKAYRKLAMKWHPDKNPNNKK+AE KFKQISEAYEVLSDP
Sbjct: 1   MGIDYYKVLQVDRNAKDDDLKKAYRKLAMKWHPDKNPNNKKEAEAKFKQISEAYEVLSDP 60

Query: 61  QKRAVYDQYGEEGLKGQMPPPDAGGP-GGASFFSTGEGPTSFRFNPRSADDIFAEFFGFS 119
           QK+ +YDQYGEEGLKGQ+PPPD GGP GGASFFSTG+  ++FRFNPR+A+DI+AEFFG S
Sbjct: 61  QKKEIYDQYGEEGLKGQVPPPDTGGPAGGASFFSTGDRSSTFRFNPRNAEDIYAEFFGSS 120

Query: 120 HPFGGMGGGGGGMRGSRFAGGLFGDDMFGPFGEGGGGSMGGGGARKAPPIENKLPCSLED 179
           +PFGGMGG      G RF+  +FGDD+F  F E GGGSM    +RKA PIEN+LPCSLED
Sbjct: 121 NPFGGMGG------GPRFSSSIFGDDIFTSFRESGGGSMNQASSRKAAPIENRLPCSLED 174

Query: 180 LYKGTTKKMKISREIADISG 199
           LYKGTTKKMKISRE++D +G
Sbjct: 175 LYKGTTKKMKISREVSDTTG 194

Source: Cucumis sativus

Species: Cucumis sativus

Genus: Cucumis

Family: Cucurbitaceae

Order: Cucurbitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|356517478|ref|XP_003527414.1| PREDICTED: dnaJ homolog subfamily B member 13-like isoform 1 [Glycine max] Back     alignment and taxonomy information
>gi|359806164|ref|NP_001241198.1| uncharacterized protein LOC100778672 [Glycine max] gi|255635480|gb|ACU18092.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|357474457|ref|XP_003607513.1| Chaperone protein dnaJ [Medicago truncatula] gi|217071884|gb|ACJ84302.1| unknown [Medicago truncatula] gi|355508568|gb|AES89710.1| Chaperone protein dnaJ [Medicago truncatula] Back     alignment and taxonomy information
>gi|388507166|gb|AFK41649.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|359483831|ref|XP_003633023.1| PREDICTED: dnaJ homolog subfamily B member 13 isoform 2 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297836810|ref|XP_002886287.1| DNAJ heat shock family protein [Arabidopsis lyrata subsp. lyrata] gi|297332127|gb|EFH62546.1| DNAJ heat shock family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|359483833|ref|XP_002278979.2| PREDICTED: dnaJ homolog subfamily B member 13 isoform 1 [Vitis vinifera] Back     alignment and taxonomy information
>gi|15225377|ref|NP_179646.1| DNAJ heat shock protein-like protein [Arabidopsis thaliana] gi|4586038|gb|AAD25656.1| putative heat shock protein [Arabidopsis thaliana] gi|15982895|gb|AAL09794.1| At2g20560/T13C7.15 [Arabidopsis thaliana] gi|21554404|gb|AAM63509.1| putative heat shock protein [Arabidopsis thaliana] gi|22137258|gb|AAM91474.1| At2g20560/T13C7.15 [Arabidopsis thaliana] gi|330251934|gb|AEC07028.1| DNAJ heat shock protein-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|449441664|ref|XP_004138602.1| PREDICTED: dnaJ homolog subfamily B member 13-like [Cucumis sativus] gi|449490312|ref|XP_004158567.1| PREDICTED: dnaJ homolog subfamily B member 13-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query199
TAIR|locus:2121368 348 AT4G28480 [Arabidopsis thalian 0.567 0.324 0.798 7.8e-62
TAIR|locus:2054809 337 AT2G20560 [Arabidopsis thalian 0.557 0.329 0.789 7.8e-62
TAIR|locus:2097638 323 AT3G08910 [Arabidopsis thalian 0.537 0.331 0.754 3.3e-53
TAIR|locus:2179127 335 AT5G01390 [Arabidopsis thalian 0.547 0.325 0.675 4.7e-50
TAIR|locus:2012743 349 AT1G10350 [Arabidopsis thalian 0.572 0.326 0.605 5.3e-45
TAIR|locus:2179429 347 AT5G25530 [Arabidopsis thalian 0.517 0.296 0.622 3.7e-44
TAIR|locus:2097880 350 AT3G47940 [Arabidopsis thalian 0.572 0.325 0.558 3.6e-42
TAIR|locus:2825170 331 AT1G59725 [Arabidopsis thalian 0.567 0.341 0.565 1.1e-40
ZFIN|ZDB-GENE-040801-192 340 dnajb4 "DnaJ (Hsp40) homolog, 0.371 0.217 0.710 1e-32
UNIPROTKB|F1NKV0 342 DNAJB4 "Uncharacterized protei 0.371 0.216 0.684 4.3e-32
TAIR|locus:2121368 AT4G28480 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 478 (173.3 bits), Expect = 7.8e-62, Sum P(2) = 7.8e-62
 Identities = 91/114 (79%), Positives = 98/114 (85%)

Query:     1 MGVDYYKILGVDRNAKDDDLKKAYRKLAMKWHPDKNPNNKKDAETKFKQISEAYEVLSDP 60
             MGVDYYK+L VDR+A DDDLKKAYRKLAMKWHPDKNPNNKKDAE KFKQISEAY+VLSDP
Sbjct:     1 MGVDYYKVLQVDRSANDDDLKKAYRKLAMKWHPDKNPNNKKDAEAKFKQISEAYDVLSDP 60

Query:    61 QKRAVYDQYGEEGLKGQMXXXXXXXXXXXSFFSTGEGPTSFRFNPRSADDIFAE 114
             QKRAVYDQYGEEGLKG +           S+FSTG+G +SFRFNPRSADDIFAE
Sbjct:    61 QKRAVYDQYGEEGLKGNVPPPNAATSGA-SYFSTGDGSSSFRFNPRSADDIFAE 113
GO:0005737 "cytoplasm" evidence=ISM
GO:0006457 "protein folding" evidence=IEA;ISS
GO:0031072 "heat shock protein binding" evidence=IEA
GO:0051082 "unfolded protein binding" evidence=IEA
TAIR|locus:2054809 AT2G20560 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2097638 AT3G08910 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2179127 AT5G01390 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2012743 AT1G10350 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2179429 AT5G25530 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2097880 AT3G47940 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2825170 AT1G59725 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040801-192 dnajb4 "DnaJ (Hsp40) homolog, subfamily B, member 4" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1NKV0 DNAJB4 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00003050001
SubName- Full=Chromosome chr10 scaffold_138, whole genome shotgun sequence; (342 aa)
(Vitis vinifera)
Predicted Functional Partners:
GSVIVG00017724001
SubName- Full=Chromosome chr17 scaffold_16, whole genome shotgun sequence; (538 aa)
  •     0.476
GSVIVG00017185001
SubName- Full=Chromosome chr11 scaffold_14, whole genome shotgun sequence; (482 aa)
  •     0.472
GSVIVG00022013001
SubName- Full=Chromosome chr18 scaffold_24, whole genome shotgun sequence; (667 aa)
  •     0.471
GSVIVG00001482001
SubName- Full=Chromosome chr3 scaffold_117, whole genome shotgun sequence; (103 aa)
  •     0.471
GSVIVG00022731001
SubName- Full=Chromosome chr14 scaffold_27, whole genome shotgun sequence; (655 aa)
  •     0.467
GSVIVG00018481001
SubName- Full=Chromosome chr13 scaffold_17, whole genome shotgun sequence; (650 aa)
  •     0.467
GSVIVG00037232001
SubName- Full=Chromosome chr16 scaffold_86, whole genome shotgun sequence; (658 aa)
  •     0.466
GSVIVG00024357001
SubName- Full=Chromosome chr6 scaffold_3, whole genome shotgun sequence; (652 aa)
  •     0.465
GSVIVG00006687001
SubName- Full=Chromosome chr2 scaffold_176, whole genome shotgun sequence; (667 aa)
  •     0.465
GSVIVG00021301001
SubName- Full=Chromosome chr8 scaffold_23, whole genome shotgun sequence; (649 aa)
  •     0.464

