Citrus Sinensis ID: 029082

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------20
MRFISESSEERIPCYRVLDDDGQPFPDSSFVKVSEGVAIKMYNDMVTLQTMDTIFYEAQRQGRISFYLTTSGEEAINIASAAAIKNDDFVVPQYREPGVLLWRGFSMQEFANQCFGNKADYGKGRQMPIHYGSNKHNYFTVSSTIATQLPHAVGAAYALKMDRKDACAVTYFGDGGTSEEVSFLFLIHQLVIREISMLL
cccccccccccccEEEEEccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHcccccccEEccccccHHHHHHHcccHHHHHHHHccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccEEEEEEccccccHHHHHHHHHcccccccccccc
cccccccccccccEEEEEcccccEccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEcccHHHHHHHHHHHHcccccEEEcccccccEEEEccccHHHHHHHHHcccccccccccccEEEccccccccccccHHHHHcHHHHHHHHHHHHcccccEEEEEEcccccccccHHHHHHHcccHHHHHHHc
mrfisesseeripcyrvldddgqpfpdssfvKVSEGVAIKMYNDMVTLQTMDTIFYEAQRQGRISFYLTTSGEEAINIASAAaiknddfvvpqyrepgvllwRGFSMQEFAnqcfgnkadygkgrqmpihygsnkhnyftVSSTIATQLPHAVGAAYALkmdrkdacavtyfgdggtseEVSFLFLIHQLVIREISMLL
mrfisesseeriPCYRVLDDDGQPFPDSSFVKVSEGVAIKMYNDMVTLQTMDTIFYEAQRQGRISFYLTTSGEEAINIASAAAIKNDDFVVPQYREPGVLLWRGFSMQEFANQCFGNKADYGKGRQMPIHYGSNKHNYFTVSSTIATQLPHAVGAAYALKMDRKDACAVTYFGDGGTSEEVSFLFLIHQLVIREISMLL
MRFISESSEERIPCYRVLDDDGQPFPDSSFVKVSEGVAIKMYNDMVTLQTMDTIFYEAQRQGRISFYLTTSGEEainiasaaaiKNDDFVVPQYREPGVLLWRGFSMQEFANQCFGNKADYGKGRQMPIHYGSNKHNYFTVSSTIATQLPHAVGAAYALKMDRKDACAVTYFGDGGTSEEVSFLFLIHQLVIREISMLL
************PCYRVLDD****F*DSSFVKVSEGVAIKMYNDMVTLQTMDTIFYEAQRQGRISFYLTTSGEEAINIASAAAIKNDDFVVPQYREPGVLLWRGFSMQEFANQCFGNKADYGKGRQMPIHYGSNKHNYFTVSSTIATQLPHAVGAAYALKMDRKDACAVTYFGDGGTSEEVSFLFLIHQLVIREI****
*******SEERIPCYRVLDDDGQPFPDSSFVKVSEGVAIKMYNDMVTLQTMDTIFYEAQRQGRISFYLTTSGEEAINIASAAAIKNDDFVVPQYREPGVLLWRGFSMQEFANQCFGNKADYGKGRQMPIHYGSNKHNYFTVSSTIATQLPHAVGAAYALKMDRKDACAVTYFGDGGTSEEVSFLFLIHQLVIREISMLL
*********ERIPCYRVLDDDGQPFPDSSFVKVSEGVAIKMYNDMVTLQTMDTIFYEAQRQGRISFYLTTSGEEAINIASAAAIKNDDFVVPQYREPGVLLWRGFSMQEFANQCFGNKADYGKGRQMPIHYGSNKHNYFTVSSTIATQLPHAVGAAYALKMDRKDACAVTYFGDGGTSEEVSFLFLIHQLVIREISMLL
*RFISESSEERIPCYRVLDDDGQPFPDSSFVKVSEGVAIKMYNDMVTLQTMDTIFYEAQRQGRISFYLTTSGEEAINIASAAAIKNDDFVVPQYREPGVLLWRGFSMQEFANQCFGNKADYGKGRQMPIHYGSNKHNYFTVSSTIATQLPHAVGAAYALKMDRKDACAVTYFGDGGTSEEVSFLFLIHQLVIREISMLL
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRFISESSEERIPCYRVLDDDGQPFPDSSFVKVSEGVAIKMYNDMVTLQTMDTIFYEAQRQGRISFYLTTSGEEAINIASAAAIKNDDFVVPQYREPGVLLWRGFSMQEFANQCFGNKADYGKGRQMPIHYGSNKHNYFTVSSTIATQLPHAVGAAYALKMDRKDACAVTYFGDGGTSEEVSFLFLIHQLVIREISMLL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query199 2.2.26 [Sep-21-2011]
Q54M22 441 2-oxoisovalerate dehydrog yes no 0.829 0.374 0.520 1e-47
O45924 431 2-oxoisovalerate dehydrog yes no 0.844 0.389 0.508 2e-46
A5A6H9 445 2-oxoisovalerate dehydrog yes no 0.899 0.402 0.480 3e-42
Q8HXY4 445 2-oxoisovalerate dehydrog N/A no 0.899 0.402 0.480 3e-42
P12694 445 2-oxoisovalerate dehydrog yes no 0.899 0.402 0.480 3e-42
P11960 441 2-oxoisovalerate dehydrog yes no 0.899 0.405 0.474 2e-41
P11178 455 2-oxoisovalerate dehydrog yes no 0.899 0.393 0.474 3e-41
P50136 442 2-oxoisovalerate dehydrog yes no 0.899 0.404 0.469 1e-40
Q5SLR4 367 2-oxoisovalerate dehydrog yes no 0.703 0.381 0.425 7e-25
Q72GU1 367 2-oxoisovalerate dehydrog yes no 0.703 0.381 0.425 1e-24
>sp|Q54M22|ODBA_DICDI 2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial OS=Dictyostelium discoideum GN=bkdA PE=3 SV=1 Back     alignment and function desciption
 Score =  189 bits (480), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 89/171 (52%), Positives = 118/171 (69%), Gaps = 6/171 (3%)

Query: 12  IPCYRVLDDDG---QPFPDSSFVKVSEGVAIKMYNDMVTLQTMDTIFYEAQRQGRISFYL 68
           IPCY ++D +G   +P  D +F K      IKMY  M+TL  MD+I Y+ QRQGRISFY+
Sbjct: 64  IPCYTIMDQEGVVSKPDQDPNFSKEE---VIKMYTTMLTLNVMDSILYDVQRQGRISFYM 120

Query: 69  TTSGEEAINIASAAAIKNDDFVVPQYREPGVLLWRGFSMQEFANQCFGNKADYGKGRQMP 128
           T+ GEEAI+I SAAA++  D +  QYRE GV +WRGF++ +  NQC  N+ D GKGRQMP
Sbjct: 121 TSFGEEAIHIGSAAALEMSDTIFAQYRETGVFMWRGFTINDIINQCCTNEHDLGKGRQMP 180

Query: 129 IHYGSNKHNYFTVSSTIATQLPHAVGAAYALKMDRKDACAVTYFGDGGTSE 179
           +H+GS K N  T+SS + TQLP AVG++YA K+  +  C + YFG+G  SE
Sbjct: 181 MHFGSRKINLQTISSPLTTQLPQAVGSSYAQKLAGEKNCTIVYFGEGAASE 231
The branched-chain alpha-keto dehydrogenase complex catalyzes the overall conversion of alpha-keto acids to acyl-CoA and CO(2). It contains multiple copies of three enzymatic components: branched-chain alpha-keto acid decarboxylase (E1), lipoamide acyltransferase (E2) and lipoamide dehydrogenase (E3).
Dictyostelium discoideum (taxid: 44689)
EC: 1EC: .EC: 2EC: .EC: 4EC: .EC: 4
>sp|O45924|ODBA_CAEEL 2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial OS=Caenorhabditis elegans GN=Y39E4A.3 PE=1 SV=2 Back     alignment and function description
>sp|A5A6H9|ODBA_PANTR 2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial OS=Pan troglodytes GN=BCKDHA PE=2 SV=1 Back     alignment and function description
>sp|Q8HXY4|ODBA_MACFA 2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial OS=Macaca fascicularis GN=BCKDHA PE=2 SV=1 Back     alignment and function description
>sp|P12694|ODBA_HUMAN 2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial OS=Homo sapiens GN=BCKDHA PE=1 SV=2 Back     alignment and function description
>sp|P11960|ODBA_RAT 2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial (Fragment) OS=Rattus norvegicus GN=Bckdha PE=1 SV=1 Back     alignment and function description
>sp|P11178|ODBA_BOVIN 2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial OS=Bos taurus GN=BCKDHA PE=2 SV=1 Back     alignment and function description
>sp|P50136|ODBA_MOUSE 2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial OS=Mus musculus GN=Bckdha PE=1 SV=1 Back     alignment and function description
>sp|Q5SLR4|ODBA_THET8 2-oxoisovalerate dehydrogenase subunit alpha OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=TTHA0229 PE=1 SV=1 Back     alignment and function description
>sp|Q72GU1|ODBA_THET2 2-oxoisovalerate dehydrogenase subunit alpha OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=TT_C1757 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query199
297811017 472 hypothetical protein ARALYDRAFT_350155 [ 0.899 0.379 0.798 8e-83
18415939 472 2-oxoisovalerate dehydrogenase E1 compon 0.899 0.379 0.787 3e-82
42573319 401 2-oxoisovalerate dehydrogenase E1 compon 0.899 0.446 0.787 3e-82
9955517 414 branched-chain alpha keto-acid dehydroge 0.899 0.432 0.787 3e-82
413916414 392 hypothetical protein ZEAMMB73_816012 [Ze 0.899 0.456 0.793 7e-82
413916415 346 hypothetical protein ZEAMMB73_816012 [Ze 0.899 0.517 0.793 8e-82
212275011 488 uncharacterized protein LOC100191513 [Ze 0.899 0.366 0.793 1e-81
312281515 471 unnamed protein product [Thellungiella h 0.899 0.380 0.765 3e-81
255558474 380 2-oxoisovalerate dehydrogenase, putative 0.899 0.471 0.765 4e-81
357160615 470 PREDICTED: 2-oxoisovalerate dehydrogenas 0.899 0.380 0.798 6e-81
>gi|297811017|ref|XP_002873392.1| hypothetical protein ARALYDRAFT_350155 [Arabidopsis lyrata subsp. lyrata] gi|297319229|gb|EFH49651.1| hypothetical protein ARALYDRAFT_350155 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
 Score =  311 bits (797), Expect = 8e-83,   Method: Compositional matrix adjust.
 Identities = 143/179 (79%), Positives = 161/179 (89%)

Query: 1   MRFISESSEERIPCYRVLDDDGQPFPDSSFVKVSEGVAIKMYNDMVTLQTMDTIFYEAQR 60
           +RFISES  ER+PCYRVLDD+GQ   +S FV+VSE VA+K+Y+DMVTLQ MD IFYEAQR
Sbjct: 93  IRFISESDSERVPCYRVLDDNGQLITNSQFVQVSEEVAVKIYSDMVTLQIMDNIFYEAQR 152

Query: 61  QGRISFYLTTSGEEAINIASAAAIKNDDFVVPQYREPGVLLWRGFSMQEFANQCFGNKAD 120
           QGR+SFY T  GEEAINIASAAA+   D + PQYREPGVLLWRGF++QEFANQCFGNK+D
Sbjct: 153 QGRLSFYATAIGEEAINIASAAALTPQDVIFPQYREPGVLLWRGFTLQEFANQCFGNKSD 212

Query: 121 YGKGRQMPIHYGSNKHNYFTVSSTIATQLPHAVGAAYALKMDRKDACAVTYFGDGGTSE 179
           YGKGRQMP+HYGSNK NYFTVS+TIATQLP+AVGAAY+LKMDRKDACAVTYFGDGGTSE
Sbjct: 213 YGKGRQMPVHYGSNKLNYFTVSATIATQLPNAVGAAYSLKMDRKDACAVTYFGDGGTSE 271