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query199
COG0484 371 COG0484, DnaJ, DnaJ-class molecular chaperone with 1e-47
TIGR02349 354 TIGR02349, DnaJ_bact, chaperone protein DnaJ 2e-47
PRK10767 371 PRK10767, PRK10767, chaperone protein DnaJ; Provis 5e-47
PRK14290 365 PRK14290, PRK14290, chaperone protein DnaJ; Provis 9e-37
pfam0022663 pfam00226, DnaJ, DnaJ domain 2e-36
PRK14294 366 PRK14294, PRK14294, chaperone protein DnaJ; Provis 2e-36
PRK14281 397 PRK14281, PRK14281, chaperone protein DnaJ; Provis 2e-34
PRK14293 374 PRK14293, PRK14293, chaperone protein DnaJ; Provis 3e-34
PRK14282 369 PRK14282, PRK14282, chaperone protein DnaJ; Provis 3e-34
PRK14276 380 PRK14276, PRK14276, chaperone protein DnaJ; Provis 4e-34
PRK14284 391 PRK14284, PRK14284, chaperone protein DnaJ; Provis 6e-34
PRK14301 373 PRK14301, PRK14301, chaperone protein DnaJ; Provis 7e-34
PRK14291 382 PRK14291, PRK14291, chaperone protein DnaJ; Provis 9e-34
smart0027160 smart00271, DnaJ, DnaJ molecular chaperone homolog 2e-33
PRK14289 386 PRK14289, PRK14289, chaperone protein DnaJ; Provis 3e-32
PRK14277 386 PRK14277, PRK14277, chaperone protein DnaJ; Provis 4e-32
PRK14299 291 PRK14299, PRK14299, chaperone protein DnaJ; Provis 4e-30
PRK14278 378 PRK14278, PRK14278, chaperone protein DnaJ; Provis 4e-29
PRK14297 380 PRK14297, PRK14297, chaperone protein DnaJ; Provis 6e-29
cd0625755 cd06257, DnaJ, DnaJ domain or J-domain 8e-29
PRK14283 378 PRK14283, PRK14283, chaperone protein DnaJ; Provis 8e-29
PRK14298 377 PRK14298, PRK14298, chaperone protein DnaJ; Provis 2e-28
PRK14280 376 PRK14280, PRK14280, chaperone protein DnaJ; Provis 3e-28
PRK14292 371 PRK14292, PRK14292, chaperone protein DnaJ; Provis 5e-28
PTZ00037 421 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Prov 2e-27
PRK14279 392 PRK14279, PRK14279, chaperone protein DnaJ; Provis 2e-26
PRK14286 372 PRK14286, PRK14286, chaperone protein DnaJ; Provis 1e-25
TIGR03835 871 TIGR03835, termin_org_DnaJ, terminal organelle ass 1e-24
PRK14295 389 PRK14295, PRK14295, chaperone protein DnaJ; Provis 8e-24
PRK14285 365 PRK14285, PRK14285, chaperone protein DnaJ; Provis 4e-23
PRK14300 372 PRK14300, PRK14300, chaperone protein DnaJ; Provis 5e-22
COG2214237 COG2214, CbpA, DnaJ-class molecular chaperone [Pos 1e-21
PRK14287 371 PRK14287, PRK14287, chaperone protein DnaJ; Provis 7e-21
PRK10266 306 PRK10266, PRK10266, curved DNA-binding protein Cbp 2e-20
PRK14288 369 PRK14288, PRK14288, chaperone protein DnaJ; Provis 1e-19
PRK14296 372 PRK14296, PRK14296, chaperone protein DnaJ; Provis 4e-18
COG5407 610 COG5407, SEC63, Preprotein translocase subunit Sec 1e-15
PTZ00341 1136 PTZ00341, PTZ00341, Ring-infected erythrocyte surf 1e-12
COG5269 379 COG5269, ZUO1, Ribosome-associated chaperone zuoti 1e-08
PRK09430267 PRK09430, djlA, Dna-J like membrane chaperone prot 3e-07
COG1076174 COG1076, DjlA, DnaJ-domain-containing proteins 1 [ 3e-06
PRK01356166 PRK01356, hscB, co-chaperone HscB; Provisional 1e-05
TIGR00714155 TIGR00714, hscB, Fe-S protein assembly co-chaperon 2e-05
PRK03578176 PRK03578, hscB, co-chaperone HscB; Provisional 3e-04
PHA02624 647 PHA02624, PHA02624, large T antigen; Provisional 6e-04
PTZ00146 293 PTZ00146, PTZ00146, fibrillarin; Provisional 0.002
PRK00294173 PRK00294, hscB, co-chaperone HscB; Provisional 0.003
PHA03102153 PHA03102, PHA03102, Small T antigen; Reviewed 0.003
>gnl|CDD|223560 COG0484, DnaJ, DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
 Score =  159 bits (404), Expect = 1e-47
 Identities = 71/194 (36%), Positives = 97/194 (50%), Gaps = 52/194 (26%)

Query: 1   MGVDYYKILGVDRNAKDDDLKKAYRKLAMKWHPDKNPNNKKDAETKFKQISEAYEVLSDP 60
              DYY+ILGV ++A ++++KKAYRKLA K+HPD+NP + K+AE KFK+I+EAYEVLSDP
Sbjct: 2   AKRDYYEILGVSKDASEEEIKKAYRKLAKKYHPDRNPGD-KEAEEKFKEINEAYEVLSDP 60

Query: 61  QKRAVYDQYGEEGLKGQMPPPDAGGPGGASFFSTGEGPTSFRFNPRSADDIFAEFFGFSH 120
           +KRA YDQ+G  G K        GG GG  F   G              DIF +FF    
Sbjct: 61  EKRAAYDQFGHAGFKA-------GGFGGFGFGGFGGDF----------GDIFEDFF---- 99

Query: 121 PFGGMGGGGGGMRGSRFAGGLFGDDMFGPFGEGGGGSMGGGGARKAPPIENKLPCSLEDL 180
                 GGGGG R                              R+   +   L  +LE+ 
Sbjct: 100 ------GGGGGGRRRP------------------------NRPRRGADLRYNLEITLEEA 129

Query: 181 YKGTTKKMKISREI 194
             G  K+++++R +
Sbjct: 130 VFGVKKEIRVTRSV 143

Length = 371
>gnl|CDD|233829 TIGR02349, DnaJ_bact, chaperone protein DnaJ Back     alignment and domain information
>gnl|CDD|236757 PRK10767, PRK10767, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172778 PRK14290, PRK14290, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|215804 pfam00226, DnaJ, DnaJ domain Back     alignment and domain information
>gnl|CDD|237664 PRK14294, PRK14294, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237657 PRK14281, PRK14281, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237663 PRK14293, PRK14293, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184603 PRK14282, PRK14282, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237653 PRK14276, PRK14276, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237658 PRK14284, PRK14284, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237668 PRK14301, PRK14301, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237661 PRK14291, PRK14291, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|197617 smart00271, DnaJ, DnaJ molecular chaperone homology domain Back     alignment and domain information
>gnl|CDD|237660 PRK14289, PRK14289, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184599 PRK14277, PRK14277, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237667 PRK14299, PRK14299, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237654 PRK14278, PRK14278, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184611 PRK14297, PRK14297, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|99751 cd06257, DnaJ, DnaJ domain or J-domain Back     alignment and domain information
>gnl|CDD|184604 PRK14283, PRK14283, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184612 PRK14298, PRK14298, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237656 PRK14280, PRK14280, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237662 PRK14292, PRK14292, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|240236 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>gnl|CDD|237655 PRK14279, PRK14279, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172774 PRK14286, PRK14286, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|234368 TIGR03835, termin_org_DnaJ, terminal organelle assembly protein TopJ Back     alignment and domain information
>gnl|CDD|237665 PRK14295, PRK14295, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172773 PRK14285, PRK14285, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172788 PRK14300, PRK14300, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|225124 COG2214, CbpA, DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|237659 PRK14287, PRK14287, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|182347 PRK10266, PRK10266, curved DNA-binding protein CbpA; Provisional Back     alignment and domain information
>gnl|CDD|172776 PRK14288, PRK14288, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237666 PRK14296, PRK14296, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|227694 COG5407, SEC63, Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|173534 PTZ00341, PTZ00341, Ring-infected erythrocyte surface antigen; Provisional Back     alignment and domain information
>gnl|CDD|227594 COG5269, ZUO1, Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|236512 PRK09430, djlA, Dna-J like membrane chaperone protein; Provisional Back     alignment and domain information
>gnl|CDD|224002 COG1076, DjlA, DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|167217 PRK01356, hscB, co-chaperone HscB; Provisional Back     alignment and domain information
>gnl|CDD|211601 TIGR00714, hscB, Fe-S protein assembly co-chaperone HscB Back     alignment and domain information
>gnl|CDD|235133 PRK03578, hscB, co-chaperone HscB; Provisional Back     alignment and domain information
>gnl|CDD|222912 PHA02624, PHA02624, large T antigen; Provisional Back     alignment and domain information
>gnl|CDD|240291 PTZ00146, PTZ00146, fibrillarin; Provisional Back     alignment and domain information
>gnl|CDD|166894 PRK00294, hscB, co-chaperone HscB; Provisional Back     alignment and domain information
>gnl|CDD|222986 PHA03102, PHA03102, Small T antigen; Reviewed Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 199
COG0484 371 DnaJ DnaJ-class molecular chaperone with C-termina 100.0
PRK14288 369 chaperone protein DnaJ; Provisional 100.0
PRK14286 372 chaperone protein DnaJ; Provisional 100.0
PRK14296 372 chaperone protein DnaJ; Provisional 100.0
PRK14279 392 chaperone protein DnaJ; Provisional 100.0
KOG0712 337 consensus Molecular chaperone (DnaJ superfamily) [ 100.0
PRK14285 365 chaperone protein DnaJ; Provisional 100.0
PRK14277 386 chaperone protein DnaJ; Provisional 100.0
PRK14287 371 chaperone protein DnaJ; Provisional 100.0
PRK14276 380 chaperone protein DnaJ; Provisional 100.0
PRK14297 380 chaperone protein DnaJ; Provisional 100.0
PRK14291 382 chaperone protein DnaJ; Provisional 100.0
PRK14282 369 chaperone protein DnaJ; Provisional 99.98
PRK14281 397 chaperone protein DnaJ; Provisional 99.98
PRK14278 378 chaperone protein DnaJ; Provisional 99.98
PRK14280 376 chaperone protein DnaJ; Provisional 99.98
PRK14298 377 chaperone protein DnaJ; Provisional 99.98
PRK14295 389 chaperone protein DnaJ; Provisional 99.97
PRK14294 366 chaperone protein DnaJ; Provisional 99.97
PRK14301 373 chaperone protein DnaJ; Provisional 99.97
PTZ00037 421 DnaJ_C chaperone protein; Provisional 99.97
PRK14290 365 chaperone protein DnaJ; Provisional 99.97
PRK14284 391 chaperone protein DnaJ; Provisional 99.97
PRK10767 371 chaperone protein DnaJ; Provisional 99.97
PRK14299 291 chaperone protein DnaJ; Provisional 99.97
TIGR02349 354 DnaJ_bact chaperone protein DnaJ. This model repre 99.97
PRK14300 372 chaperone protein DnaJ; Provisional 99.97
PRK14283 378 chaperone protein DnaJ; Provisional 99.97
PRK14293 374 chaperone protein DnaJ; Provisional 99.97
PRK14292 371 chaperone protein DnaJ; Provisional 99.96
PRK14289 386 chaperone protein DnaJ; Provisional 99.96
KOG0713 336 consensus Molecular chaperone (DnaJ superfamily) [ 99.96
PRK10266 306 curved DNA-binding protein CbpA; Provisional 99.96
KOG0715 288 consensus Molecular chaperone (DnaJ superfamily) [ 99.89
KOG0716279 consensus Molecular chaperone (DnaJ superfamily) [ 99.85
KOG0714 306 consensus Molecular chaperone (DnaJ superfamily) [ 99.83
KOG0718 546 consensus Molecular chaperone (DnaJ superfamily) [ 99.83
KOG0717 508 consensus Molecular chaperone (DnaJ superfamily) [ 99.82
KOG0691296 consensus Molecular chaperone (DnaJ superfamily) [ 99.82
PF0022664 DnaJ: DnaJ domain; InterPro: IPR001623 The prokary 99.82
PTZ00341 1136 Ring-infected erythrocyte surface antigen; Provisi 99.79
KOG0719264 consensus Molecular chaperone (DnaJ superfamily) [ 99.77
smart0027160 DnaJ DnaJ molecular chaperone homology domain. 99.75
KOG0721230 consensus Molecular chaperone (DnaJ superfamily) [ 99.73
TIGR03835 871 termin_org_DnaJ terminal organelle assembly protei 99.73
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.72
COG2214237 CbpA DnaJ-class molecular chaperone [Posttranslati 99.72
cd0625755 DnaJ DnaJ domain or J-domain. DnaJ/Hsp40 (heat sho 99.72
PHA03102153 Small T antigen; Reviewed 99.72
PRK05014171 hscB co-chaperone HscB; Provisional 99.62
PRK01356166 hscB co-chaperone HscB; Provisional 99.59
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 99.56
PRK00294173 hscB co-chaperone HscB; Provisional 99.54
PRK03578176 hscB co-chaperone HscB; Provisional 99.54
KOG0722 329 consensus Molecular chaperone (DnaJ superfamily) [ 99.51
KOG0720490 consensus Molecular chaperone (DnaJ superfamily) [ 99.51
PTZ00100116 DnaJ chaperone protein; Provisional 99.43
PRK09430267 djlA Dna-J like membrane chaperone protein; Provis 99.42
COG5407 610 SEC63 Preprotein translocase subunit Sec63 [Intrac 99.39
PHA02624 647 large T antigen; Provisional 99.34
KOG1150250 consensus Predicted molecular chaperone (DnaJ supe 99.27
PRK01773173 hscB co-chaperone HscB; Provisional 99.27
TIGR00714157 hscB Fe-S protein assembly co-chaperone HscB. This 99.12
COG5269 379 ZUO1 Ribosome-associated chaperone zuotin [Transla 98.97
KOG1789 2235 consensus Endocytosis protein RME-8, contains DnaJ 98.52
KOG0568342 consensus Molecular chaperone (DnaJ superfamily) [ 98.36
KOG0723112 consensus Molecular chaperone (DnaJ superfamily) [ 98.26
KOG3192168 consensus Mitochondrial J-type chaperone [Posttran 97.44
KOG0431453 consensus Auxilin-like protein and related protein 97.31
COG1076174 DjlA DnaJ-domain-containing proteins 1 [Posttransl 97.15
TIGR03835 871 termin_org_DnaJ terminal organelle assembly protei 96.85
COG1076174 DjlA DnaJ-domain-containing proteins 1 [Posttransl 96.35
PF03656127 Pam16: Pam16; InterPro: IPR005341 The Pam16 protei 95.36
PF1344662 RPT: A repeated domain in UCH-protein 94.07
KOG0724 335 consensus Zuotin and related molecular chaperones 90.17
PF14687112 DUF4460: Domain of unknown function (DUF4460) 89.06
PF0155681 CTDII: DnaJ C terminal domain; InterPro: IPR002939 88.44
PRK14291382 chaperone protein DnaJ; Provisional 86.79
PRK14284391 chaperone protein DnaJ; Provisional 85.29
PRK14282369 chaperone protein DnaJ; Provisional 82.75
PRK14299291 chaperone protein DnaJ; Provisional 80.15
>COG0484 DnaJ DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=100.00  E-value=1.1e-40  Score=290.88  Aligned_cols=145  Identities=46%  Similarity=0.801  Sum_probs=117.4