Source: Arabidopsis lyrata subsp. lyrata

Species: Arabidopsis lyrata

Genus: Arabidopsis

Family: Brassicaceae

Order: Brassicales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|18415939|ref|NP_568209.1| 2-oxoisovalerate dehydrogenase E1 component, alpha subunit [Arabidopsis thaliana] gi|28393751|gb|AAO42286.1| putative branched-chain alpha keto-acid dehydrogenase E1 alpha subunit [Arabidopsis thaliana] gi|28973423|gb|AAO64036.1| putative branched-chain alpha keto-acid dehydrogenase E1 alpha subunit [Arabidopsis thaliana] gi|332003988|gb|AED91371.1| 2-oxoisovalerate dehydrogenase E1 component, alpha subunit [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|42573319|ref|NP_974756.1| 2-oxoisovalerate dehydrogenase E1 component, alpha subunit [Arabidopsis thaliana] gi|332003989|gb|AED91372.1| 2-oxoisovalerate dehydrogenase E1 component, alpha subunit [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|9955517|emb|CAC05456.1| branched-chain alpha keto-acid dehydrogenase E1 alpha subunit-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|413916414|gb|AFW56346.1| hypothetical protein ZEAMMB73_816012 [Zea mays] Back     alignment and taxonomy information
>gi|413916415|gb|AFW56347.1| hypothetical protein ZEAMMB73_816012 [Zea mays] Back     alignment and taxonomy information
>gi|212275011|ref|NP_001130417.1| uncharacterized protein LOC100191513 [Zea mays] gi|194689064|gb|ACF78616.1| unknown [Zea mays] gi|194690354|gb|ACF79261.1| unknown [Zea mays] gi|194690522|gb|ACF79345.1| unknown [Zea mays] gi|194703080|gb|ACF85624.1| unknown [Zea mays] gi|413916413|gb|AFW56345.1| hypothetical protein ZEAMMB73_816012 [Zea mays] Back     alignment and taxonomy information
>gi|312281515|dbj|BAJ33623.1| unnamed protein product [Thellungiella halophila] Back     alignment and taxonomy information
>gi|255558474|ref|XP_002520262.1| 2-oxoisovalerate dehydrogenase, putative [Ricinus communis] gi|223540481|gb|EEF42048.1| 2-oxoisovalerate dehydrogenase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|357160615|ref|XP_003578820.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial-like [Brachypodium distachyon] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query199
TAIR|locus:2184702 472 AT5G09300 "AT5G09300" [Arabido 0.899 0.379 0.737 3.7e-71
TAIR|locus:2027072 472 AT1G21400 "AT1G21400" [Arabido 0.899 0.379 0.703 3.5e-68
FB|FBgn0037709 439 CG8199 [Drosophila melanogaste 0.844 0.382 0.508 3.9e-44
WB|WBGene00012713 432 Y39E4A.3 [Caenorhabditis elega 0.899 0.414 0.455 4.6e-41
DICTYBASE|DDB_G0286335 441 bkdA "branched-chain alpha-ket 0.829 0.374 0.491 9.6e-41
ZFIN|ZDB-GENE-050522-376 446 bckdha "branched chain keto ac 0.899 0.401 0.463 5.3e-40
UNIPROTKB|B4DP47 448 BCKDHA "2-oxoisovalerate dehyd 0.899 0.399 0.458 8.7e-40
UNIPROTKB|F5H5P2 479 BCKDHA "Uncharacterized protei 0.899 0.373 0.458 8.7e-40
UNIPROTKB|P12694 445 BCKDHA "2-oxoisovalerate dehyd 0.899 0.402 0.458 8.7e-40
UNIPROTKB|E2RPW4 530 B3GNT8 "Uncharacterized protei 0.899 0.337 0.458 2.3e-39
TAIR|locus:2184702 AT5G09300 "AT5G09300" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 720 (258.5 bits), Expect = 3.7e-71, P = 3.7e-71
 Identities = 132/179 (73%), Positives = 152/179 (84%)

Query:     1 MRFISESSEERIPCYRVLDDDGQPFPDSSFVKVSEGVAIKMYNDMVTLQTMDTIFYEAQR 60
             ++FISES +ER+PCYRVLDD+GQ   +S FV+VSE VA+K+Y+DMVTLQ MD IFYEAQR
Sbjct:    93 IQFISESDKERVPCYRVLDDNGQLITNSQFVQVSEEVAVKIYSDMVTLQIMDNIFYEAQR 152

Query:    61 QGRISFYLTTSGEEXXXXXXXXXXKNDDFVVPQYREPGVLLWRGFSMQEFANQCFGNKAD 120
             QGR+SFY T  GEE             D + PQYREPGVLLWRGF++QEFANQCFGNK+D
Sbjct:   153 QGRLSFYATAIGEEAINIASAAALTPQDVIFPQYREPGVLLWRGFTLQEFANQCFGNKSD 212

Query:   121 YGKGRQMPIHYGSNKHNYFTVSSTIATQLPHAVGAAYALKMDRKDACAVTYFGDGGTSE 179
             YGKGRQMP+HYGSNK NYFTVS+TIATQLP+AVGAAY+LKMD+KDACAVTYFGDGGTSE
Sbjct:   213 YGKGRQMPVHYGSNKLNYFTVSATIATQLPNAVGAAYSLKMDKKDACAVTYFGDGGTSE 271
GO:0003863 "3-methyl-2-oxobutanoate dehydrogenase (2-methylpropanoyl-transferring) activity" evidence=ISS
GO:0005739 "mitochondrion" evidence=ISM;IDA
GO:0008152 "metabolic process" evidence=IEA;ISS
GO:0016624 "oxidoreductase activity, acting on the aldehyde or oxo group of donors, disulfide as acceptor" evidence=IEA
TAIR|locus:2027072 AT1G21400 "AT1G21400" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
FB|FBgn0037709 CG8199 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
WB|WBGene00012713 Y39E4A.3 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0286335 bkdA "branched-chain alpha-keto acid dehydrogenase E1 alpha chain" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050522-376 bckdha "branched chain keto acid dehydrogenase E1, alpha polypeptide" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|B4DP47 BCKDHA "2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F5H5P2 BCKDHA "Uncharacterized protein" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P12694 BCKDHA "2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E2RPW4 B3GNT8 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.2.4LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
fgenesh1_pg.C_scaffold_6000748
annotation not avaliable (472 aa)
(Arabidopsis lyrata)
Predicted Functional Partners:
scaffold_105341.1
annotation not avaliable (352 aa)
••••••• 0.952
fgenesh2_kg.3__1430__AT3G13450.1
annotation not avaliable (360 aa)
••••••• 0.946
fgenesh1_pm.C_scaffold_8000817
annotation not avaliable (366 aa)
••••••• 0.873
scaffold_300800.1
annotation not avaliable (484 aa)
• •• •• 0.872
fgenesh2_kg.1__3184__AT1G30120.1
annotation not avaliable (406 aa)
•••  •• 0.773
fgenesh2_kg.4__1482__AT2G34590.1
annotation not avaliable (409 aa)
•••  •• 0.768
fgenesh2_kg.1__3892__AT1G48030.2
annotation not avaliable (505 aa)
•  • •• 0.666
scaffold_302028.1
annotation not avaliable (507 aa)
•  • •• 0.657
scaffold_304435.1
annotation not avaliable (374 aa)
•       0.528
scaffold_501390.1
annotation not avaliable (409 aa)
•  • •• 0.506

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query199
cd02000 293 cd02000, TPP_E1_PDC_ADC_BCADC, Thiamine pyrophosph 4e-62
COG1071 358 COG1071, AcoA, Pyruvate/2-oxoglutarate dehydrogena 2e-48
TIGR03181 341 TIGR03181, PDH_E1_alph_x, pyruvate dehydrogenase E 6e-43
pfam00676 303 pfam00676, E1_dh, Dehydrogenase E1 component 1e-38
TIGR03182 315 TIGR03182, PDH_E1_alph_y, pyruvate dehydrogenase E 2e-19
PLN02374 433 PLN02374, PLN02374, pyruvate dehydrogenase (acetyl 9e-12
CHL00149 341 CHL00149, odpA, pyruvate dehydrogenase E1 componen 2e-10
PLN02269 362 PLN02269, PLN02269, Pyruvate dehydrogenase E1 comp 3e-09
>gnl|CDD|238958 cd02000, TPP_E1_PDC_ADC_BCADC, Thiamine pyrophosphate (TPP) family, E1 of PDC_ADC_BCADC subfamily, TPP-binding module; composed of proteins similar to the E1 components of the human pyruvate dehydrogenase complex (PDC), the acetoin dehydrogenase complex (ADC) and the branched chain alpha-keto acid dehydrogenase/2-oxoisovalerate dehydrogenase complex (BCADC) Back     alignment and domain information 
 Score =  194 bits (495), Expect = 4e-62
 Identities = 54/140 (38%), Positives = 79/140 (56%), Gaps = 1/140 (0%)

Query: 41  MYNDMVTLQTMDTIFYEAQRQGRIS-FYLTTSGEEAINIASAAAIKNDDFVVPQYREPGV 99
           +Y  MV ++  D    E  RQG+I  FY  + G+EA+ +  AAA++  D+V P YR+ G 
Sbjct: 1   LYRTMVLIRRFDERLLELYRQGKIGGFYHLSIGQEAVAVGVAAALRPGDWVFPTYRDHGH 60

Query: 100 LLWRGFSMQEFANQCFGNKADYGKGRQMPIHYGSNKHNYFTVSSTIATQLPHAVGAAYAL 159
            L RG  ++E   + FG +    KGR   +H G  + N+F  +  +  Q+P A GAA AL
Sbjct: 61  ALARGVDLKEMLAELFGKETGPCKGRGGSMHIGDKEKNFFGGNGIVGGQVPLAAGAALAL 120