Q ss_pred             CCCCcccccCCCCCCCHHHHHHHHHHHHHHhCCCCCCCChhHHHHHHHHHHHHhhhcCChhhhhhhhhhccccccCCCCC
Q 029075            1 MGVDYYKILGVDRNAKDDDLKKAYRKLAMKWHPDKNPNNKKDAETKFKQISEAYEVLSDPQKRAVYDQYGEEGLKGQMPP   80 (199)
Q Consensus         1 m~~d~Y~iLgv~~~a~~~eIkkayrkla~~~HPDk~~~~~~~a~~~f~~i~~Ay~~Lsd~~~R~~Yd~~g~~~~~~~~~~   80 (199)
                      |.+|||+||||+++||.+||||||||||++||||+|+.+ ++|+++|++|+|||+|||||+||++||+||+.+++.+   
T Consensus         2 ~~~dyYeiLGV~k~As~~EIKkAYRkLA~kyHPD~n~g~-~~AeeKFKEI~eAYEVLsD~eKRa~YD~fG~~~~~~g---   77 (371)
T COG0484           2 AKRDYYEILGVSKDASEEEIKKAYRKLAKKYHPDRNPGD-KEAEEKFKEINEAYEVLSDPEKRAAYDQFGHAGFKAG---   77 (371)
T ss_pred             CccchhhhcCCCCCCCHHHHHHHHHHHHHHhCCCCCCCC-HHHHHHHHHHHHHHHHhCCHHHHHHhhccCccccccC---
Confidence            568999999999999999999999999999999999864 6899999999999999999999999999999887621   


Q ss_pred             CCCCCCCCCCCCCCCCCCCCccCCCCChHHHHHHhhCCCCCCCCCCCCCCCCCCCcCCCCCCCCCCCCCCCCCCCCCCCC
Q 029075           81 PDAGGPGGASFFSTGEGPTSFRFNPRSADDIFAEFFGFSHPFGGMGGGGGGMRGSRFAGGLFGDDMFGPFGEGGGGSMGG  160 (199)
Q Consensus        81 ~~~~~~g~~~~~~~~~~~~~~~f~~~~~~d~f~~~fg~~~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  160 (199)
                          +++++ +|+        .|.. ++.|||++|||+     +      +++..                       ++
T Consensus        78 ----g~gg~-g~~--------~fgg-~~~DIF~~~FgG-----g------~~~~~-----------------------~~  109 (371)
T COG0484          78 ----GFGGF-GFG--------GFGG-DFGDIFEDFFGG-----G------GGGRR-----------------------RP  109 (371)
T ss_pred             ----CcCCC-CcC--------CCCC-CHHHHHHHhhcC-----C------CcccC-----------------------CC
Confidence                11111 111        1111 578999999971     1      00000                       01


Q ss_pred             CCCCCCCCeEEEEeeeHHHHhcCceEEEEeeeeeecC
Q 029075          161 GGARKAPPIENKLPCSLEDLYKGTTKKMKISREIADI  197 (199)
Q Consensus       161 ~~~~~g~di~~~l~vtLee~~~G~~k~l~~~r~v~~~  197 (199)
                      .+++++.||.+.|+|||||||+|++++|+|++.+.|.
T Consensus       110 ~~~~rG~Dl~~~l~isleEa~~G~~~~i~~~~~~~C~  146 (371)
T COG0484         110 NRPRRGADLRYNLEITLEEAVFGVKKEIRVTRSVTCS  146 (371)
T ss_pred             CCcccCCceEEEEEeEhhhhccCceeeEecceeeECC
Confidence            3367999999999999999999999999999999885

>PRK14288 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14286 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14296 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14279 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0712 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14285 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14277 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14287 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14276 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14297 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14291 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14282 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14281 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14278 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14280 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14298 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14295 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14294 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14301 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PTZ00037 DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>PRK14290 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14284 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK10767 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14299 chaperone protein DnaJ; Provisional Back     alignment and domain information
>TIGR02349 DnaJ_bact chaperone protein DnaJ Back     alignment and domain information
>PRK14300 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14283 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14293 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14292 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14289 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0713 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10266 curved DNA-binding protein CbpA; Provisional Back     alignment and domain information
>KOG0715 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0716 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0714 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0718 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0717 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0691 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00226 DnaJ: DnaJ domain; InterPro: IPR001623 The prokaryotic heat shock protein DnaJ interacts with the chaperone hsp70-like DnaK protein [] Back     alignment and domain information
>PTZ00341 Ring-infected erythrocyte surface antigen; Provisional Back     alignment and domain information
>KOG0719 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00271 DnaJ DnaJ molecular chaperone homology domain Back     alignment and domain information
>KOG0721 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03835 termin_org_DnaJ terminal organelle assembly protein TopJ Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>COG2214 CbpA DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd06257 DnaJ DnaJ domain or J-domain Back     alignment and domain information
>PHA03102 Small T antigen; Reviewed Back     alignment and domain information
>PRK05014 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PRK01356 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK00294 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PRK03578 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>KOG0722 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0720 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00100 DnaJ chaperone protein; Provisional Back     alignment and domain information
>PRK09430 djlA Dna-J like membrane chaperone protein; Provisional Back     alignment and domain information
>COG5407 SEC63 Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] Back     alignment and domain information
>PHA02624 large T antigen; Provisional Back     alignment and domain information
>KOG1150 consensus Predicted molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK01773 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>TIGR00714 hscB Fe-S protein assembly co-chaperone HscB Back     alignment and domain information
>COG5269 ZUO1 Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1789 consensus Endocytosis protein RME-8, contains DnaJ domain [Intracellular trafficking, secretion, and vesicular transport; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0568 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0723 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3192 consensus Mitochondrial J-type chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0431 consensus Auxilin-like protein and related proteins containing DnaJ domain [General function prediction only] Back     alignment and domain information
>COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03835 termin_org_DnaJ terminal organelle assembly protein TopJ Back     alignment and domain information
>COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF03656 Pam16: Pam16; InterPro: IPR005341 The Pam16 protein is the fifth essential subunit of the pre-sequence translocase-associated protein import motor (PAM) [] Back     alignment and domain information
>PF13446 RPT: A repeated domain in UCH-protein Back     alignment and domain information
>KOG0724 consensus Zuotin and related molecular chaperones (DnaJ superfamily), contains DNA-binding domains [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14687 DUF4460: Domain of unknown function (DUF4460) Back     alignment and domain information
>PF01556 CTDII: DnaJ C terminal domain; InterPro: IPR002939 Molecular chaperones are a diverse family of proteins that function to protect proteins in the intracellular milieu from irreversible aggregation during synthesis and in times of cellular stress Back     alignment and domain information
>PRK14291 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14284 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14282 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14299 chaperone protein DnaJ; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query199
2lgw_A99 Solution Structure Of The J Domain Of Hsj1a Length 7e-23
2ej7_A82 Solution Structure Of The Dnaj Domain Of The Human 2e-22
2dmx_A92 Solution Structure Of The J Domain Of Dnaj Homolog 3e-21
1hdj_A77 Human Hsp40 (Hdj-1), Nmr Length = 77 2e-20
1bqz_A77 J-Domain (Residues 1-77) Of The Escherichia Coli N- 8e-20
1xbl_A107 Nmr Structure Of The J-Domain (Residues 2-76) In Th 1e-19
1bq0_A103 J-Domain (Residues 1-77) Of The Escherichia Coli N- 1e-19
2ctw_A109 Solution Structure Of J-Domain From Mouse Dnaj Subf 2e-18
2och_A73 J-domain Of Dnj-12 From Caenorhabditis Elegans Leng 4e-18
2lo1_A71 Nmr Structure Of The Protein Bc008182, A Dnaj-Like 1e-17
2ctp_A78 Solution Structure Of J-Domain From Human Dnaj Subf 2e-17
2cug_A88 Solution Structure Of The J Domain Of The Pseudo Dn 2e-15
2dn9_A79 Solution Structure Of J-Domain From The Dnaj Homolo 4e-15
2o37_A92 J-Domain Of Sis1 Protein, Hsp40 Co-Chaperone From S 8e-15
2ctr_A88 Solution Structure Of J-Domain From Human Dnaj Subf 1e-14
3apo_A 780 Crystal Structure Of Full-Length Erdj5 Length = 780 4e-14
3apq_A210 Crystal Structure Of J-Trx1 Fragment Of Erdj5 Lengt 5e-14
2y4u_A450 Crystal Structure Of Human P58(Ipk) In Space Group 1e-12
2y4t_A450 Crystal Structure Of The Human Co-Chaperone P58(Ipk 1e-12
3lz8_A 329 Structure Of A Putative Chaperone Dnaj From Klebsie 2e-12
2kqx_A73 Nmr Structure Of The J-Domain (Residues 2-72) In Th 1e-11
2ctq_A112 Solution Structure Of J-Domain From Human Dnaj Subf 1e-07
2l6l_A155 Solution Structure Of Human J-Protein Co-Chaperone, 2e-06
2yua_A99 Solution Structure Of The Dnaj Domain From Human Wi 2e-06
1wjz_A94 Soluiotn Structure Of J-Domain Of Mouse Dnaj Like P 3e-06
2qsa_A109 Crystal Structure Of J-Domain Of Dnaj Homolog Dnj-2 3e-06
>pdb|2LGW|A Chain A, Solution Structure Of The J Domain Of Hsj1a Length = 99 Back     alignment and structure 
Iteration: 1