Query: 160 KMDRKDACAVTYFGDGGTSE 179
           K   +D  AV +FGDG T+E
Sbjct: 121 KYRGEDRVAVCFFGDGATNE 140

PDC catalyzes the irreversible oxidative decarboxylation of pyruvate to produce acetyl-CoA in the bridging step between glycolysis and the citric acid cycle. ADC participates in the breakdown of acetoin while BCADC participates in the breakdown of branched chain amino acids. BCADC catalyzes the oxidative decarboxylation of 4-methyl-2-oxopentanoate, 3-methyl-2-oxopentanoate and 3-methyl-2-oxobutanoate (branched chain 2-oxo acids derived from the transamination of leucine, valine and isoleucine). Length = 293
>gnl|CDD|223997 COG1071, AcoA, Pyruvate/2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, eukaryotic type, alpha subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|213783 TIGR03181, PDH_E1_alph_x, pyruvate dehydrogenase E1 component, alpha subunit Back     alignment and domain information
>gnl|CDD|201386 pfam00676, E1_dh, Dehydrogenase E1 component Back     alignment and domain information
>gnl|CDD|234139 TIGR03182, PDH_E1_alph_y, pyruvate dehydrogenase E1 component, alpha subunit Back     alignment and domain information
>gnl|CDD|215213 PLN02374, PLN02374, pyruvate dehydrogenase (acetyl-transferring) Back     alignment and domain information
>gnl|CDD|177069 CHL00149, odpA, pyruvate dehydrogenase E1 component alpha subunit; Reviewed Back     alignment and domain information
>gnl|CDD|215152 PLN02269, PLN02269, Pyruvate dehydrogenase E1 component subunit alpha Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 199
COG1071 358 AcoA Pyruvate/2-oxoglutarate dehydrogenase complex 100.0
PLN02269 362 Pyruvate dehydrogenase E1 component subunit alpha 100.0
KOG1182 432 consensus Branched chain alpha-keto acid dehydroge 100.0
CHL00149 341 odpA pyruvate dehydrogenase E1 component alpha sub 100.0
TIGR03182 315 PDH_E1_alph_y pyruvate dehydrogenase E1 component, 100.0
PLN02374 433 pyruvate dehydrogenase (acetyl-transferring) 100.0
TIGR03181 341 PDH_E1_alph_x pyruvate dehydrogenase E1 component, 100.0
KOG0225 394 consensus Pyruvate dehydrogenase E1, alpha subunit 100.0
cd02000 293 TPP_E1_PDC_ADC_BCADC Thiamine pyrophosphate (TPP) 100.0
PF00676 300 E1_dh: Dehydrogenase E1 component; InterPro: IPR00 100.0
PRK09404 924 sucA 2-oxoglutarate dehydrogenase E1 component; Re 99.95
cd02016265 TPP_E1_OGDC_like Thiamine pyrophosphate (TPP) fami 99.92
PRK12315 581 1-deoxy-D-xylulose-5-phosphate synthase; Provision 99.87
TIGR00239 929 2oxo_dh_E1 2-oxoglutarate dehydrogenase, E1 compon 99.75
COG3959243 Transketolase, N-terminal subunit [Carbohydrate tr 99.58
cd02011 227 TPP_PK Thiamine pyrophosphate (TPP) family, Phosph 99.5
TIGR00232 653 tktlase_bact transketolase, bacterial and yeast. T 99.38
PRK12754 663 transketolase; Reviewed 99.37
cd02007195 TPP_DXS Thiamine pyrophosphate (TPP) family, DXS s 99.36
PLN02582 677 1-deoxy-D-xylulose-5-phosphate synthase 99.35
PRK12753 663 transketolase; Reviewed 99.35
TIGR00204 617 dxs 1-deoxy-D-xylulose-5-phosphate synthase. DXP s 99.34
PTZ00089 661 transketolase; Provisional 99.31
PRK11864 300 2-ketoisovalerate ferredoxin oxidoreductase subuni 99.31
PLN02790 654 transketolase 99.3
PRK05444 580 1-deoxy-D-xylulose-5-phosphate synthase; Provision 99.24
cd02012255 TPP_TK Thiamine pyrophosphate (TPP) family, Transk 99.23
PLN02234 641 1-deoxy-D-xylulose-5-phosphate synthase 99.19
PRK05899 624 transketolase; Reviewed 99.17
cd02017 386 TPP_E1_EcPDC_like Thiamine pyrophosphate (TPP) fam 99.16
PF00456 332 Transketolase_N: Transketolase, thiamine diphospha 99.12
TIGR00759 885 aceE pyruvate dehydrogenase E1 component, homodime 98.92
KOG0523 632 consensus Transketolase [Carbohydrate transport an 98.91
PRK12571 641 1-deoxy-D-xylulose-5-phosphate synthase; Provision 98.88
TIGR03186 889 AKGDH_not_PDH alpha-ketoglutarate dehydrogenase. S 98.88
PRK13012 896 2-oxoacid dehydrogenase subunit E1; Provisional 98.74
PRK09405 891 aceE pyruvate dehydrogenase subunit E1; Reviewed 98.58
PRK05261 785 putative phosphoketolase; Provisional 98.14
COG0021 663 TktA Transketolase [Carbohydrate transport and met 97.95
PF13292 270 DXP_synthase_N: 1-deoxy-D-xylulose-5-phosphate syn 97.91
PLN02225 701 1-deoxy-D-xylulose-5-phosphate synthase 97.84
COG1154 627 Dxs Deoxyxylulose-5-phosphate synthase [Coenzyme m 97.77
cd03372179 TPP_ComE Thiamine pyrophosphate (TPP) family, ComE 97.69
cd00568168 TPP_enzymes Thiamine pyrophosphate (TPP) enzyme fa 97.54
cd02002178 TPP_BFDC Thiamine pyrophosphate (TPP) family, BFDC 97.47
cd02004172 TPP_BZL_OCoD_HPCL Thiamine pyrophosphate (TPP) fam 97.25
cd02014178 TPP_POX Thiamine pyrophosphate (TPP) family, Pyruv 97.19
cd02001157 TPP_ComE_PpyrDC Thiamine pyrophosphate (TPP) famil 96.95
cd02015186 TPP_AHAS Thiamine pyrophosphate (TPP) family, Acet 96.92
cd02008178 TPP_IOR_alpha Thiamine pyrophosphate (TPP) family, 96.74
PRK07092530 benzoylformate decarboxylase; Reviewed 96.56
cd02005183 TPP_PDC_IPDC Thiamine pyrophosphate (TPP) family, 96.53
PRK06725570 acetolactate synthase 3 catalytic subunit; Validat 96.53
cd02013196 TPP_Xsc_like Thiamine pyrophosphate (TPP) family, 96.51
cd03375193 TPP_OGFOR Thiamine pyrophosphate (TPP family), 2-o 96.48
cd02010177 TPP_ALS Thiamine pyrophosphate (TPP) family, Aceto 96.47
cd02006202 TPP_Gcl Thiamine pyrophosphate (TPP) family, Gcl s 96.4
PRK06163202 hypothetical protein; Provisional 96.19
cd03371188 TPP_PpyrDC Thiamine pyrophosphate (TPP) family, Pp 96.19
TIGR03846181 sulfopy_beta sulfopyruvate decarboxylase, beta sub 96.09
PF02775153 TPP_enzyme_C: Thiamine pyrophosphate enzyme, C-ter 95.98
PRK07524535 hypothetical protein; Provisional 95.95
PRK07064544 hypothetical protein; Provisional 95.83
cd02018 237 TPP_PFOR Thiamine pyrophosphate (TPP family), Pyru 95.81
cd02003 205 TPP_IolD Thiamine pyrophosphate (TPP) family, IolD 95.81
PRK07586514 hypothetical protein; Validated 95.79
PRK11867 286 2-oxoglutarate ferredoxin oxidoreductase subunit b 95.65
PRK12474518 hypothetical protein; Provisional 95.54
PRK08155564 acetolactate synthase catalytic subunit; Validated 95.53
PRK08199557 thiamine pyrophosphate protein; Validated 95.53
PRK06546 578 pyruvate dehydrogenase; Provisional 95.53
cd03376 235 TPP_PFOR_porB_like Thiamine pyrophosphate (TPP fam 95.48
PRK09124 574 pyruvate dehydrogenase; Provisional 95.47
TIGR00118558 acolac_lg acetolactate synthase, large subunit, bi 95.41
cd02009175 TPP_SHCHC_synthase Thiamine pyrophosphate (TPP) fa 95.39
PRK05778 301 2-oxoglutarate ferredoxin oxidoreductase subunit b 95.36
PRK06154565 hypothetical protein; Provisional 95.33
PRK08527563 acetolactate synthase 3 catalytic subunit; Validat 95.27
PRK06112578 acetolactate synthase catalytic subunit; Validated 95.18
PRK08266542 hypothetical protein; Provisional 95.14
PRK06882574 acetolactate synthase 3 catalytic subunit; Validat 95.14
PRK05858542 hypothetical protein; Provisional 95.11
TIGR01504 588 glyox_carbo_lig glyoxylate carboligase. Glyoxylate 95.02
PRK11269 591 glyoxylate carboligase; Provisional 94.99
TIGR02177 287 PorB_KorB 2-oxoacid:acceptor oxidoreductase, beta 94.95
TIGR03457579 sulphoacet_xsc sulfoacetaldehyde acetyltransferase 94.9
PRK09259569 putative oxalyl-CoA decarboxylase; Validated 94.9
PLN02573578 pyruvate decarboxylase 94.83
PRK06466574 acetolactate synthase 3 catalytic subunit; Validat 94.82
PRK11869 280 2-oxoacid ferredoxin oxidoreductase subunit beta; 94.81
TIGR03254554 oxalate_oxc oxalyl-CoA decarboxylase. In a number 94.76
TIGR03297361 Ppyr-DeCO2ase phosphonopyruvate decarboxylase. Thi 94.75
PRK08979572 acetolactate synthase 3 catalytic subunit; Validat 94.72
CHL00099 585 ilvB acetohydroxyacid synthase large subunit 94.7
PRK09107 595 acetolactate synthase 3 catalytic subunit; Validat 94.69
PRK08327569 acetolactate synthase catalytic subunit; Validated 94.49
PRK06965587 acetolactate synthase 3 catalytic subunit; Validat 94.48
PRK07525588 sulfoacetaldehyde acetyltransferase; Validated 94.47
PRK11865 299 pyruvate ferredoxin oxidoreductase subunit beta; P 94.44
PRK07789 612 acetolactate synthase 1 catalytic subunit; Validat 94.42
TIGR02418539 acolac_catab acetolactate synthase, catabolic. Ace 94.42
TIGR03393539 indolpyr_decarb indolepyruvate decarboxylase, Erwi 94.41
PRK08273 597 thiamine pyrophosphate protein; Provisional 94.36
TIGR03336 595 IOR_alpha indolepyruvate ferredoxin oxidoreductase 94.3
PRK07710571 acetolactate synthase catalytic subunit; Reviewed 94.27
PRK11866 279 2-oxoacid ferredoxin oxidoreductase subunit beta; 94.16
PRK06276 586 acetolactate synthase catalytic subunit; Reviewed 94.11
PLN02470 585 acetolactate synthase 94.07
PRK07979574 acetolactate synthase 3 catalytic subunit; Validat 94.02
PRK06048561 acetolactate synthase 3 catalytic subunit; Reviewe 94.02
PRK07282566 acetolactate synthase catalytic subunit; Reviewed 93.99
PRK08978548 acetolactate synthase 2 catalytic subunit; Reviewe 93.88
PRK07418 616 acetolactate synthase 3 catalytic subunit; Reviewe 93.64
PRK08617552 acetolactate synthase; Reviewed 93.25
PRK08611 576 pyruvate oxidase; Provisional 93.18
PRK08322547 acetolactate synthase; Reviewed 92.88
COG0028550 IlvB Thiamine pyrophosphate-requiring enzymes [ace 92.71
PRK09628 277 oorB 2-oxoglutarate-acceptor oxidoreductase subuni 92.59
PRK07449568 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1 92.39
TIGR03394535 indol_phenyl_DC indolepyruvate/phenylpyruvate deca 92.26
PRK06456572 acetolactate synthase catalytic subunit; Reviewed 92.23
PRK06457549 pyruvate dehydrogenase; Provisional 92.14
TIGR02720 575 pyruv_oxi_spxB pyruvate oxidase. Members of this f 92.0
COG2609 887 AceE Pyruvate dehydrogenase complex, dehydrogenase 90.66
PRK12270 1228 kgd alpha-ketoglutarate decarboxylase; Reviewed 89.76
PF09364 379 XFP_N: XFP N-terminal domain; InterPro: IPR018970 89.72
COG0567 906 SucA 2-oxoglutarate dehydrogenase complex, dehydro 86.45
KOG0451 913 consensus Predicted 2-oxoglutarate dehydrogenase, 83.89
>COG1071 AcoA Pyruvate/2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, eukaryotic type, alpha subunit [Energy production and conversion] Back     alignment and domain information 
Probab=100.00  E-value=6.8e-58  Score=407.29  Aligned_cols=182  Identities=32%  Similarity=0.533  Sum_probs=174.0

Q ss_pred             CceeeeCCCCCCCCCCCCC--CCCHHHHHHHHHHHHHHHHHHHHHHHHHHcCCcc-cccCCCchhHHHHHHHhhccCC-C
Q 029082           13 PCYRVLDDDGQPFPDSSFV--KVSEGVAIKMYNDMVTLQTMDTIFYEAQRQGRIS-FYLTTSGEEAINIASAAAIKND-D   88 (199)
Q Consensus        13 ~~~~~l~~~G~~~~~~~~~--~~~~e~l~~lyr~M~~~R~~d~~~~~l~rqG~ig-~~~~~~GqEa~~vg~~~al~~~-D   88 (199)
                      +.+|+++++|+++.+....  .+++++++++||+|+++|.||+++.+++|||+++ |+|++.||||++||++.+|+++ |
T Consensus         2 ~~~~~~~~~g~~~~~~~~~~~~~~~~~l~~~y~~M~l~R~fd~k~~~l~r~G~i~gf~~~~~GqEA~~vg~~~aL~~~~D   81 (358)
T COG1071           2 SLIRVLDEDGRAVDELPGPNAALSKEELLELYRLMLLIRRFDEKMLQLQRQGKIGGFYHLYIGQEAVQVGAAAALRPGED   81 (358)
T ss_pred             CceeccCcccccccccccccccCCHHHHHHHHHHHHHHHHHHHHHHHHHhCCCcccCcCCcccHHHHHHHHHHhcCCCCC
Confidence            5789999999999885433  7899999999999999999999999999999996 9999999999999999999966 9


Q ss_pred             eeecCCCchHHHHhcCCCHHHHHHHhhcCCCCCCCCCCCCcccCCCCCccccccccccccchhhhHHHHHHHhCCCCC-E
Q 029082           89 FVVPQYREPGVLLWRGFSMQEFANQCFGNKADYGKGRQMPIHYGSNKHNYFTVSSTIATQLPHAVGAAYALKMDRKDA-C  167 (199)
Q Consensus        89 ~~~~~yR~~~~~l~rG~~~~~~l~e~~g~~~g~~~Gr~~~~H~~~~~~~~~~~~~~vG~q~~~A~G~A~A~k~~g~~~-v  167 (199)
                      |++|+||+|+++|++|+|+.++|++++|+++|+|+||++|+|+++++.|+++.+++||+|+|+|+|+|||.|+++++. |
T Consensus        82 ~i~~~YR~h~~~l~~G~~~~~~~a~~~G~~~g~~kGr~~~~h~~~~~~~~~~~~~iVg~Q~~~AaG~A~a~k~~~~~~~V  161 (358)
T COG1071          82 WIFPTYRDHGHLLARGVPLKEIMAELLGKATGPCKGRGGSMHYSDKEKGFLGGSGIVGTQIPLAAGAALALKYRGTKDGV  161 (358)
T ss_pred             EeecccCccccceecCCCHHHHHHHHhccccCCCCCCCCcccccccccccCCCCceecccccHHHHHHHHHHHhCCCCcE
Confidence            999999999999999999999999999999999999999999999999999999999999999999999999999666 9


Q ss_pred             EEEEeCCCccChhHHHHHHH----hccchhh
Q 029082          168 AVTYFGDGGTSEEVSFLFLI----HQLVIRE  194 (199)
Q Consensus       168 vv~~~GDGatseG~f~Eal~----~~lP~~~  194 (199)
                      ++||||||+||||+|||+||    |+||||-
T Consensus       162 a~~~~GDGat~qG~FhEalN~A~v~klPvvf  192 (358)
T COG1071         162 AVAFFGDGATNQGDFHEALNFAAVWKLPVVF  192 (358)
T ss_pred             EEEEecCCccccchHHHHHHHHHHhcCCEEE
Confidence            99999999999999999987    9999984