 Score =  103 bits (257), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 47/72 (65%), Positives = 60/72 (83%)
Query: 5  YYKILGVDRNAKDDDLKKAYRKLAMKWHPDKNPNNKKDAETKFKQISEAYEVLSDPQKRA 64
          YY+IL V R+A  DD+KKAYR+ A++WHPDKNP+NK+ AE KFK+++EAYEVLSD  KR 
Sbjct: 4  YYEILDVPRSASADDIKKAYRRKALQWHPDKNPDNKEFAEKKFKEVAEAYEVLSDKHKRE 63
Query: 65 VYDQYGEEGLKG 76
          +YD+YG EGL G
Sbjct: 64 IYDRYGREGLTG 75
>pdb|2EJ7|A Chain A, Solution Structure Of The Dnaj Domain Of The Human Protein Hcg3, A Hypothetical Protein Tmp_locus_21 Length = 82 Back     alignment and structure
>pdb|2DMX|A Chain A, Solution Structure Of The J Domain Of Dnaj Homolog Subfamily B Member 8 Length = 92 Back     alignment and structure
>pdb|1HDJ|A Chain A, Human Hsp40 (Hdj-1), Nmr Length = 77 Back     alignment and structure
>pdb|1BQZ|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-78) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 77 Back     alignment and structure
>pdb|1XBL|A Chain A, Nmr Structure Of The J-Domain (Residues 2-76) In The Escherichia Coli N-Terminal Fragment (Residues 2-108) Of The Molecular Chaperone Dnaj, 20 Structures Length = 107 Back     alignment and structure
>pdb|1BQ0|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-104) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 103 Back     alignment and structure
>pdb|2CTW|A Chain A, Solution Structure Of J-Domain From Mouse Dnaj Subfamily C Menber 5 Length = 109 Back     alignment and structure
>pdb|2OCH|A Chain A, J-domain Of Dnj-12 From Caenorhabditis Elegans Length = 73 Back     alignment and structure
>pdb|2LO1|A Chain A, Nmr Structure Of The Protein Bc008182, A Dnaj-Like Domain From Homo Sapiens Length = 71 Back     alignment and structure
>pdb|2CTP|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 12 Length = 78 Back     alignment and structure
>pdb|2CUG|A Chain A, Solution Structure Of The J Domain Of The Pseudo Dnaj Protein, Mouse Hypothetical Mkiaa0962 Length = 88 Back     alignment and structure
>pdb|2DN9|A Chain A, Solution Structure Of J-Domain From The Dnaj Homolog, Human Tid1 Protein Length = 79 Back     alignment and structure
>pdb|2O37|A Chain A, J-Domain Of Sis1 Protein, Hsp40 Co-Chaperone From Saccharomyces Cerevisiae Length = 92 Back     alignment and structure
>pdb|2CTR|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 9 Length = 88 Back     alignment and structure
>pdb|3APO|A Chain A, Crystal Structure Of Full-Length Erdj5 Length = 780 Back     alignment and structure
>pdb|3APQ|A Chain A, Crystal Structure Of J-Trx1 Fragment Of Erdj5 Length = 210 Back     alignment and structure
>pdb|2Y4U|A Chain A, Crystal Structure Of Human P58(Ipk) In Space Group P312 Length = 450 Back     alignment and structure
>pdb|2Y4T|A Chain A, Crystal Structure Of The Human Co-Chaperone P58(Ipk) Length = 450 Back     alignment and structure
>pdb|3LZ8|A Chain A, Structure Of A Putative Chaperone Dnaj From Klebsiella Pneumoniae Subsp. Pneumoniae Mgh 78578 At 2.9 A Resolution. Length = 329 Back     alignment and structure
>pdb|2KQX|A Chain A, Nmr Structure Of The J-Domain (Residues 2-72) In The Escherichia Coli Cbpa Length = 73 Back     alignment and structure
>pdb|2CTQ|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily C Menber 12 Length = 112 Back     alignment and structure
>pdb|2L6L|A Chain A, Solution Structure Of Human J-Protein Co-Chaperone, Dph4 Length = 155 Back     alignment and structure
>pdb|2YUA|A Chain A, Solution Structure Of The Dnaj Domain From Human Williams- Beuren Syndrome Chromosome Region 18 Protein Length = 99 Back     alignment and structure
>pdb|1WJZ|A Chain A, Soluiotn Structure Of J-Domain Of Mouse Dnaj Like Protein Length = 94 Back     alignment and structure
>pdb|2QSA|A Chain A, Crystal Structure Of J-Domain Of Dnaj Homolog Dnj-2 Precursor From C.Elegans Length = 109 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query199
2lgw_A99 DNAJ homolog subfamily B member 2; J domain, HSJ1A 1e-52
2ej7_A82 HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati 2e-49
1hdj_A77 Human HSP40, HDJ-1; molecular chaperone; NMR {Homo 3e-49
2dmx_A92 DNAJ homolog subfamily B member 8; DNAJ J domain, 5e-49
3lz8_A 329 Putative chaperone DNAJ; structure genomics, struc 3e-46
2l6l_A155 DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, 4e-45
2ctw_A109 DNAJ homolog subfamily C member 5; J-domain, chape 5e-45
3apq_A210 DNAJ homolog subfamily C member 10; thioredoxin fo 6e-45
1iur_A88 KIAA0730 protein; DNAJ like domain, riken structur 4e-44
2o37_A92 Protein SIS1; HSP40, J-domain, cochaperone, APC900 5e-44
2och_A73 Hypothetical protein DNJ-12; HSP40, J-domain, chap 3e-43
2cug_A88 Mkiaa0962 protein; DNAJ-like domain, structural ge 3e-42
2ctp_A78 DNAJ homolog subfamily B member 12; J-domain, chap 2e-41
2dn9_A79 DNAJ homolog subfamily A member 3; J-domain, TID1, 4e-41
2qsa_A109 DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s 2e-40
1wjz_A94 1700030A21RIK protein; J-domain, DNAJ like protein 1e-39
2ctq_A112 DNAJ homolog subfamily C member 12; J-domain, chap 3e-39
2ctr_A88 DNAJ homolog subfamily B member 9; J-domain, chape 5e-39
2yua_A99 Williams-beuren syndrome chromosome region 18 prot 3e-38
1bq0_A103 DNAJ, HSP40; chaperone, heat shock, protein foldin 1e-37
2pf4_E174 Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, 6e-35
2ys8_A90 RAB-related GTP-binding protein RABJ; DNAJ domain, 5e-33
1gh6_A114 Large T antigen; tumor suppressor, oncoprotein, an 9e-33
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 9e-32
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 4e-29
1fpo_A171 HSC20, chaperone protein HSCB; molecular chaperone 3e-25
3hho_A174 CO-chaperone protein HSCB homolog; structural geno 7e-25
3uo3_A181 J-type CO-chaperone JAC1, mitochondrial; structura 1e-21
1n4c_A182 Auxilin; four helix bundle, protein binding; NMR { 8e-21
3bvo_A207 CO-chaperone protein HSCB, mitochondrial precurso; 1e-20
1faf_A79 Large T antigen; J domain, HPD motif, anti-paralle 2e-17
2qwo_B92 Putative tyrosine-protein phosphatase auxilin; cha 1e-14
3ag7_A106 Putative uncharacterized protein F9E10.5; J-domain 5e-13
2guz_A71 Mitochondrial import inner membrane translocase su 2e-12
3agx_A 181 DNAJ homolog subfamily B member 1; chaperone; 1.85 4e-10
1c3g_A 170 Heat shock protein 40; beta sheets, short helices, 2e-09
2q2g_A 180 HSP40 protein, heat shock 40 kDa protein, putative 2e-09
1nlt_A 248 Protein YDJ1, mitochondrial protein import protein 7e-05
>2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Length = 99 Back     alignment and structure
 Score =  162 bits (413), Expect = 1e-52
 Identities = 49/92 (53%), Positives = 62/92 (67%)

Query: 3  VDYYKILGVDRNAKDDDLKKAYRKLAMKWHPDKNPNNKKDAETKFKQISEAYEVLSDPQK 62
            YY+IL V R+A  DD+KKAYR+ A++WHPDKNP+NK+ AE KFK+++EAYEVLSD  K
Sbjct: 2  ASYYEILDVPRSASADDIKKAYRRKALQWHPDKNPDNKEFAEKKFKEVAEAYEVLSDKHK 61

Query: 63 RAVYDQYGEEGLKGQMPPPDAGGPGGASFFST 94
          R +YD+YG EGL G    P     G       
Sbjct: 62 REIYDRYGREGLTGTGTGPSRAEAGSGGPGLE 93
>2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 82 Back     alignment and structure
>1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 77 Back     alignment and structure
>2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Length = 329 Back     alignment and structure
>2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Length = 109 Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Length = 210 Back     alignment and structure
>1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 88 Back     alignment and structure
>2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Length = 92 Back     alignment and structure
>2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Length = 73 Back     alignment and structure
>2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Length = 88 Back     alignment and structure
>2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Length = 109 Back     alignment and structure
>1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Length = 94 Back     alignment and structure
>2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 112 Back     alignment and structure
>2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Length = 103 Back     alignment and structure
>2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Length = 174 Back     alignment and structure
>2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Length = 114 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Length = 780 Back     alignment and structure
>1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Length = 171 Back     alignment and structure
>3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A Length = 181 Back     alignment and structure
>1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Length = 182 Back     alignment and structure
>3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} Length = 207 Back     alignment and structure
>1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Length = 79 Back     alignment and structure
>2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Length = 92 Back     alignment and structure
>3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} Length = 106 Back     alignment and structure
>2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Length = 71 Back     alignment and structure
>3agx_A DNAJ homolog subfamily B member 1; chaperone; 1.85A {Homo sapiens} PDB: 3agy_A 3agz_A 2qld_A Length = 181 Back     alignment and structure
>1c3g_A Heat shock protein 40; beta sheets, short helices, chaperone; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 PDB: 2b26_A Length = 170 Back     alignment and structure
>2q2g_A HSP40 protein, heat shock 40 kDa protein, putative (fragment); malaria, structural genomics, structural genomics consortium, SGC; 1.90A {Cryptosporidium parvum iowa II} Length = 180 Back     alignment and structure
>1nlt_A Protein YDJ1, mitochondrial protein import protein MAS5; beta-strands, chaperone, heat shock, mitochondrion; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 g.54.1.1 Length = 248 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query199
3lz8_A 329 Putative chaperone DNAJ; structure genomics, struc 99.96
1hdj_A77 Human HSP40, HDJ-1; molecular chaperone; NMR {Homo 99.92
1bq0_A103 DNAJ, HSP40; chaperone, heat shock, protein foldin 99.91
2ej7_A82 HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati 99.91
2o37_A92 Protein SIS1; HSP40, J-domain, cochaperone, APC900 99.9
2lgw_A99 DNAJ homolog subfamily B member 2; J domain, HSJ1A 99.9
2dn9_A79 DNAJ homolog subfamily A member 3; J-domain, TID1, 99.9
2dmx_A92 DNAJ homolog subfamily B member 8; DNAJ J domain, 99.9
2ctr_A88 DNAJ homolog subfamily B member 9; J-domain, chape 99.89
2ctp_A78 DNAJ homolog subfamily B member 12; J-domain, chap 99.89
2cug_A88 Mkiaa0962 protein; DNAJ-like domain, structural ge 99.89
2och_A73 Hypothetical protein DNJ-12; HSP40, J-domain, chap 99.88
2yua_A99 Williams-beuren syndrome chromosome region 18 prot 99.88
2ctw_A109 DNAJ homolog subfamily C member 5; J-domain, chape 99.88
2ctq_A112 DNAJ homolog subfamily C member 12; J-domain, chap 99.88
1wjz_A94 1700030A21RIK protein; J-domain, DNAJ like protein 99.86
3apq_A210 DNAJ homolog subfamily C member 10; thioredoxin fo 99.83
2qsa_A109 DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s 99.83
2l6l_A155 DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, 99.81
2ys8_A90 RAB-related GTP-binding protein RABJ; DNAJ domain, 99.81
1iur_A88 KIAA0730 protein; DNAJ like domain, riken structur 99.78
1gh6_A114 Large T antigen; tumor suppressor, oncoprotein, an 99.78
1fpo_A171 HSC20, chaperone protein HSCB; molecular chaperone 99.76
1faf_A79 Large T antigen; J domain, HPD motif, anti-paralle 99.76
2pf4_E174 Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, 99.76
3hho_A174 CO-chaperone protein HSCB homolog; structural geno 99.76
1n4c_A182 Auxilin; four helix bundle, protein binding; NMR { 99.75
3bvo_A207 CO-chaperone protein HSCB, mitochondrial precurso; 99.74
2qwo_B92 Putative tyrosine-protein phosphatase auxilin; cha 99.74
3ag7_A106 Putative uncharacterized protein F9E10.5; J-domain 99.72
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 99.7
3uo3_A181 J-type CO-chaperone JAC1, mitochondrial; structura 99.69
2guz_A71 Mitochondrial import inner membrane translocase su 99.67
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.29
2guz_B65 Mitochondrial import inner membrane translocase su 98.94
3i38_A109 Putative chaperone DNAJ; structural genomics, prot 92.0
1c3g_A170 Heat shock protein 40; beta sheets, short helices, 81.1
>3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Back     alignment and structure
Probab=99.96  E-value=3.4e-31  Score=229.77  Aligned_cols=146  Identities=34%  Similarity=0.523  Sum_probs=33.1

Q ss_pred             CCcccccCCCCCCCHHHHHHHHHHHHHHhCCCCCCCChhHHHHHHHHHHHHhhhcCChhhhhhhhhhccccccCCCCCCC
Q 029075            3 VDYYKILGVDRNAKDDDLKKAYRKLAMKWHPDKNPNNKKDAETKFKQISEAYEVLSDPQKRAVYDQYGEEGLKGQMPPPD   82 (199)
Q Consensus         3 ~d~Y~iLgv~~~a~~~eIkkayrkla~~~HPDk~~~~~~~a~~~f~~i~~Ay~~Lsd~~~R~~Yd~~g~~~~~~~~~~~~   82 (199)
                      +|||+||||+++|+.+|||+|||+||++||||+++.  +.|+++|++|++||++|+||.+|+.||+++......     +
T Consensus        28 ~d~Y~vLgv~~~as~~eIk~aYr~la~~~HPDk~~~--~~a~~~f~~i~~Ay~vL~d~~~R~~YD~~~~~~~~~-----~  100 (329)
T 3lz8_A           28 KDYYAILGVQPTDDLKTIKTAYRRLARKYHPDVSKE--NDAEAKFKDLAEAWEVLKDEQRRAEYDQLWQHRNDP-----G  100 (329)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             cCHHHHcCcCCCCCHHHHHHHHHHHHHHHCCCCCCC--hHHHHHHHHHHHHHHHhhhhhhhcccchhhccccCC-----C
Confidence            699999999999999999999999999999999974  378899999999999999999999999985432110     0


Q ss_pred             CCCCCCCCCCCCCCCCCCccCCCCChHHHHHHhhCCCCCCCCCCCCCCCCCCCcCCCCCCCCCCCCCCCCCCCCCCCCCC
Q 029075           83 AGGPGGASFFSTGEGPTSFRFNPRSADDIFAEFFGFSHPFGGMGGGGGGMRGSRFAGGLFGDDMFGPFGEGGGGSMGGGG  162 (199)
Q Consensus        83 ~~~~g~~~~~~~~~~~~~~~f~~~~~~d~f~~~fg~~~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  162 (199)
                         +++  .+....  .  .|...+++|||+.|||+.    +      + ++.                        ...
T Consensus       101 ---~~~--~~~~~~--~--~f~~~~f~diF~~~Fg~~----g------~-~~~------------------------~~~  136 (329)
T 3lz8_A          101 ---FGR--QRQTHE--Q--SYSQQDFDDIFSSMFGQQ----A------H-QRR------------------------RQH  136 (329)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             ---ccc--cccccc--C--CcCCCchhhhhHhhhcCc----C------C-CCC------------------------CCC
Confidence               000  000000  0  111224578888888721    0      0 000                        012