>PLN02269 Pyruvate dehydrogenase E1 component subunit alpha Back     alignment and domain information
>KOG1182 consensus Branched chain alpha-keto acid dehydrogenase complex, alpha subunit [Energy production and conversion] Back     alignment and domain information
>CHL00149 odpA pyruvate dehydrogenase E1 component alpha subunit; Reviewed Back     alignment and domain information
>TIGR03182 PDH_E1_alph_y pyruvate dehydrogenase E1 component, alpha subunit Back     alignment and domain information
>PLN02374 pyruvate dehydrogenase (acetyl-transferring) Back     alignment and domain information
>TIGR03181 PDH_E1_alph_x pyruvate dehydrogenase E1 component, alpha subunit Back     alignment and domain information
>KOG0225 consensus Pyruvate dehydrogenase E1, alpha subunit [Energy production and conversion] Back     alignment and domain information
>cd02000 TPP_E1_PDC_ADC_BCADC Thiamine pyrophosphate (TPP) family, E1 of PDC_ADC_BCADC subfamily, TPP-binding module; composed of proteins similar to the E1 components of the human pyruvate dehydrogenase complex (PDC), the acetoin dehydrogenase complex (ADC) and the branched chain alpha-keto acid dehydrogenase/2-oxoisovalerate dehydrogenase complex (BCADC) Back     alignment and domain information
>PF00676 E1_dh: Dehydrogenase E1 component; InterPro: IPR001017 This entry includes a number of dehydrogenases all of which use thiamine pyrophosphate as a cofactor and are members of a multienzyme complex Back     alignment and domain information
>PRK09404 sucA 2-oxoglutarate dehydrogenase E1 component; Reviewed Back     alignment and domain information
>cd02016 TPP_E1_OGDC_like Thiamine pyrophosphate (TPP) family, E1 of OGDC-like subfamily, TPP-binding module; composed of proteins similar to the E1 component of the 2-oxoglutarate dehydrogenase multienzyme complex (OGDC) Back     alignment and domain information
>PRK12315 1-deoxy-D-xylulose-5-phosphate synthase; Provisional Back     alignment and domain information
>TIGR00239 2oxo_dh_E1 2-oxoglutarate dehydrogenase, E1 component Back     alignment and domain information
>COG3959 Transketolase, N-terminal subunit [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd02011 TPP_PK Thiamine pyrophosphate (TPP) family, Phosphoketolase (PK) subfamily, TPP-binding module; PK catalyzes the conversion of D-xylulose 5-phosphate and phosphate to acetyl phosphate, D-glyceraldehyde-3-phosphate and H2O Back     alignment and domain information
>TIGR00232 tktlase_bact transketolase, bacterial and yeast Back     alignment and domain information
>PRK12754 transketolase; Reviewed Back     alignment and domain information
>cd02007 TPP_DXS Thiamine pyrophosphate (TPP) family, DXS subfamily, TPP-binding module; 1-Deoxy-D-xylulose-5-phosphate synthase (DXS) is a regulatory enzyme of the mevalonate-independent pathway involved in terpenoid biosynthesis Back     alignment and domain information
>PLN02582 1-deoxy-D-xylulose-5-phosphate synthase Back     alignment and domain information
>PRK12753 transketolase; Reviewed Back     alignment and domain information
>TIGR00204 dxs 1-deoxy-D-xylulose-5-phosphate synthase Back     alignment and domain information
>PTZ00089 transketolase; Provisional Back     alignment and domain information
>PRK11864 2-ketoisovalerate ferredoxin oxidoreductase subunit beta; Provisional Back     alignment and domain information
>PLN02790 transketolase Back     alignment and domain information
>PRK05444 1-deoxy-D-xylulose-5-phosphate synthase; Provisional Back     alignment and domain information
>cd02012 TPP_TK Thiamine pyrophosphate (TPP) family, Transketolase (TK) subfamily, TPP-binding module; TK catalyzes the transfer of a two-carbon unit from ketose phosphates to aldose phosphates Back     alignment and domain information
>PLN02234 1-deoxy-D-xylulose-5-phosphate synthase Back     alignment and domain information
>PRK05899 transketolase; Reviewed Back     alignment and domain information
>cd02017 TPP_E1_EcPDC_like Thiamine pyrophosphate (TPP) family, E1 of E Back     alignment and domain information
>PF00456 Transketolase_N: Transketolase, thiamine diphosphate binding domain; InterPro: IPR005474 Transketolase 2 Back     alignment and domain information
>TIGR00759 aceE pyruvate dehydrogenase E1 component, homodimeric type Back     alignment and domain information
>KOG0523 consensus Transketolase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK12571 1-deoxy-D-xylulose-5-phosphate synthase; Provisional Back     alignment and domain information
>TIGR03186 AKGDH_not_PDH alpha-ketoglutarate dehydrogenase Back     alignment and domain information
>PRK13012 2-oxoacid dehydrogenase subunit E1; Provisional Back     alignment and domain information
>PRK09405 aceE pyruvate dehydrogenase subunit E1; Reviewed Back     alignment and domain information
>PRK05261 putative phosphoketolase; Provisional Back     alignment and domain information
>COG0021 TktA Transketolase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF13292 DXP_synthase_N: 1-deoxy-D-xylulose-5-phosphate synthase; PDB: 2O1X_C 2O1S_B Back     alignment and domain information
>PLN02225 1-deoxy-D-xylulose-5-phosphate synthase Back     alignment and domain information
>COG1154 Dxs Deoxyxylulose-5-phosphate synthase [Coenzyme metabolism / Lipid metabolism] Back     alignment and domain information
>cd03372 TPP_ComE Thiamine pyrophosphate (TPP) family, ComE subfamily, TPP-binding module; composed of proteins similar to Methanococcus jannaschii sulfopyruvate decarboxylase beta subunit (ComE) Back     alignment and domain information
>cd00568 TPP_enzymes Thiamine pyrophosphate (TPP) enzyme family, TPP-binding module; found in many key metabolic enzymes which use TPP (also known as thiamine diphosphate) as a cofactor Back     alignment and domain information
>cd02002 TPP_BFDC Thiamine pyrophosphate (TPP) family, BFDC subfamily, TPP-binding module; composed of proteins similar to Pseudomonas putida benzoylformate decarboxylase (BFDC) Back     alignment and domain information
>cd02004 TPP_BZL_OCoD_HPCL Thiamine pyrophosphate (TPP) family, BZL_OCoD_HPCL subfamily, TPP-binding module; composed of proteins similar to benzaldehyde lyase (BZL), oxalyl-CoA decarboxylase (OCoD) and 2-hydroxyphytanoyl-CoA lyase (2-HPCL) Back     alignment and domain information
>cd02014 TPP_POX Thiamine pyrophosphate (TPP) family, Pyruvate oxidase (POX) subfamily, TPP-binding module; composed of proteins similar to Lactobacillus plantarum POX, which plays a key role in controlling acetate production under aerobic conditions Back     alignment and domain information
>cd02001 TPP_ComE_PpyrDC Thiamine pyrophosphate (TPP) family, ComE and PpyrDC subfamily, TPP-binding module; composed of proteins similar to sulfopyruvate decarboxylase beta subunit (ComE) and phosphonopyruvate decarboxylase (Ppyr decarboxylase) Back     alignment and domain information
>cd02015 TPP_AHAS Thiamine pyrophosphate (TPP) family, Acetohydroxyacid synthase (AHAS) subfamily, TPP-binding module; composed of proteins similar to the large catalytic subunit of AHAS Back     alignment and domain information
>cd02008 TPP_IOR_alpha Thiamine pyrophosphate (TPP) family, IOR-alpha subfamily, TPP-binding module; composed of proteins similar to indolepyruvate ferredoxin oxidoreductase (IOR) alpha subunit Back     alignment and domain information
>PRK07092 benzoylformate decarboxylase; Reviewed Back     alignment and domain information
>cd02005 TPP_PDC_IPDC Thiamine pyrophosphate (TPP) family, PDC_IPDC subfamily, TPP-binding module; composed of proteins similar to pyruvate decarboxylase (PDC) and indolepyruvate decarboxylase (IPDC) Back     alignment and domain information
>PRK06725 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>cd02013 TPP_Xsc_like Thiamine pyrophosphate (TPP) family, Xsc-like subfamily, TPP-binding module; composed of proteins similar to Alcaligenes defragrans sulfoacetaldehyde acetyltransferase (Xsc) Back     alignment and domain information
>cd03375 TPP_OGFOR Thiamine pyrophosphate (TPP family), 2-oxoglutarate ferredoxin oxidoreductase (OGFOR) subfamily, TPP-binding module; OGFOR catalyzes the oxidative decarboxylation of 2-oxo-acids, with ferredoxin acting as an electron acceptor Back     alignment and domain information
>cd02010 TPP_ALS Thiamine pyrophosphate (TPP) family, Acetolactate synthase (ALS) subfamily, TPP-binding module; composed of proteins similar to Klebsiella pneumoniae ALS, a catabolic enzyme required for butanediol fermentation Back     alignment and domain information
>cd02006 TPP_Gcl Thiamine pyrophosphate (TPP) family, Gcl subfamily, TPP-binding module; composed of proteins similar to Escherichia coli glyoxylate carboligase (Gcl) Back     alignment and domain information
>PRK06163 hypothetical protein; Provisional Back     alignment and domain information
>cd03371 TPP_PpyrDC Thiamine pyrophosphate (TPP) family, PpyrDC subfamily, TPP-binding module; composed of proteins similar to phosphonopyruvate decarboxylase (PpyrDC) proteins Back     alignment and domain information
>TIGR03846 sulfopy_beta sulfopyruvate decarboxylase, beta subunit Back     alignment and domain information
>PF02775 TPP_enzyme_C: Thiamine pyrophosphate enzyme, C-terminal TPP binding domain; InterPro: IPR011766 A number of enzymes require thiamine pyrophosphate (TPP) (vitamin B1) as a cofactor Back     alignment and domain information
>PRK07524 hypothetical protein; Provisional Back     alignment and domain information
>PRK07064 hypothetical protein; Provisional Back     alignment and domain information
>cd02018 TPP_PFOR Thiamine pyrophosphate (TPP family), Pyruvate ferredoxin/flavodoxin oxidoreductase (PFOR) subfamily, TPP-binding module; PFOR catalyzes the oxidative decarboxylation of pyruvate to form acetyl-CoA, a crucial step in many metabolic pathways Back     alignment and domain information
>cd02003 TPP_IolD Thiamine pyrophosphate (TPP) family, IolD subfamily, TPP-binding module; composed of proteins similar to Rhizobium leguminosarum bv Back     alignment and domain information
>PRK07586 hypothetical protein; Validated Back     alignment and domain information
>PRK11867 2-oxoglutarate ferredoxin oxidoreductase subunit beta; Reviewed Back     alignment and domain information
>PRK12474 hypothetical protein; Provisional Back     alignment and domain information
>PRK08155 acetolactate synthase catalytic subunit; Validated Back     alignment and domain information
>PRK08199 thiamine pyrophosphate protein; Validated Back     alignment and domain information
>PRK06546 pyruvate dehydrogenase; Provisional Back     alignment and domain information
>cd03376 TPP_PFOR_porB_like Thiamine pyrophosphate (TPP family), PFOR porB-like subfamily, TPP-binding module; composed of proteins similar to the beta subunit (porB) of the Helicobacter pylori four-subunit pyruvate ferredoxin oxidoreductase (PFOR), which are also found in archaea and some hyperthermophilic bacteria Back     alignment and domain information
>PRK09124 pyruvate dehydrogenase; Provisional Back     alignment and domain information
>TIGR00118 acolac_lg acetolactate synthase, large subunit, biosynthetic type Back     alignment and domain information
>cd02009 TPP_SHCHC_synthase Thiamine pyrophosphate (TPP) family, SHCHC synthase subfamily, TPP-binding module; composed of proteins similar to Escherichia coli 2-succinyl-6-hydroxyl-2,4-cyclohexadiene-1-carboxylic acid (SHCHC) synthase (also called MenD) Back     alignment and domain information
>PRK05778 2-oxoglutarate ferredoxin oxidoreductase subunit beta; Validated Back     alignment and domain information
>PRK06154 hypothetical protein; Provisional Back     alignment and domain information
>PRK08527 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK06112 acetolactate synthase catalytic subunit; Validated Back     alignment and domain information
>PRK08266 hypothetical protein; Provisional Back     alignment and domain information
>PRK06882 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK05858 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01504 glyox_carbo_lig glyoxylate carboligase Back     alignment and domain information
>PRK11269 glyoxylate carboligase; Provisional Back     alignment and domain information
>TIGR02177 PorB_KorB 2-oxoacid:acceptor oxidoreductase, beta subunit, pyruvate/2-ketoisovalerate family Back     alignment and domain information
>TIGR03457 sulphoacet_xsc sulfoacetaldehyde acetyltransferase Back     alignment and domain information
>PRK09259 putative oxalyl-CoA decarboxylase; Validated Back     alignment and domain information
>PLN02573 pyruvate decarboxylase Back     alignment and domain information
>PRK06466 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK11869 2-oxoacid ferredoxin oxidoreductase subunit beta; Provisional Back     alignment and domain information
>TIGR03254 oxalate_oxc oxalyl-CoA decarboxylase Back     alignment and domain information
>TIGR03297 Ppyr-DeCO2ase phosphonopyruvate decarboxylase Back     alignment and domain information
>PRK08979 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>CHL00099 ilvB acetohydroxyacid synthase large subunit Back     alignment and domain information
>PRK09107 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK08327 acetolactate synthase catalytic subunit; Validated Back     alignment and domain information
>PRK06965 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK07525 sulfoacetaldehyde acetyltransferase; Validated Back     alignment and domain information
>PRK11865 pyruvate ferredoxin oxidoreductase subunit beta; Provisional Back     alignment and domain information
>PRK07789 acetolactate synthase 1 catalytic subunit; Validated Back     alignment and domain information
>TIGR02418 acolac_catab acetolactate synthase, catabolic Back     alignment and domain information
>TIGR03393 indolpyr_decarb indolepyruvate decarboxylase, Erwinia family Back     alignment and domain information
>PRK08273 thiamine pyrophosphate protein; Provisional Back     alignment and domain information
>TIGR03336 IOR_alpha indolepyruvate ferredoxin oxidoreductase, alpha subunit Back     alignment and domain information
>PRK07710 acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>PRK11866 2-oxoacid ferredoxin oxidoreductase subunit beta; Provisional Back     alignment and domain information
>PRK06276 acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>PLN02470 acetolactate synthase Back     alignment and domain information
>PRK07979 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK06048 acetolactate synthase 3 catalytic subunit; Reviewed Back     alignment and domain information
>PRK07282 acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>PRK08978 acetolactate synthase 2 catalytic subunit; Reviewed Back     alignment and domain information
>PRK07418 acetolactate synthase 3 catalytic subunit; Reviewed Back     alignment and domain information
>PRK08617 acetolactate synthase; Reviewed Back     alignment and domain information
>PRK08611 pyruvate oxidase; Provisional Back     alignment and domain information
>PRK08322 acetolactate synthase; Reviewed Back     alignment and domain information
>COG0028 IlvB Thiamine pyrophosphate-requiring enzymes [acetolactate synthase, pyruvate dehydrogenase (cytochrome), glyoxylate carboligase, phosphonopyruvate decarboxylase] [Amino acid transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>PRK09628 oorB 2-oxoglutarate-acceptor oxidoreductase subunit OorB; Reviewed Back     alignment and domain information
>PRK07449 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase; Validated Back     alignment and domain information
>TIGR03394 indol_phenyl_DC indolepyruvate/phenylpyruvate decarboxylase, Azospirillum family Back     alignment and domain information
>PRK06456 acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>PRK06457 pyruvate dehydrogenase; Provisional Back     alignment and domain information
>TIGR02720 pyruv_oxi_spxB pyruvate oxidase Back     alignment and domain information
>COG2609 AceE Pyruvate dehydrogenase complex, dehydrogenase (E1) component [Energy production and conversion] Back     alignment and domain information
>PRK12270 kgd alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>PF09364 XFP_N: XFP N-terminal domain; InterPro: IPR018970 Phosphoketolases (PK) are key enzymes of the pentose phosphate pathway of heterofermentative and facultative homofermentative lactic acid bacteria and of the D-fructose 6-phosphate shunt of bifidobacteria Back     alignment and domain information
>COG0567 SucA 2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>KOG0451 consensus Predicted 2-oxoglutarate dehydrogenase, E1 subunit [Carbohydrate transport and metabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query199
1v1m_A 400 Crosstalk Between Cofactor Binding And The Phosphor 2e-39
1v11_A 400 Crosstalk Between Cofactor Binding And The Phosphor 2e-39
1x80_A 400 Crystal Structure Of The Human Mitochondrial Branch 2e-39
1dtw_A 400 Human Branched-Chain Alpha-Keto Acid Dehydrogenase 2e-39
1x7w_A 400 Crystal Structure Of The Human Mitochondrial Branch 2e-39
1olu_A 400 Roles Of His291-Alpha And His146-Beta' In The Reduc 2e-39
1v16_A 400 Crosstalk Between Cofactor Binding And The Phosphor 2e-39
2bff_A 400 Reactivity Modulation Of Human Branched-Chain Alpha 2e-39
1x7y_A 400 Crystal Structure Of The Human Mitochondrial Branch 2e-39
2j9f_A 400 Human Branched-Chain Alpha-Ketoacid Dehydrogenase- 2e-39
1x7z_A 400 Crystal Structure Of The Human Mitochondrial Branch 2e-39
1x7x_A 400 Crystal Structure Of The Human Mitochondrial Branch 2e-39
2bfc_A 400 Reactivity Modulation Of Human Branched-Chain Alpha 6e-39
2bfb_A 400 Reactivity Modulation Of Human Branched-Chain Alpha 1e-38
2bfd_A 400 Reactivity Modulation Of Human Branched-Chain Alpha 2e-38
2bfe_A 400 Reactivity Modulation Of Human Branched-Chain Alpha 9e-38
1um9_A 367 Branched-chain 2-oxo Acid Dehydrogenase (e1) From T 5e-23
2bp7_A 410 New Crystal Form Of The Pseudomonas Putida Branched 4e-18
1qs0_A 407 Crystal Structure Of Pseudomonas Putida 2-Oxoisoval 8e-16
1w88_A 368 The Crystal Structure Of Pyruvate Dehydrogenase E1( 1e-14
1w85_A 368 The Crystal Structure Of Pyruvate Dehydrogenase E1 1e-14
3duf_A 369 Snapshots Of Catalysis In The E1 Subunit Of The Pyr 1e-14
3dva_A 369 Snapshots Of Catalysis In The E1 Subunit Of The Pyr 1e-14
3exe_A 382 Crystal Structure Of The Pyruvate Dehydrogenase (E1 2e-04
3exh_C 382 Crystal Structure Of The Pyruvate Dehydrogenase (E1 2e-04
3exf_A 382 Crystal Structure Of The Pyruvate Dehydrogenase (E1 3e-04
2ozl_A 365 Human Pyruvate Dehydrogenase S264e Variant Length = 3e-04
3exi_A 382 Crystal Structure Of The Pyruvate Dehydrogenase (E1 7e-04
>pdb|1V1M|A Chain A, Crosstalk Between Cofactor Binding And The Phosphorylation Loop Conformation In The Bckd Machine Length = 400 Back     alignment and structure 
Iteration: 1

 Score =  158 bits (399), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 82/179 (45%), Positives = 108/179 (60%)
Query: 1   MRFISESSEERIPCYRVLDDDGQPFPDSSFVKVSEGVAIKMYNDMVTLQTMDTIFYEAQR 60
           + FI  +    IP YRV+D  GQ    S    + +   +K+Y  M  L TMD I YE+QR
Sbjct: 20  LEFIQPNVISGIPIYRVMDRQGQIINPSEDPHLPKEKVLKLYKSMTLLNTMDRILYESQR 79
Query: 61  QGRISFYLTTSGEEXXXXXXXXXXKNDDFVVPQYREPGVLLWRGFSMQEFANQCFGNKAD 120
           QGRISFY+T  GEE           N D V  QYRE GVL++R + ++ F  QC+GN +D
Sbjct: 80  QGRISFYMTNYGEEGTHVGSAAALDNTDLVFGQYREAGVLMYRDYPLELFMAQCYGNISD 139
Query: 121 YGKGRQMPIHYGSNKHNYFTVSSTIATQLPHAVGAAYALKMDRKDACAVTYFGDGGTSE 179
            GKGRQMP+HYG  + ++ T+SS +ATQ+P AVGAAYA K    +   + YFG+G  SE
Sbjct: 140 LGKGRQMPVHYGCKERHFVTISSPLATQIPQAVGAAYAAKRANANRVVICYFGEGAASE 198
>pdb|1V11|A Chain A, Crosstalk Between Cofactor Binding And The Phosphorylation Loop Conformation In The Bckd Machine Length = 400 Back     alignment and structure
>pdb|1X80|A Chain A, Crystal Structure Of The Human Mitochondrial Branched-chain Alpha- Ketoacid Dehydrogenase Length = 400 Back     alignment and structure
>pdb|1DTW|A Chain A, Human Branched-Chain Alpha-Keto Acid Dehydrogenase Length = 400 Back     alignment and structure
>pdb|1X7W|A Chain A, Crystal Structure Of The Human Mitochondrial Branched-Chain Alpha- Ketoacid Dehydrogenase Length = 400 Back     alignment and structure
>pdb|1OLU|A Chain A, Roles Of His291-Alpha And His146-Beta' In The Reductive Acylation Reaction Catalyzed By Human Branched-Chain Alpha-Ketoacid Dehydrogenase Length = 400 Back     alignment and structure
>pdb|1V16|A Chain A, Crosstalk Between Cofactor Binding And The Phosphorylation Loop Conformation In The Bckd Machine Length = 400 Back     alignment and structure
>pdb|2BFF|A Chain A, Reactivity Modulation Of Human Branched-Chain Alpha- Ketoacid Dehydrogenase By An Internal Molecular Switch Length = 400 Back     alignment and structure
>pdb|1X7Y|A Chain A, Crystal Structure Of The Human Mitochondrial Branched-chain Alpha- Ketoacid Dehydrogenase Length = 400 Back     alignment and structure
>pdb|2J9F|A Chain A, Human Branched-Chain Alpha-Ketoacid Dehydrogenase- Decarboxylase E1b Length = 400 Back     alignment and structure
>pdb|1X7Z|A Chain A, Crystal Structure Of The Human Mitochondrial Branched-Chain Alpha- Ketoacid Dehydrogenase Length = 400 Back     alignment and structure
>pdb|1X7X|A Chain A, Crystal Structure Of The Human Mitochondrial Branched-Chain Alpha- Ketoacid Dehydrogenase Length = 400 Back     alignment and structure
>pdb|2BFC|A Chain A, Reactivity Modulation Of Human Branched-Chain Alpha- Ketoacid Dehydrogenase By An Internal Molecular Switch Length = 400 Back     alignment and structure
>pdb|2BFB|A Chain A, Reactivity Modulation Of Human Branched-Chain Alpha- Ketoacid Dehydrogenase By An Internal Molecular Switch Length = 400 Back     alignment and structure
>pdb|2BFD|A Chain A, Reactivity Modulation Of Human Branched-Chain Alpha- Ketoacid Dehydrogenase By An Internal Molecular Switch Length = 400 Back     alignment and structure
>pdb|2BFE|A Chain A, Reactivity Modulation Of Human Branched-Chain Alpha- Ketoacid Dehydrogenase By An Internal Molecular Switch Length = 400 Back     alignment and structure
>pdb|1UM9|A Chain A, Branched-chain 2-oxo Acid Dehydrogenase (e1) From Thermus Thermophilus Hb8 In Apo-form Length = 367 Back     alignment and structure
>pdb|2BP7|A Chain A, New Crystal Form Of The Pseudomonas Putida Branched-Chain Dehydrogenase (E1) Length = 410 Back     alignment and structure
>pdb|1QS0|A Chain A, Crystal Structure Of Pseudomonas Putida 2-Oxoisovalerate Dehydrogenase (Branched-Chain Alpha-Keto Acid Dehydrogenase, E1b) Length = 407 Back     alignment and structure
>pdb|1W88|A Chain A, The Crystal Structure Of Pyruvate Dehydrogenase E1(D180n, E183q) Bound To The Peripheral Subunit Binding Domain Of E2 Length = 368 Back     alignment and structure
>pdb|1W85|A Chain A, The Crystal Structure Of Pyruvate Dehydrogenase E1 Bound To The Peripheral Subunit Binding Domain Of E2 Length = 368 Back     alignment and structure
>pdb|3DUF|A Chain A, Snapshots Of Catalysis In The E1 Subunit Of The Pyruvate Dehydrogenase Multi-Enzyme Complex Length = 369 Back     alignment and structure
>pdb|3DVA|A Chain A, Snapshots Of Catalysis In The E1 Subunit Of The Pyruvate Dehydrogenase Multi-Enzyme Complex Length = 369 Back     alignment and structure
>pdb|3EXE|A Chain A, Crystal Structure Of The Pyruvate Dehydrogenase (E1p) Component Of Human Pyruvate Dehydrogenase Complex Length = 382 Back     alignment and structure
>pdb|3EXH|C Chain C, Crystal Structure Of The Pyruvate Dehydrogenase (E1p) Component Of Human Pyruvate Dehydrogenase Complex Length = 382 Back     alignment and structure
>pdb|3EXF|A Chain A, Crystal Structure Of The Pyruvate Dehydrogenase (E1p) Component Of Human Pyruvate Dehydrogenase Complex Length = 382 Back     alignment and structure
>pdb|2OZL|A Chain A, Human Pyruvate Dehydrogenase S264e Variant Length = 365 Back     alignment and structure
>pdb|3EXI|A Chain A, Crystal Structure Of The Pyruvate Dehydrogenase (E1p) Component Of Human Pyruvate Dehydrogenase Complex With The Subunit-Binding Domain (Sbd) Of E2p, But Sbd Cannot Be Modeled Into The Electron Density Length = 382 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query199
2bfd_A 400 2-oxoisovalerate dehydrogenase alpha subunit; oxid 4e-87
1qs0_A 407 2-oxoisovalerate dehydrogenase alpha-subunit; hete 3e-81
1umd_A 367 E1-alpha, 2-OXO acid dehydrogenase alpha subunit; 4e-78
1w85_A 368 Pyruvate dehydrogenase E1 component, alpha subunit 2e-74
2ozl_A 365 PDHE1-A type I, pyruvate dehydrogenase E1 componen 1e-17
>2bfd_A 2-oxoisovalerate dehydrogenase alpha subunit; oxidoreductase, multi-enzyme complex, acylation, oxidative decarboxylation, maple syrup urine disease; HET: TDP; 1.39A {Homo sapiens} SCOP: c.36.1.11 PDB: 1v16_A* 2bfc_A* 1v1r_A* 1olu_A* 2bfb_A* 1v1m_A* 2bew_A* 1dtw_A* 1olx_A* 1ols_A* 1wci_A* 1x80_A* 2beu_A* 1u5b_A* 2bev_A* 1v11_A* 1x7x_A* 1x7y_A* 1x7w_A* 1x7z_A* ... Length = 400 Back     alignment and structure
 Score =  261 bits (668), Expect = 4e-87
 Identities = 85/179 (47%), Positives = 114/179 (63%)

Query: 1   MRFISESSEERIPCYRVLDDDGQPFPDSSFVKVSEGVAIKMYNDMVTLQTMDTIFYEAQR 60
           + FI  +    IP YRV+D  GQ    S    + +   +K+Y  M  L TMD I YE+QR
Sbjct: 20  LEFIQPNVISGIPIYRVMDRQGQIINPSEDPHLPKEKVLKLYKSMTLLNTMDRILYESQR 79

Query: 61  QGRISFYLTTSGEEAINIASAAAIKNDDFVVPQYREPGVLLWRGFSMQEFANQCFGNKAD 120
           QGRISFY+T  GEE  ++ SAAA+ N D V  Q RE GVL++R + ++ F  QC+GN +D
Sbjct: 80  QGRISFYMTNYGEEGTHVGSAAALDNTDLVFGQAREAGVLMYRDYPLELFMAQCYGNISD 139

Query: 121 YGKGRQMPIHYGSNKHNYFTVSSTIATQLPHAVGAAYALKMDRKDACAVTYFGDGGTSE 179
            GKGRQMP+HYG  + ++ T+SS +ATQ+P AVGAAYA K    +   + YFG+G  SE
Sbjct: 140 LGKGRQMPVHYGCKERHFVTISSPLATQIPQAVGAAYAAKRANANRVVICYFGEGAASE 198
>1qs0_A 2-oxoisovalerate dehydrogenase alpha-subunit; heterotetramer, THDP cofactor, oxidoreductase; HET: TDP; 2.40A {Pseudomonas putida} SCOP: c.36.1.11 PDB: 2bp7_A Length = 407 Back     alignment and structure
>1umd_A E1-alpha, 2-OXO acid dehydrogenase alpha subunit; alpha(2)beta(2) tetramer, structural genomics; HET: TDP; 1.90A {Thermus thermophilus} SCOP: c.36.1.11 PDB: 1um9_A* 1umc_A* 1umb_A* Length = 367 Back     alignment and structure
>1w85_A Pyruvate dehydrogenase E1 component, alpha subunit; dehydrogenase, multienzyme complex, oxidoreductase; HET: TDP; 2.0A {Geobacillus stearothermophilus} SCOP: c.36.1.11 PDB: 3duf_A* 3dv0_A* 3dva_A* 1w88_A* Length = 368 Back     alignment and structure
>2ozl_A PDHE1-A type I, pyruvate dehydrogenase E1 component alpha subunit, somatic form; pyruvate_dehydrogenase_complex, human, multienzyme_complex_component; HET: TPP; 1.90A {Homo sapiens} SCOP: c.36.1.11 PDB: 1ni4_A* 3exe_A* 3exi_A 3exh_A* 3exg_A 3exf_A* Length = 365 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query199
2bfd_A 400 2-oxoisovalerate dehydrogenase alpha subunit; oxid 100.0
1qs0_A 407 2-oxoisovalerate dehydrogenase alpha-subunit; hete 100.0
2ozl_A 365 PDHE1-A type I, pyruvate dehydrogenase E1 componen 100.0
1w85_A 368 Pyruvate dehydrogenase E1 component, alpha subunit 100.0
1umd_A 367 E1-alpha, 2-OXO acid dehydrogenase alpha subunit; 100.0
2jgd_A 933 2-oxoglutarate dehydrogenase E1 component; flavopr 99.97
2yic_A 868 2-oxoglutarate decarboxylase; lyase; HET: TPP; 1.9 99.96
2xt6_A 1113 2-oxoglutarate decarboxylase; lyase, KDH, KGD; HET 99.96
2o1s_A 621 1-deoxy-D-xylulose-5-phosphate synthase; DXS, thia 99.77
2o1x_A 629 1-deoxy-D-xylulose-5-phosphate synthase; thiamin, 99.68
3rim_A 700 Transketolase, TK; TPP, transferase; HET: TPP; 2.4 99.26
3mos_A 616 Transketolase, TK; thiamin diphosphate TPP THDP en 99.24
1r9j_A 673 Transketolase; domains, EACH of the alpha/beta typ 99.21
1itz_A 675 Transketolase; calvin cycle, cofactor, thiamine py 99.15
3kom_A 663 Transketolase; rossmann fold, csgid, transferase, 99.14
1gpu_A 680 Transketolase; transferase(ketone residues); HET: 99.14
3uk1_A 711 Transketolase; structural genomics, seattle struct 99.11
2qtc_A 886 Pyruvate dehydrogenase E1 component; thiamin dipho 99.1
2r8o_A 669 Transketolase 1, TK 1; reaction intermediate, calc 99.08
3l84_A 632 Transketolase; TKT, structural genomics, center fo 99.07
2e6k_A 651 Transketolase; structural genomics, NPPSFA, nation 99.05
3m49_A 690 Transketolase; alpha-beta-alpha sandwich, csgid, t 99.02
3ahc_A 845 Phosphoketolase, xylulose 5-phosphate/fructose 6-p 97.37
2vk8_A563 Pyruvate decarboxylase isozyme 1; asymmetric activ 97.26
2uz1_A563 Benzaldehyde lyase; thiamine diphosphate, thiamine 96.75
4feg_A 603 Pyruvate oxidase; carbanion, structure activity re 96.66
1ovm_A552 Indole-3-pyruvate decarboxylase; thiamine diphosph 96.51
1q6z_A528 BFD, BFDC, benzoylformate decarboxylase; lyase, ca 96.49
1ozh_A566 ALS, acetolactate synthase, catabolic; acetohydrox 96.16
1v5e_A 590 Pyruvate oxidase; oxidoreductase, flavoprotein; HE 96.1
2pan_A 616 Glyoxylate carboligase; thiamin-diphosphate (THDP) 96.09
2vbf_A570 Branched-chain alpha-ketoacid decarboxylase; KDCA, 96.08
1ybh_A 590 Acetolactate synthase, chloroplast; acetohydroxyac 96.07
2wvg_A 568 PDC, pyruvate decarboxylase; thiamine diphosphate, 95.86
1t9b_A 677 Acetolactate synthase, mitochondrial; acetohydroxy 95.85
2iht_A573 Carboxyethylarginine synthase; thiamin diphosphate 95.8
2q28_A564 Oxalyl-COA decarboxylase; lyase, oxalate degradati 95.78
2vbi_A 566 Pyruvate decarboxylase; thiamine pyrophosphate, ly 95.71
2c31_A568 Oxalyl-COA decarboxylase; oxalate, thiamin diphosp 95.7
3eya_A549 Pyruvate dehydrogenase [cytochrome]; pyruvate oxid 95.67
2pgn_A 589 Cyclohexane-1,2-dione hydrolase (CDH); three alpha 95.62
2nxw_A565 Phenyl-3-pyruvate decarboxylase; thiamine pyrophos 95.52
3hww_A556 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- 95.43
2x7j_A604 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene - 94.65
3lq1_A578 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- 91.18
>2bfd_A 2-oxoisovalerate dehydrogenase alpha subunit; oxidoreductase, multi-enzyme complex, acylation, oxidative decarboxylation, maple syrup urine disease; HET: TDP; 1.39A {Homo sapiens} SCOP: c.36.1.11 PDB: 1v16_A* 2bfc_A* 1v1r_A* 1olu_A* 2bfb_A* 1v1m_A* 2bew_A* 1dtw_A* 1olx_A* 1ols_A* 1wci_A* 1x80_A* 2beu_A* 1u5b_A* 2bev_A* 1v11_A* 1x7x_A* 1x7y_A* 1x7w_A* 1x7z_A* ... Back     alignment and structure
Probab=100.00  E-value=3.2e-47  Score=344.00  Aligned_cols=195  Identities=44%  Similarity=0.735  Sum_probs=186.2

Q ss_pred             CccccCCCCCCCCceeeeCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHcCCcccccCCCchhHHHHHH
Q 029082            1 MRFISESSEERIPCYRVLDDDGQPFPDSSFVKVSEGVAIKMYNDMVTLQTMDTIFYEAQRQGRISFYLTTSGEEAINIAS   80 (199)
Q Consensus         1 ~~~~~~~~~~~~~~~~~l~~~G~~~~~~~~~~~~~e~l~~lyr~M~~~R~~d~~~~~l~rqG~ig~~~~~~GqEa~~vg~   80 (199)
                      |+|++++....+|++||||+||+++++...+++++|+++++||.|+++|.||+++.++++||+++|++++.||||++||+
T Consensus        20 ~~~~~~~~~~~~~~~~~l~~~g~~~~~~~~~~~~~e~~~~~y~~M~~~r~fe~~~~~~~~~gri~~~~~~~GqEa~~vg~   99 (400)
T 2bfd_A           20 LEFIQPNVISGIPIYRVMDRQGQIINPSEDPHLPKEKVLKLYKSMTLLNTMDRILYESQRQGRISFYMTNYGEEGTHVGS   99 (400)
T ss_dssp             CCCCCCCCSSCSCEECSBCTTSCBSCGGGCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHTTSSSCCCCCTTCHHHHHHH
T ss_pred             eeeccCcccCCCCeeEEECCCCCCCCccccCCCCHHHHHHHHHHHHHHHHHHHHHHHHHhcCCcceeecCCChHHHHHHH
Confidence            68999887788999999999999998765688999999999999999999999999999999999999999999999999


Q ss_pred             HhhccCCCeeecCCCchHHHHhcCCCHHHHHHHhhcCCCCCCCCCCCCcccCCCCCccccccccccccchhhhHHHHHHH
Q 029082           81 AAAIKNDDFVVPQYREPGVLLWRGFSMQEFANQCFGNKADYGKGRQMPIHYGSNKHNYFTVSSTIATQLPHAVGAAYALK  160 (199)
Q Consensus        81 ~~al~~~D~~~~~yR~~~~~l~rG~~~~~~l~e~~g~~~g~~~Gr~~~~H~~~~~~~~~~~~~~vG~q~~~A~G~A~A~k  160 (199)
                      +.+|+++||++++||+|++++.+|+++.++|++++|+.+|+++|+++++|+++++.++++.++++|.++|+|+|+|+|.+
T Consensus       100 ~~al~~~D~v~~~yR~~~~~~~~G~~~~~~l~e~~g~~~g~~~G~~~~~H~~~~~~~~~~~~g~lG~~lp~AvG~AlA~~  179 (400)
T 2bfd_A          100 AAALDNTDLVFGQAREAGVLMYRDYPLELFMAQCYGNISDLGKGRQMPVHYGCKERHFVTISSPLATQIPQAVGAAYAAK  179 (400)
T ss_dssp             HHTSCTTSEEECCSCCHHHHHHTTCCHHHHHHHHHTCTTCTTTTCSCSSCCCBTTTTBCCCCSSTTTHHHHHHHHHHHHH
T ss_pred             HHhcCCCCEEEecCcCHHHHHHcCCCHHHHHHHhcCCCCCCCCCCCCCcCCcccccCccccCccccccccHHHHHHHhhh
Confidence            99999999999999999999999999999999999999999999999999998889999999999999999999999999


Q ss_pred             hCCCCCEEEEEeCCCccChhHHHHHHH----hccchhhh
Q 029082          161 MDRKDACAVTYFGDGGTSEEVSFLFLI----HQLVIREI  195 (199)
Q Consensus       161 ~~g~~~vvv~~~GDGatseG~f~Eal~----~~lP~~~~  195 (199)
                      +++++.+++|++|||++++|.|||+++    |+||++-+
T Consensus       180 ~~~~~~~vv~~~GDGa~~~G~~~Eal~~A~~~~lpvi~v  218 (400)
T 2bfd_A          180 RANANRVVICYFGEGAASEGDAHAGFNFAATLECPIIFF  218 (400)
T ss_dssp             HHTCCCCEEEEEETTGGGSHHHHHHHHHHHHTTCCEEEE
T ss_pred             hhCCCCeEEEEECchhhhcChHHHHHHHHHHHCcCEEEE
Confidence            999999999999999999999999985    89997654
>1qs0_A 2-oxoisovalerate dehydrogenase alpha-subunit; heterotetramer, THDP cofactor, oxidoreductase; HET: TDP; 2.40A {Pseudomonas putida} SCOP: c.36.1.11 PDB: 2bp7_A Back     alignment and structure
>2ozl_A PDHE1-A type I, pyruvate dehydrogenase E1 component alpha subunit, somatic form; pyruvate_dehydrogenase_complex, human, multienzyme_complex_component; HET: TPP; 1.90A {Homo sapiens} SCOP: c.36.1.11 PDB: 1ni4_A* 3exe_A* 3exi_A 3exh_A* 3exg_A 3exf_A* Back     alignment and structure
>1w85_A Pyruvate dehydrogenase E1 component, alpha subunit; dehydrogenase, multienzyme complex, oxidoreductase; HET: TDP; 2.0A {Geobacillus stearothermophilus} SCOP: c.36.1.11 PDB: 3duf_A* 3dv0_A* 3dva_A* 1w88_A* Back     alignment and structure
>1umd_A E1-alpha, 2-OXO acid dehydrogenase alpha subunit; alpha(2)beta(2) tetramer, structural genomics; HET: TDP; 1.90A {Thermus thermophilus} SCOP: c.36.1.11 PDB: 1um9_A* 1umc_A* 1umb_A* Back     alignment and structure
>2jgd_A 2-oxoglutarate dehydrogenase E1 component; flavoprotein, oxidoreductase, thiamine diphosphate, thiamine pyrophosphate, adenosine monophosphate; HET: AMP; 2.6A {Escherichia coli} PDB: 2jgd_B* Back     alignment and structure
>2yic_A 2-oxoglutarate decarboxylase; lyase; HET: TPP; 1.96A {Mycobacterium smegmatis} PDB: 2xta_A* 2y0p_A* 2xt9_A* 2yid_A* Back     alignment and structure
>2xt6_A 2-oxoglutarate decarboxylase; lyase, KDH, KGD; HET: TPP; 2.74A {Mycobacterium smegmatis} Back     alignment and structure
>2o1s_A 1-deoxy-D-xylulose-5-phosphate synthase; DXS, thiamine, isoprenoid, transferase; HET: TDP; 2.40A {Escherichia coli} Back     alignment and structure
>2o1x_A 1-deoxy-D-xylulose-5-phosphate synthase; thiamin, isoprenoid, DXS, transferase; HET: TDP; 2.90A {Deinococcus radiodurans} Back     alignment and structure
>3rim_A Transketolase, TK; TPP, transferase; HET: TPP; 2.49A {Mycobacterium tuberculosis} Back     alignment and structure
>3mos_A Transketolase, TK; thiamin diphosphate TPP THDP enzyme catalysis sugar metaboli transferase; HET: TPP; 1.75A {Homo sapiens} PDB: 3ooy_A* Back     alignment and structure
>1r9j_A Transketolase; domains, EACH of the alpha/beta type, thiamine diphosphate binding domain, transferase; HET: TPP; 2.22A {Leishmania mexicana mexicana} SCOP: c.36.1.6 c.36.1.10 c.48.1.1 Back     alignment and structure
>1itz_A Transketolase; calvin cycle, cofactor, thiamine pyrophosphate, plant, transferase; HET: TPP; 2.30A {Zea mays} SCOP: c.36.1.6 c.36.1.10 c.48.1.1 Back     alignment and structure
>3kom_A Transketolase; rossmann fold, csgid, transferase, structural genomics, center for structural genomics of infectious DISE; HET: MSE; 1.60A {Francisella tularensis subsp} Back     alignment and structure
>1gpu_A Transketolase; transferase(ketone residues); HET: THD; 1.86A {Saccharomyces cerevisiae} SCOP: c.36.1.6 c.36.1.10 c.48.1.1 PDB: 1ngs_A* 1trk_A* 1ay0_A* 1tkb_A* 1tka_A* 1tkc_A* Back     alignment and structure
>3uk1_A Transketolase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, thiamine pyrophosphate; 2.15A {Burkholderia thailandensis} PDB: 3upt_A* Back     alignment and structure
>2qtc_A Pyruvate dehydrogenase E1 component; thiamin diphosphate, glycolysis, MAG metal-binding, oxidoreductase, thiamine pyrophosphate; HET: TDK; 1.77A {Escherichia coli} SCOP: c.36.1.6 c.36.1.10 c.48.1.1 PDB: 2qta_A* 1l8a_A* 1rp7_A* 2g25_A* 2g28_A* 2g67_A 2iea_A* 3lpl_A* 3lq2_A* 3lq4_A* Back     alignment and structure
>2r8o_A Transketolase 1, TK 1; reaction intermediate, calcium, metal-binding, thiamine pyrophosphate, transferase; HET: T5X; 1.47A {Escherichia coli K12} SCOP: c.36.1.6 c.36.1.10 c.48.1.1 PDB: 2r5n_A* 2r8p_A* 1qgd_A* Back     alignment and structure
>3l84_A Transketolase; TKT, structural genomics, center for structur genomics of infectious diseases, csgid, transferase; HET: MSE; 1.36A {Campylobacter jejuni} PDB: 3m6l_A* 3m34_A* 3m7i_A* Back     alignment and structure
>2e6k_A Transketolase; structural genomics, NPPSFA, national project protein structural and functional analyses; 2.09A {Thermus thermophilus} Back     alignment and structure
>3m49_A Transketolase; alpha-beta-alpha sandwich, csgid, transferase, structural genomics, center for structural genomics of infectious diseases; HET: MSE TDP PG5 TRS BTB; 2.00A {Bacillus anthracis} PDB: 3hyl_A* Back     alignment and structure
>3ahc_A Phosphoketolase, xylulose 5-phosphate/fructose 6-phosphate phospho; thiamine diphosphate-dependent enzyme, alpha-beta fold; HET: TPP 2PE; 1.70A {Bifidobacterium breve} PDB: 3ahd_A* 3ahe_A* 3ahf_A* 3ahj_A* 3ahi_A* 3ahh_A* 3ahg_A* 3ai7_A* Back     alignment and structure
>2vk8_A Pyruvate decarboxylase isozyme 1; asymmetric active sites, phenylalanine catabolism, tryptophan catabolism, thiamine pyrophosphate; HET: TPP; 1.42A {Saccharomyces cerevisiae} PDB: 1qpb_A* 2vk1_A* 2w93_A* 1pyd_A* 1pvd_A* 2vk4_A* 2vjy_A* 2g1i_A* Back     alignment and structure
>2uz1_A Benzaldehyde lyase; thiamine diphosphate, thiamine pyrophosphate, benzoin, flavoprotein; HET: TPP; 1.65A {Pseudomonas fluorescens} PDB: 2ag1_A* 2ag0_A* 2uz1_B* 3iae_A* 3iaf_A* 3d7k_A* Back     alignment and structure
>4feg_A Pyruvate oxidase; carbanion, structure activity relationship, oxidation-reduct umpolung, thiamine diphosphate, reaction intermediate; HET: TDM FAD GOL; 1.09A {Lactobacillus plantarum} PDB: 4fee_A* 1y9d_A* 2ez9_A* 2ez4_A* 2ez8_A* 2ezt_A* 2ezu_A* 1pow_A* 1pox_A* Back     alignment and structure
>1ovm_A Indole-3-pyruvate decarboxylase; thiamine diphosphate, indole-3-acetic acid, TDP dependent enzyme, lyase; HET: TPP; 2.65A {Enterobacter cloacae} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 Back     alignment and structure
>1q6z_A BFD, BFDC, benzoylformate decarboxylase; lyase, carbon-carbon, mandelate catabolism, T thiazolone diphosphate, inhibitor, high resolution; HET: TZD; 1.00A {Pseudomonas putida} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1po7_A* 1pi3_A* 3fsj_X* 1mcz_A* 1bfd_A* 2fwn_A* 3fzn_A* 2fn3_A* 2v3w_A* 1yno_A* 3f6b_X* 3f6e_X* Back     alignment and structure
>1ozh_A ALS, acetolactate synthase, catabolic; acetohydroxyacid synthase, thiamin diphosphate, lyase; HET: PGE HE3; 2.00A {Klebsiella pneumoniae} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1ozg_A* 1ozf_A* Back     alignment and structure
>1v5e_A Pyruvate oxidase; oxidoreductase, flavoprotein; HET: FAD; 1.60A {Aerococcus viridans} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 2dji_A* 1v5f_A* 1v5g_A* Back     alignment and structure
>2pan_A Glyoxylate carboligase; thiamin-diphosphate (THDP), thimain-dependent enzymes, FAD, lyase; HET: FAD TDP 1PE; 2.70A {Escherichia coli} Back     alignment and structure
>2vbf_A Branched-chain alpha-ketoacid decarboxylase; KDCA, flavoprotein, THDP-dependent enzymes, thiamine pyrophosphate, lyase; HET: TPP; 1.60A {Lactococcus lactis} PDB: 2vbg_A* Back     alignment and structure
>1ybh_A Acetolactate synthase, chloroplast; acetohydroxyacid synthase, herbicide, sulfonylurea, thiamin diphosphate, FAD, inhibitor; HET: CIE NHE FAD P22; 2.50A {Arabidopsis thaliana} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1yhy_A* 1yhz_A* 1yi0_A* 1yi1_A* 1z8n_A* 3ea4_A* 3e9y_A* Back     alignment and structure
>2wvg_A PDC, pyruvate decarboxylase; thiamine diphosphate, lyase, flavoprotein, metal-binding, alcohol fermentation; HET: TPU; 1.75A {Zymomonas mobilis} PDB: 2wva_A* 2wvh_A 3oe1_A* 1zpd_A* Back     alignment and structure
>1t9b_A Acetolactate synthase, mitochondrial; acetohydroxyacid synthase, herbicide, sulfonylurea, thiamin diphosphate, FAD, inhibitor; HET: 1CS P25 FAD NSP P22 YF3; 2.20A {Saccharomyces cerevisiae} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1n0h_A* 1t9a_A* 1t9c_A* 1t9d_A* 1jsc_A* Back     alignment and structure
>2iht_A Carboxyethylarginine synthase; thiamin diphosphate complex, transferase; HET: MSE TPP; 2.00A {Streptomyces clavuligerus} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1upb_A* 1upc_A* 1upa_A* 2ihu_A* 2ihv_A* Back     alignment and structure
>2q28_A Oxalyl-COA decarboxylase; lyase, oxalate degradation, thiami diphosphate, lyase; HET: TPP ADP MES; 1.74A {Escherichia coli} PDB: 2q27_A* 2q29_A* Back     alignment and structure
>2vbi_A Pyruvate decarboxylase; thiamine pyrophosphate, lyase, pyruv flavoprotein, THDP-dependent enzyme; HET: TPP; 2.75A {Acetobacter pasteurianus} Back     alignment and structure
>2c31_A Oxalyl-COA decarboxylase; oxalate, thiamin diphosphate, flavoprotein, lyase, thiamine pyrophosphate; HET: TZD ADP; 1.73A {Oxalobacter formigenes} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 2ji6_A* 2ji7_A* 2ji8_A* 2ji9_A* 2jib_A* Back     alignment and structure
>3eya_A Pyruvate dehydrogenase [cytochrome]; pyruvate oxidase, membrane-associated flavoprotein dehydrogenase, interactions with lipids cell membrane; HET: TDP FAD; 2.50A {Escherichia coli} PDB: 3ey9_A* Back     alignment and structure
>2pgn_A Cyclohexane-1,2-dione hydrolase (CDH); three alpha/beta domains; HET: P6G FAD TPP; 1.20A {Azoarcus SP} PDB: 2pgo_A* Back     alignment and structure
>2nxw_A Phenyl-3-pyruvate decarboxylase; thiamine pyrophosphate, asymmetric dimer of dimers, open ACT loops, lyase; HET: TPP; 1.50A {Azospirillum brasilense} PDB: 2q5j_A* 2q5l_A* 2q5o_A* 2q5q_A* Back     alignment and structure
>3hww_A 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- carboxylate synthase; menaquinone, THDP, Mg, vitamin K2, carboxylase, magnesium; HET: AKG; 1.95A {Escherichia coli k-12} PDB: 3flm_A* 3hwx_A* 2jlc_A* 2jla_A* Back     alignment and structure
>2x7j_A 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene -1-carboxylate synthase; transferase, metal-binding; HET: TPP; 2.35A {Bacillus subtilis} Back     alignment and structure
>3lq1_A 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- 1-carboxylate synthase; menaquinone biosynthesis, sephchc synthase, structural genomics; 2.60A {Listeria monocytogenes} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 199
d2bfda1 395 c.36.1.11 (A:6-400) Branched-chain alpha-keto acid 1e-41
d1w85a_ 365 c.36.1.11 (A:) Pyruvate dehydrogenase E1-alpha, Pd 2e-36
d1qs0a_ 407 c.36.1.11 (A:) 2-oxoisovalerate dehydrogenase (E1B 8e-35
d1umda_ 362 c.36.1.11 (A:) Branched-chain alpha-keto acid dehy 6e-28
d2ozla1 361 c.36.1.11 (A:1-361) E1-beta subunit of pyruvate de 4e-27
>d2bfda1 c.36.1.11 (A:6-400) Branched-chain alpha-keto acid dehydrogenase, PP module {Human (Homo sapiens) [TaxId: 9606]} Length = 395 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Thiamin diphosphate-binding fold (THDP-binding)
superfamily: Thiamin diphosphate-binding fold (THDP-binding)
family: Branched-chain alpha-keto acid dehydrogenase PP module
domain: Branched-chain alpha-keto acid dehydrogenase, PP module
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  142 bits (358), Expect = 1e-41
 Identities = 85/180 (47%), Positives = 114/180 (63%)

Query: 1   MRFISESSEERIPCYRVLDDDGQPFPDSSFVKVSEGVAIKMYNDMVTLQTMDTIFYEAQR 60
           + FI  +    IP YRV+D  GQ    S    + +   +K+Y  M  L TMD I YE+QR
Sbjct: 15  LEFIQPNVISGIPIYRVMDRQGQIINPSEDPHLPKEKVLKLYKSMTLLNTMDRILYESQR 74

Query: 61  QGRISFYLTTSGEEAINIASAAAIKNDDFVVPQYREPGVLLWRGFSMQEFANQCFGNKAD 120
           QGRISFY+T  GEE  ++ SAAA+ N D V  Q RE GVL++R + ++ F  QC+GN +D
Sbjct: 75  QGRISFYMTNYGEEGTHVGSAAALDNTDLVFGQAREAGVLMYRDYPLELFMAQCYGNISD 134

Query: 121 YGKGRQMPIHYGSNKHNYFTVSSTIATQLPHAVGAAYALKMDRKDACAVTYFGDGGTSEE 180
            GKGRQMP+HYG  + ++ T+SS +ATQ+P AVGAAYA K    +   + YFG+G  SE 
Sbjct: 135 LGKGRQMPVHYGCKERHFVTISSPLATQIPQAVGAAYAAKRANANRVVICYFGEGAASEG 194
>d1w85a_ c.36.1.11 (A:) Pyruvate dehydrogenase E1-alpha, PdhA {Bacillus stearothermophilus [TaxId: 1422]} Length = 365 Back     information, alignment and structure
>d1qs0a_ c.36.1.11 (A:) 2-oxoisovalerate dehydrogenase (E1B), PP module {Pseudomonas putida [TaxId: 303]} Length = 407 Back     information, alignment and structure
>d1umda_ c.36.1.11 (A:) Branched-chain alpha-keto acid dehydrogenase, PP module {Thermus thermophilus [TaxId: 274]} Length = 362 Back     information, alignment and structure
>d2ozla1 c.36.1.11 (A:1-361) E1-beta subunit of pyruvate dehydrogenase (PP module) {Human (Homo sapiens) [TaxId: 9606]} Length = 361 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query199
d2bfda1 395 Branched-chain alpha-keto acid dehydrogenase, PP m 100.0
d1qs0a_ 407 2-oxoisovalerate dehydrogenase (E1B), PP module {P 100.0
d1umda_ 362 Branched-chain alpha-keto acid dehydrogenase, PP m 100.0
d1w85a_ 365 Pyruvate dehydrogenase E1-alpha, PdhA {Bacillus st 100.0
d2ozla1 361 E1-beta subunit of pyruvate dehydrogenase (PP modu 100.0
d2r8oa2 331 Transketolase (TK), PP module {Escherichia coli [T 99.09
d1r9ja2 336 Transketolase (TK), PP module {Leishmania mexicana 99.06
d1gpua1 335 Transketolase (TK), PP module {Baker's yeast (Sacc 99.02
d1itza1 338 Transketolase (TK), PP module {Maize (Zea mays) [T 98.93
d2ieaa2 415 Pyruvate dehydrogenase E1 component, PP module {Es 98.29
d1pvda3196 Pyruvate decarboxylase {Baker's yeast (Saccharomyc 97.14
d1q6za3183 Benzoylformate decarboxylase {Pseudomonas putida [ 97.07
d2ez9a3 228 Pyruvate oxidase {Lactobacillus plantarum [TaxId: 96.06
d2djia3 229 Pyruvate oxidase {Aerococcus viridans [TaxId: 1377 95.91
d1ovma3196 Indole-3-pyruvate decarboxylase {Enterobacter cloa 95.75
d1zpda3204 Pyruvate decarboxylase {Zymomonas mobilis [TaxId: 95.75
d1ybha3 208 Acetohydroxyacid synthase catalytic subunit {Thale 95.52
d1ozha3192 Catabolic acetolactate synthase {Klebsiella pneumo 95.47
d1t9ba3 227 Acetohydroxyacid synthase catalytic subunit {Baker 95.45
d2ihta3198 Carboxyethylarginine synthase {Streptomyces clavul 94.61
d2ji7a3183 Oxalyl-CoA decarboxylase {Oxalobacter formigenes [ 93.09
>d2bfda1 c.36.1.11 (A:6-400) Branched-chain alpha-keto acid dehydrogenase, PP module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Thiamin diphosphate-binding fold (THDP-binding)
superfamily: Thiamin diphosphate-binding fold (THDP-binding)
family: Branched-chain alpha-keto acid dehydrogenase PP module
domain: Branched-chain alpha-keto acid dehydrogenase, PP module
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=3.2e-58  Score=413.35  Aligned_cols=195  Identities=44%  Similarity=0.735  Sum_probs=187.7

Q ss_pred             CccccCCCCCCCCceeeeCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHcCCcccccCCCchhHHHHHH
Q 029082            1 MRFISESSEERIPCYRVLDDDGQPFPDSSFVKVSEGVAIKMYNDMVTLQTMDTIFYEAQRQGRISFYLTTSGEEAINIAS   80 (199)
Q Consensus         1 ~~~~~~~~~~~~~~~~~l~~~G~~~~~~~~~~~~~e~l~~lyr~M~~~R~~d~~~~~l~rqG~ig~~~~~~GqEa~~vg~   80 (199)
                      ++|+.+.....+|++||||+||+++++...+++|+|+++++||.|+++|.||+++.++++||++++++++.||||++||+
T Consensus        15 ~~~~~~~~~~~~p~~r~ld~~g~~~~~~~~~~ls~e~l~~~Yr~M~~~R~~e~~~~~l~~~G~i~~~~~~~GqEA~~vg~   94 (395)
T d2bfda1          15 LEFIQPNVISGIPIYRVMDRQGQIINPSEDPHLPKEKVLKLYKSMTLLNTMDRILYESQRQGRISFYMTNYGEEGTHVGS   94 (395)
T ss_dssp             CCCCCCCCSSCSCEECSBCTTSCBSCGGGCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHTTSSSCCCCCTTCHHHHHHH
T ss_pred             cccCCCccCCCCCeeEEECCCCCCCCccccCCCCHHHHHHHHHHHHHHHHHHHHHHHHHhCCCcccccCCCChHHHHHHH
Confidence            46777777778999999999999998877899999999999999999999999999999999999888999999999999


Q ss_pred             HhhccCCCeeecCCCchHHHHhcCCCHHHHHHHhhcCCCCCCCCCCCCcccCCCCCccccccccccccchhhhHHHHHHH
Q 029082           81 AAAIKNDDFVVPQYREPGVLLWRGFSMQEFANQCFGNKADYGKGRQMPIHYGSNKHNYFTVSSTIATQLPHAVGAAYALK  160 (199)
Q Consensus        81 ~~al~~~D~~~~~yR~~~~~l~rG~~~~~~l~e~~g~~~g~~~Gr~~~~H~~~~~~~~~~~~~~vG~q~~~A~G~A~A~k  160 (199)
                      +.+|+++||+|++||+|+++|+||+|+.++|+|++|+.+|+|+||+||+|+++++.|+++.+++||+|+|+|+|+|+|.|
T Consensus        95 ~~al~~~D~~~~~yR~h~~~la~G~~~~~~~ael~g~~~g~~~Grggs~H~~~~~~~~~~~~~ivg~~~p~A~G~A~a~k  174 (395)
T d2bfda1          95 AAALDNTDLVFGQAREAGVLMYRDYPLELFMAQCYGNISDLGKGRQMPVHYGCKERHFVTISSPLATQIPQAVGAAYAAK  174 (395)
T ss_dssp             HHTSCTTSEEECCSCCHHHHHHTTCCHHHHHHHHHTCTTCTTTTCSCSSCCCBTTTTBCCCCSSTTTHHHHHHHHHHHHH
T ss_pred             HHHcCCCCeeccccchhHhhhhhhCCHHHHHHHHhhcccCccccccccccccccccccccccccccccccHHHHHHHHhh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hCCCCCEEEEEeCCCccChhHHHHHHH----hccchhhh
Q 029082          161 MDRKDACAVTYFGDGGTSEEVSFLFLI----HQLVIREI  195 (199)
Q Consensus       161 ~~g~~~vvv~~~GDGatseG~f~Eal~----~~lP~~~~  195 (199)
                      ++++++|++|||||||++||+|||+||    |+||||-+
T Consensus       175 ~~~~~~v~v~~~GDGa~~eG~f~EalN~A~~~~lPvlfv  213 (395)
T d2bfda1         175 RANANRVVICYFGEGAASEGDAHAGFNFAATLECPIIFF  213 (395)
T ss_dssp             HHTCCCCEEEEEETTGGGSHHHHHHHHHHHHTTCCEEEE
T ss_pred             hcCcccccccccCCCCccchhHHHHHHHHhhcCCceEEE
Confidence            999999999999999999999999986    99999853
>d1qs0a_ c.36.1.11 (A:) 2-oxoisovalerate dehydrogenase (E1B), PP module {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1umda_ c.36.1.11 (A:) Branched-chain alpha-keto acid dehydrogenase, PP module {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1w85a_ c.36.1.11 (A:) Pyruvate dehydrogenase E1-alpha, PdhA {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2ozla1 c.36.1.11 (A:1-361) E1-beta subunit of pyruvate dehydrogenase (PP module) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2r8oa2 c.36.1.10 (A:2-332) Transketolase (TK), PP module {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r9ja2 c.36.1.10 (A:1-336) Transketolase (TK), PP module {Leishmania mexicana mexicana [TaxId: 44270]} Back     information, alignment and structure
>d1gpua1 c.36.1.10 (A:3-337) Transketolase (TK), PP module {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1itza1 c.36.1.10 (A:10-347) Transketolase (TK), PP module {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2ieaa2 c.36.1.10 (A:56-470) Pyruvate dehydrogenase E1 component, PP module {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pvda3 c.36.1.9 (A:361-556) Pyruvate decarboxylase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q6za3 c.36.1.9 (A:342-524) Benzoylformate decarboxylase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2ez9a3 c.36.1.9 (A:366-593) Pyruvate oxidase {Lactobacillus plantarum [TaxId: 1590]} Back     information, alignment and structure
>d2djia3 c.36.1.9 (A:364-592) Pyruvate oxidase {Aerococcus viridans [TaxId: 1377]} Back     information, alignment and structure
>d1ovma3 c.36.1.9 (A:356-551) Indole-3-pyruvate decarboxylase {Enterobacter cloacae [TaxId: 550]} Back     information, alignment and structure
>d1zpda3 c.36.1.9 (A:363-566) Pyruvate decarboxylase {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1ybha3 c.36.1.9 (A:460-667) Acetohydroxyacid synthase catalytic subunit {Thale cress (Arabidopsis thaliana), chloroplast [TaxId: 3702]} Back     information, alignment and structure
>d1ozha3 c.36.1.9 (A:367-558) Catabolic acetolactate synthase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1t9ba3 c.36.1.9 (A:461-687) Acetohydroxyacid synthase catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ihta3 c.36.1.9 (A:375-572) Carboxyethylarginine synthase {Streptomyces clavuligerus [TaxId: 1901]} Back     information, alignment and structure
>d2ji7a3 c.36.1.9 (A:370-552) Oxalyl-CoA decarboxylase {Oxalobacter formigenes [TaxId: 847]} Back     information, alignment and structure