Q ss_pred             CCCCCCeEEEEeeeHHHHhcCceEEEEeeeeeecCCC
Q 029075          163 ARKAPPIENKLPCSLEDLYKGTTKKMKISREIADISG  199 (199)
Q Consensus       163 ~~~g~di~~~l~vtLee~~~G~~k~l~~~r~v~~~~~  199 (199)
                      +++++|++++|.|||||+|+||+++|++++.+.|..|
T Consensus       137 ~~~g~Dl~~~l~vsleea~~G~~k~i~i~~~v~~g~G  173 (329)
T 3lz8_A          137 AARGHDLEIEVAVFLEETLAEQTRTISYNLPVYNVFG  173 (329)
T ss_dssp             CCCCCCEEEEECCCTTGGGSCEEEEEEEEEEECCSCC
T ss_pred             cCCCCCEEEEEecchhhhhhccceEEEEEEEeecCCe
Confidence            4689999999999999999999999999998876543
>1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Back     alignment and structure
>1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Back     alignment and structure
>2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Back     alignment and structure
>2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Back     alignment and structure
>2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Back     alignment and structure
>2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Back     alignment and structure
>2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Back     alignment and structure
>1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Back     alignment and structure
>1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Back     alignment and structure
>1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Back     alignment and structure
>2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Back     alignment and structure
>1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Back     alignment and structure
>3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} Back     alignment and structure
>2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Back     alignment and structure
>3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Back     alignment and structure
>3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A Back     alignment and structure
>2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2guz_B Mitochondrial import inner membrane translocase subunit TIM16; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3i38_A Putative chaperone DNAJ; structural genomics, protein structure initiative, midwest center for structural genomics, MCSG; 2.30A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1c3g_A Heat shock protein 40; beta sheets, short helices, chaperone; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 PDB: 2b26_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 199
d1xbla_75 a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain 5e-27
d1iura_88 a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human 1e-25
d1nz6a_98 a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [T 1e-24
d1hdja_77 a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9 2e-24
d1wjza_94 a.2.3.1 (A:) CSL-type zinc finger-containing prote 6e-23
d1fpoa176 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) doma 1e-22
d1fafa_79 a.2.3.1 (A:) Large T antigen, the N-terminal J dom 1e-20
d1gh6a_114 a.2.3.1 (A:) Large T antigen, the N-terminal J dom 9e-20
d1c3ga180 b.4.1.1 (A:180-259) Heat shock protein 40 Sis1 {Ba 8e-05
>d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 75 Back     information, alignment and structure

class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Chaperone J-domain
family: Chaperone J-domain
domain: DnaJ chaperone, N-terminal (J) domain
species: Escherichia coli [TaxId: 562]

 Score = 95.9 bits (238), Expect = 5e-27
 Identities = 41/72 (56%), Positives = 57/72 (79%), Gaps = 1/72 (1%)

Query: 4  DYYKILGVDRNAKDDDLKKAYRKLAMKWHPDKNPNNKKDAETKFKQISEAYEVLSDPQKR 63
          DYY+ILGV + A++ +++KAY++LAMK+HPD+N  +K+  E KFK+I EAYEVL+D QKR
Sbjct: 4  DYYEILGVSKTAEEREIRKAYKRLAMKYHPDRNQGDKEA-EAKFKEIKEAYEVLTDSQKR 62

Query: 64 AVYDQYGEEGLK 75
          A YDQYG    +
Sbjct: 63 AAYDQYGHAAFE 74
>d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Length = 98 Back     information, alignment and structure
>d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Length = 77 Back     information, alignment and structure
>d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 76 Back     information, alignment and structure
>d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Length = 79 Back     information, alignment and structure
>d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Length = 114 Back     information, alignment and structure
>d1c3ga1 b.4.1.1 (A:180-259) Heat shock protein 40 Sis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 80 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query199
d1xbla_75 DnaJ chaperone, N-terminal (J) domain {Escherichia 99.93
d1hdja_77 HSP40 {Human (Homo sapiens) [TaxId: 9606]} 99.93
d1wjza_94 CSL-type zinc finger-containing protein 3 (J-domai 99.88
d1gh6a_114 Large T antigen, the N-terminal J domain {Simian v 99.85
d1fpoa176 HSC20 (HSCB), N-terminal (J) domain {Escherichia c 99.78
d1iura_88 Hypothetical protein KIAA0730 {Human (Homo sapiens 99.77
d1fafa_79 Large T antigen, the N-terminal J domain {Murine p 99.76
d1nz6a_98 Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} 99.73
d1nlta174 Mitochondrial protein import protein mas5 (Hsp40, 98.26
d1c3ga180 Heat shock protein 40 Sis1 {Baker's yeast (Sacchar 98.11
d1nlta280 Mitochondrial protein import protein mas5 (Hsp40, 93.79
d1c3ga290 Heat shock protein 40 Sis1 {Baker's yeast (Sacchar 93.51
d2b7ea156 Pre-mRNA-processing protein PRP40 {Baker's yeast ( 80.77
>d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Chaperone J-domain
family: Chaperone J-domain
domain: DnaJ chaperone, N-terminal (J) domain
species: Escherichia coli [TaxId: 562]

Probab=99.93  E-value=1.2e-26  Score=159.01  Aligned_cols=71  Identities=59%  Similarity=1.072  Sum_probs=66.4

Q ss_pred             CCcccccCCCCCCCHHHHHHHHHHHHHHhCCCCCCCChhHHHHHHHHHHHHhhhcCChhhhhhhhhhccccc
Q 029075            3 VDYYKILGVDRNAKDDDLKKAYRKLAMKWHPDKNPNNKKDAETKFKQISEAYEVLSDPQKRAVYDQYGEEGL   74 (199)
Q Consensus         3 ~d~Y~iLgv~~~a~~~eIkkayrkla~~~HPDk~~~~~~~a~~~f~~i~~Ay~~Lsd~~~R~~Yd~~g~~~~   74 (199)
                      +|||+||||+++||.+|||+|||+|+++||||+++.+ +.++++|+.|++||+||+||.+|..||++|+.++
T Consensus         3 ~dyY~vLgv~~~As~~eIk~aYr~l~~~~HPDk~~~~-~~~~~~f~~i~~Ay~vL~d~~~R~~YD~~g~~~~   73 (75)
T d1xbla_           3 QDYYEILGVSKTAEEREIRKAYKRLAMKYHPDRNQGD-KEAEAKFKEIKEAYEVLTDSQKRAAYDQYGHAAF   73 (75)
T ss_dssp             CCTTTTTCCSSSCCHHHHHHHHHHHHHHTCCTTCTTT-CHHHHHHHHHHHHHHHTTSSHHHHHHHHHTTSSC
T ss_pred             CCHHHHcCCCCCcCHHHHHHHHHHHHhhhhhhccCCC-hHHHHHHHHHHHHHHhcCCHHHHHHHHHhCcccc
Confidence            6999999999999999999999999999999999754 4788899999999999999999999999997754
>d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Back     information, alignment and structure
>d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Back     information, alignment and structure
>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nlta1 b.4.1.1 (A:110-138,A:213-257) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1c3ga1 b.4.1.1 (A:180-259) Heat shock protein 40 Sis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nlta2 b.4.1.1 (A:258-337) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1c3ga2 b.4.1.1 (A:260-349) Heat shock protein 40 Sis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2b7ea1 a.159.2.1 (A:4-59) Pre-mRNA-processing protein PRP40 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure