Citrus Sinensis ID: 029105


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------20
MKLTWNKNKGNKKRSLQQFPNLPFDQQDQEHGLSGAELEKNDDNNEHQEPFDAKQLALSFEAQGNNLAEDGKFREALGKWEAALNLRPENAVLHEQKAQVLLELGDAWNALKAATRATELEQSWAEAWITLGRAQLNFGEPDKAIESFERALAIKPDSEEARDDRQTALHLVKRRKHLHLSGLSNDANRFVVGDKTEVS
cccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHcccccHHHccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcHHHHHHccHHHHHHHHHcccccccc
cEEEEcccccccccEEEccccccccccccHHHHHHHHHHHHHHccccHHcccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEccccccc
mkltwnknkgnkkrslqqfpnlpfdqqdqehglsgaeleknddnnehqepfdaKQLALSFEAQGNNLAEDGKFREALGKWEAAlnlrpenavlHEQKAQVLLELGDAWNALKAATRATELEQSWAEAWITLGRaqlnfgepdKAIESFERAlaikpdseearDDRQTALHLVKRRKHlhlsglsndanrfvvgdktevs
mkltwnknkgnkkrslQQFPNLPFDQQDQEHGLSGAELEKNDDNNEHQEPFDAKQLALSFEAQGNNLAEDGKFREALGKWEAALNLRPENAVLHEQKAQVLLELGDAWNALKAATRATELEQSWAEAWITLGRAQLNFGEPDKAIESFERAlaikpdseearDDRQTALHLVKRrkhlhlsglsndanrfvvgdktevs
MKLTWNKNKGNKKRSLQQFPNLPFDQQDQEHGLSGAELEKNDDNNEHQEPFDAKQLALSFEAQGNNLAEDGKFREALGKWEAALNLRPENAVLHEQKAQVLLELGDAWNALKAATRATELEQSWAEAWITLGRAQLNFGEPDKAIESFERALAIKPDSEEARDDRQTAlhlvkrrkhlhlSGLSNDANRFVVGDKTEVS
***********************************************************************KFREALGKWEAALNLRPENAVLHEQKAQVLLELGDAWNALKAATRATELEQSWAEAWITLGRAQLNFGE***********************************************************
MKLTWNKNKGNKKRSLQQFPNLPFDQQDQEHGLSGAELEKNDDNNEHQEPFDAKQLALSFEAQGNNLAEDGKFREALGKWEAALNLRPENAVLHEQKAQVLLELGDAWNALKAATRATELEQSWAEAWITLGRAQLNFGEPDKAIESFERALAIKPDSEEARDDRQTALHLVKRRKHLHLSGLSNDANRFVVGD*****
************KRSLQQFPNLPFDQQDQEHGLSGAELEKNDDNNEHQEPFDAKQLALSFEAQGNNLAEDGKFREALGKWEAALNLRPENAVLHEQKAQVLLELGDAWNALKAATRATELEQSWAEAWITLGRAQLNFGEPDKAIESFERALAIKPD********QTALHLVKRRKHLHLSGLSNDANRFVVGDKTEVS
MKLTWNKNKGNKKRSLQQFPNLPFDQQDQEHGLSGAELEKNDDNNEHQEPFDAKQLALSFEAQGNNLAEDGKFREALGKWEAALNLRPENAVLHEQKAQVLLELGDAWNALKAATRATELEQSWAEAWITLGRAQLNFGEPDKAIESFERALAIKPDSEEARDDRQTALHLVKRRKHLHL*******************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKLTWNKNKGNKKRSLQQFPNLPFDQQDQEHGLSGAELEKNDDNNEHQEPFDAKQLALSFEAQGNNLAEDGKFREALGKWEAALNLRPENAVLHEQKAQVLLELGDAWNALKAATRATELEQSWAEAWITLGRAQLNFGEPDKAIESFERALAIKPDSEEARDDRQTALHLVKRRKHLHLSGLSNDANRFVVGDKTEVS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query199 2.2.26 [Sep-21-2011]
Q6DI40268 Tetratricopeptide repeat yes no 0.472 0.350 0.5 1e-17
Q5M990258 Tetratricopeptide repeat N/A no 0.492 0.379 0.469 3e-16
Q6PID6262 Tetratricopeptide repeat yes no 0.467 0.354 0.484 3e-15
Q9D6K7262 Tetratricopeptide repeat yes no 0.537 0.408 0.458 3e-15
Q43468569 Heat shock protein STI OS no no 0.633 0.221 0.307 5e-08
Q9QYI3 494 DnaJ homolog subfamily C no no 0.517 0.208 0.320 9e-08
O43049 473 Serine/threonine-protein yes no 0.592 0.249 0.271 1e-07
P56558 1036 UDP-N-acetylglucosamine-- no no 0.567 0.109 0.307 2e-07
P81436 1046 UDP-N-acetylglucosamine-- no no 0.567 0.108 0.307 2e-07
O15294 1046 UDP-N-acetylglucosamine-- no no 0.567 0.108 0.307 2e-07
>sp|Q6DI40|TTC33_DANRE Tetratricopeptide repeat protein 33 OS=Danio rerio GN=ttc33 PE=2 SV=1 Back     alignment and function desciption
 Score = 89.4 bits (220), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 47/94 (50%), Positives = 65/94 (69%)

Query: 63  QGNNLAEDGKFREALGKWEAALNLRPENAVLHEQKAQVLLELGDAWNALKAATRATELEQ 122
           +G  LAE  +  EAL KW+ A+ L PE+AVL+E K+QVL+ LG+ + A+++A  AT L  
Sbjct: 66  EGALLAEQDRNWEALKKWDEAVQLTPEDAVLYEMKSQVLITLGEVFLAVQSAEMATRLRP 125

Query: 123 SWAEAWITLGRAQLNFGEPDKAIESFERALAIKP 156
            W EAW TLGRAQL+ GE + A+ SF+ AL + P
Sbjct: 126 IWWEAWQTLGRAQLSLGEVELAVRSFQVALHLHP 159





Danio rerio (taxid: 7955)
>sp|Q5M990|TTC33_XENLA Tetratricopeptide repeat protein 33 OS=Xenopus laevis GN=ttc33 PE=2 SV=1 Back     alignment and function description
>sp|Q6PID6|TTC33_HUMAN Tetratricopeptide repeat protein 33 OS=Homo sapiens GN=TTC33 PE=1 SV=2 Back     alignment and function description
>sp|Q9D6K7|TTC33_MOUSE Tetratricopeptide repeat protein 33 OS=Mus musculus GN=Ttc33 PE=2 SV=1 Back     alignment and function description
>sp|Q43468|STIP_SOYBN Heat shock protein STI OS=Glycine max GN=STI PE=2 SV=1 Back     alignment and function description
>sp|Q9QYI3|DNJC7_MOUSE DnaJ homolog subfamily C member 7 OS=Mus musculus GN=Dnajc7 PE=1 SV=2 Back     alignment and function description
>sp|O43049|PPT1_SCHPO Serine/threonine-protein phosphatase T OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppt1 PE=3 SV=2 Back     alignment and function description
>sp|P56558|OGT1_RAT UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Rattus norvegicus GN=Ogt PE=1 SV=1 Back     alignment and function description
>sp|P81436|OGT1_RABIT UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Oryctolagus cuniculus GN=OGT PE=1 SV=2 Back     alignment and function description
>sp|O15294|OGT1_HUMAN UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Homo sapiens GN=OGT PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query199
255558526216 conserved hypothetical protein [Ricinus 0.994 0.916 0.694 5e-71
359492242205 PREDICTED: tetratricopeptide repeat prot 0.984 0.956 0.658 1e-65
224062978216 predicted protein [Populus trichocarpa] 0.954 0.879 0.617 5e-64
449463430215 PREDICTED: tetratricopeptide repeat prot 0.974 0.902 0.636 2e-63
449499089215 PREDICTED: tetratricopeptide repeat prot 0.974 0.902 0.631 6e-63
302141751168 unnamed protein product [Vitis vinifera] 0.718 0.851 0.811 2e-59
297839583214 hypothetical protein ARALYDRAFT_316635 [ 0.979 0.911 0.602 1e-58
351725651192 uncharacterized protein LOC100305761 [Gl 0.949 0.984 0.611 4e-57
334183964218 tetratricopeptide repeat-containing prot 0.979 0.894 0.572 5e-56
3540197237 Unknown protein [Arabidopsis thaliana] 0.979 0.822 0.525 6e-53
>gi|255558526|ref|XP_002520288.1| conserved hypothetical protein [Ricinus communis] gi|223540507|gb|EEF42074.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
 Score =  272 bits (696), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 141/203 (69%), Positives = 161/203 (79%), Gaps = 5/203 (2%)

Query: 1   MKLTWNKNKGNKKRSLQQFPNLPFDQQDQEHGLSGAELEKNDDNNEHQ-EPFDA---KQL 56
           MK+ W K+   KKR+L ++PNLPFDQ+DQE   S  E+  N      Q EP D+   KQL
Sbjct: 15  MKVIWKKDNKTKKRTLSKYPNLPFDQEDQERE-SLNEITTNQQGFASQDEPLDSQSEKQL 73

Query: 57  ALSFEAQGNNLAEDGKFREALGKWEAALNLRPENAVLHEQKAQVLLELGDAWNALKAATR 116
           A SF++QGN LAEDGK+REALGKWEAALNL P + VLHEQKAQVLLE+GDAWNALKAATR
Sbjct: 74  AESFQSQGNKLAEDGKYREALGKWEAALNLMPGSTVLHEQKAQVLLEIGDAWNALKAATR 133

Query: 117 ATELEQSWAEAWITLGRAQLNFGEPDKAIESFERALAIKPDSEEARDDRQTALHLVKRRK 176
           ATELE SWAEAWITLGR QLNFGEPD AIESF+RALA+KPD +EA+DDR  ALHLVKRRK
Sbjct: 134 ATELEPSWAEAWITLGRTQLNFGEPDSAIESFDRALALKPDVKEAQDDRHAALHLVKRRK 193

Query: 177 HLHLSGLSNDANRFVVGDKTEVS 199
            LH SGLS + +RF+V DK E S
Sbjct: 194 QLHSSGLSANESRFMVADKAESS 216




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|359492242|ref|XP_002284637.2| PREDICTED: tetratricopeptide repeat protein 33-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224062978|ref|XP_002300958.1| predicted protein [Populus trichocarpa] gi|222842684|gb|EEE80231.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449463430|ref|XP_004149437.1| PREDICTED: tetratricopeptide repeat protein 33-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449499089|ref|XP_004160718.1| PREDICTED: tetratricopeptide repeat protein 33-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|302141751|emb|CBI18954.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|297839583|ref|XP_002887673.1| hypothetical protein ARALYDRAFT_316635 [Arabidopsis lyrata subsp. lyrata] gi|297333514|gb|EFH63932.1| hypothetical protein ARALYDRAFT_316635 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|351725651|ref|NP_001236332.1| uncharacterized protein LOC100305761 [Glycine max] gi|255626545|gb|ACU13617.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|334183964|ref|NP_177847.2| tetratricopeptide repeat-containing protein [Arabidopsis thaliana] gi|17381164|gb|AAL36394.1| unknown protein [Arabidopsis thaliana] gi|37202106|gb|AAQ89668.1| At1g77230 [Arabidopsis thaliana] gi|51969438|dbj|BAD43411.1| hypothetical protein [Arabidopsis thaliana] gi|51969472|dbj|BAD43428.1| hypothetical protein [Arabidopsis thaliana] gi|332197831|gb|AEE35952.1| tetratricopeptide repeat-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|3540197|gb|AAC34347.1| Unknown protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query199
MGI|MGI:1914765262 Ttc33 "tetratricopeptide repea 0.773 0.587 0.389 5.7e-20
ZFIN|ZDB-GENE-040718-480268 ttc33 "tetratricopeptide repea 0.743 0.552 0.392 9.2e-20
UNIPROTKB|Q43468569 STI "Heat shock protein STI" [ 0.633 0.221 0.307 6.3e-10
FB|FBgn0032640331 Sgt "small glutamine-rich tetr 0.567 0.341 0.274 1.6e-09
TAIR|locus:2137440 427 TPR8 "AT4G08320" [Arabidopsis 0.763 0.355 0.265 3.6e-09
TAIR|locus:2026197 571 Hop2 "Hop2" [Arabidopsis thali 0.497 0.173 0.313 5.9e-09
DICTYBASE|DDB_G0275389535 DDB_G0275389 "Dyslexia suscept 0.788 0.293 0.206 8.7e-09
MGI|MGI:1928373 494 Dnajc7 "DnaJ (Hsp40) homolog, 0.603 0.242 0.3 1.3e-08
ZFIN|ZDB-GENE-051128-1 1102 ogt.2 "O-linked N-acetylglucos 0.633 0.114 0.303 4.8e-08
RGD|1303226 494 Dnajc7 "DnaJ (Hsp40) homolog, 0.603 0.242 0.291 5.3e-08
MGI|MGI:1914765 Ttc33 "tetratricopeptide repeat domain 33" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
 Score = 237 (88.5 bits), Expect = 5.7e-20, P = 5.7e-20
 Identities = 62/159 (38%), Positives = 87/159 (54%)

Query:     5 WNKNKGNK--KRSLQQFPNLPFDQQDQEHGLSGAELEKNDDNNEHQEPFDAKQLALSFEA 62
             W +  G K  K + QQF     D++D      G  L+ +    E  +    KQ +   + 
Sbjct:     6 WKRRIGEKVSKATSQQFEAEAADEKDAAENEDGNWLQASKRRKETLQE-GCKQRSQQLKD 64

Query:    63 QGNNLAEDGKFREALGKWEAALNLRPENAVLHEQKAQVLLELGDAWNALKAATRATELE- 121
             +G  LAE+ +++EA+ KW+ AL L P +A L+E K+QVLL L + + A+ AA  A +   
Sbjct:    65 EGAQLAENKRYKEAIQKWDEALQLTPGDATLYEMKSQVLLSLHEMFPAVHAAEMAVKRNP 124

Query:   122 QSWAEAWITLGRAQLNFGEPDKAIESFERALAIKPDSEE 160
              SW EAW TLGRAQL  GE   AI SF+ AL I P + E
Sbjct:   125 HSW-EAWQTLGRAQLGLGEIVLAIRSFQIALHIYPMNPE 162




GO:0003674 "molecular_function" evidence=ND
GO:0005575 "cellular_component" evidence=ND
GO:0008150 "biological_process" evidence=ND
ZFIN|ZDB-GENE-040718-480 ttc33 "tetratricopeptide repeat domain 33" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q43468 STI "Heat shock protein STI" [Glycine max (taxid:3847)] Back     alignment and assigned GO terms
FB|FBgn0032640 Sgt "small glutamine-rich tetratricopeptide containing protein" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
TAIR|locus:2137440 TPR8 "AT4G08320" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2026197 Hop2 "Hop2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0275389 DDB_G0275389 "Dyslexia susceptibility 1 candidate gene 1 protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
MGI|MGI:1928373 Dnajc7 "DnaJ (Hsp40) homolog, subfamily C, member 7" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-051128-1 ogt.2 "O-linked N-acetylglucosamine (GlcNAc) transferase (UDP-N-acetylglucosamine:polypeptide-N-acetylglucosaminyl transferase) 2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
RGD|1303226 Dnajc7 "DnaJ (Hsp40) homolog, subfamily C, member 7" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00015465001
SubName- Full=Chromosome chr18 scaffold_1, whole genome shotgun sequence; (221 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query199
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 6e-13
pfam1341469 pfam13414, TPR_11, TPR repeat 2e-07
pfam1341469 pfam13414, TPR_11, TPR repeat 3e-07
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 9e-07
TIGR02917899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 2e-05
COG4783484 COG4783, COG4783, Putative Zn-dependent protease, 3e-05
TIGR02917 899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 5e-05
pfam0051534 pfam00515, TPR_1, Tetratricopeptide repeat 8e-05
COG4976 287 COG4976, COG4976, Predicted methyltransferase (con 2e-04
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 3e-04
PLN03088 356 PLN03088, PLN03088, SGT1, suppressor of G2 allele 3e-04
COG4783484 COG4783, COG4783, Putative Zn-dependent protease, 4e-04
smart0002834 smart00028, TPR, Tetratricopeptide repeats 4e-04
TIGR02917 899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 6e-04
COG3118304 COG3118, COG3118, Thioredoxin domain-containing pr 8e-04
TIGR02917 899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 0.001
pfam1343265 pfam13432, TPR_16, Tetratricopeptide repeat 0.001
pfam1318134 pfam13181, TPR_8, Tetratricopeptide repeat 0.002
TIGR02917 899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 0.003
smart01043145 smart01043, BTAD, Bacterial transcriptional activa 0.003
TIGR00990 615 TIGR00990, 3a0801s09, mitochondrial precursor prot 0.003
TIGR02917 899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 0.004
TIGR02521234 TIGR02521, type_IV_pilW, type IV pilus biogenesis/ 0.004
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
 Score = 61.6 bits (150), Expect = 6e-13
 Identities = 33/95 (34%), Positives = 53/95 (55%)

Query: 63  QGNNLAEDGKFREALGKWEAALNLRPENAVLHEQKAQVLLELGDAWNALKAATRATELEQ 122
            GN   + G + EAL  +E AL L P+NA  +   A    +LG    AL+   +A EL+ 
Sbjct: 6   LGNLYYKLGDYDEALEYYEKALELDPDNADAYYNLAAAYYKLGKYEEALEDYEKALELDP 65

Query: 123 SWAEAWITLGRAQLNFGEPDKAIESFERALAIKPD 157
             A+A+  LG A    G+ ++A+E++E+AL + P+
Sbjct: 66  DNAKAYYNLGLAYYKLGKYEEALEAYEKALELDPN 100


Length = 100

>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|227122 COG4783, COG4783, Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|201277 pfam00515, TPR_1, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|227310 COG4976, COG4976, Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|215568 PLN03088, PLN03088, SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>gnl|CDD|227122 COG4783, COG4783, Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>gnl|CDD|197478 smart00028, TPR, Tetratricopeptide repeats Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|225660 COG3118, COG3118, Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|222123 pfam13432, TPR_16, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|205362 pfam13181, TPR_8, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|198111 smart01043, BTAD, Bacterial transcriptional activator domain Back     alignment and domain information
>gnl|CDD|233223 TIGR00990, 3a0801s09, mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|131573 TIGR02521, type_IV_pilW, type IV pilus biogenesis/stability protein PilW Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 199
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.91
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.91
TIGR00990 615 3a0801s09 mitochondrial precursor proteins import 99.88
KOG1126638 consensus DNA-binding cell division cycle control 99.86
PRK15359144 type III secretion system chaperone protein SscB; 99.86
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.86
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.85
KOG1126638 consensus DNA-binding cell division cycle control 99.85
KOG0553304 consensus TPR repeat-containing protein [General f 99.85
TIGR00990 615 3a0801s09 mitochondrial precursor proteins import 99.84
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.83
KOG1125579 consensus TPR repeat-containing protein [General f 99.83
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.82
PRK12370553 invasion protein regulator; Provisional 99.82
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.81
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.81
PRK12370 553 invasion protein regulator; Provisional 99.8
PRK11189296 lipoprotein NlpI; Provisional 99.79
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.79
PRK11189296 lipoprotein NlpI; Provisional 99.79
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 99.79
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.79
PRK10370198 formate-dependent nitrite reductase complex subuni 99.79
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.78
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.78
TIGR02552135 LcrH_SycD type III secretion low calcium response 99.77
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.77
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.76
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.76
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 99.76
PRK15359144 type III secretion system chaperone protein SscB; 99.75
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 99.75
PRK11788389 tetratricopeptide repeat protein; Provisional 99.74
PRK10370198 formate-dependent nitrite reductase complex subuni 99.74
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.74
TIGR02917 899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.73
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.73
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 99.73
PRK11788 389 tetratricopeptide repeat protein; Provisional 99.73
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 99.71
KOG0547 606 consensus Translocase of outer mitochondrial membr 99.71
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.7
KOG0547606 consensus Translocase of outer mitochondrial membr 99.7
PLN02789 320 farnesyltranstransferase 99.69
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 99.68
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 99.68
TIGR02552135 LcrH_SycD type III secretion low calcium response 99.67
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.67
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 99.66
KOG1129478 consensus TPR repeat-containing protein [General f 99.66
KOG2076 895 consensus RNA polymerase III transcription factor 99.66
KOG1125579 consensus TPR repeat-containing protein [General f 99.65
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.65
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.65
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.64
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.64
PLN02789320 farnesyltranstransferase 99.64
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 99.64
KOG0553304 consensus TPR repeat-containing protein [General f 99.63
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 99.63
KOG0550 486 consensus Molecular chaperone (DnaJ superfamily) [ 99.62
COG4783484 Putative Zn-dependent protease, contains TPR repea 99.61
KOG3060289 consensus Uncharacterized conserved protein [Funct 99.61
KOG1129478 consensus TPR repeat-containing protein [General f 99.6
PRK02603172 photosystem I assembly protein Ycf3; Provisional 99.59
KOG1840 508 consensus Kinesin light chain [Cytoskeleton] 99.59
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 99.59
PRK15331165 chaperone protein SicA; Provisional 99.59
cd00189100 TPR Tetratricopeptide repeat domain; typically con 99.58
KOG2076 895 consensus RNA polymerase III transcription factor 99.58
KOG1173 611 consensus Anaphase-promoting complex (APC), Cdc16 99.56
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 99.56
CHL00033168 ycf3 photosystem I assembly protein Ycf3 99.56
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.56
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 99.55
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.55
KOG2003 840 consensus TPR repeat-containing protein [General f 99.55
KOG3060289 consensus Uncharacterized conserved protein [Funct 99.55
PRK14574 822 hmsH outer membrane protein; Provisional 99.54
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 99.54
KOG0624 504 consensus dsRNA-activated protein kinase inhibitor 99.54
KOG0548 539 consensus Molecular co-chaperone STI1 [Posttransla 99.53
cd05804 355 StaR_like StaR_like; a well-conserved protein foun 99.52
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.52
COG4783484 Putative Zn-dependent protease, contains TPR repea 99.52
COG4235287 Cytochrome c biogenesis factor [Posttranslational 99.51
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 99.51
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.51
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 99.51
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 99.5
cd05804 355 StaR_like StaR_like; a well-conserved protein foun 99.5
PRK14574 822 hmsH outer membrane protein; Provisional 99.5
KOG2003 840 consensus TPR repeat-containing protein [General f 99.48
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.47
KOG1174 564 consensus Anaphase-promoting complex (APC), subuni 99.47
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 99.47
PRK10803263 tol-pal system protein YbgF; Provisional 99.46
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 99.46
KOG4234271 consensus TPR repeat-containing protein [General f 99.46
PRK14720 906 transcript cleavage factor/unknown domain fusion p 99.46
KOG0624 504 consensus dsRNA-activated protein kinase inhibitor 99.45
KOG4648 536 consensus Uncharacterized conserved protein, conta 99.44
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 99.43
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.43
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 99.42
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 99.41
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 99.41
CHL00033168 ycf3 photosystem I assembly protein Ycf3 99.41
COG2956 389 Predicted N-acetylglucosaminyl transferase [Carboh 99.41
KOG1128 777 consensus Uncharacterized conserved protein, conta 99.41
KOG1128 777 consensus Uncharacterized conserved protein, conta 99.39
cd00189100 TPR Tetratricopeptide repeat domain; typically con 99.39
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.38
COG4235287 Cytochrome c biogenesis factor [Posttranslational 99.38
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 99.37
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 99.36
PRK10153517 DNA-binding transcriptional activator CadC; Provis 99.35
PRK10747 398 putative protoheme IX biogenesis protein; Provisio 99.35
PRK02603172 photosystem I assembly protein Ycf3; Provisional 99.35
KOG0495 913 consensus HAT repeat protein [RNA processing and m 99.35
PF12688120 TPR_5: Tetratrico peptide repeat 99.35
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.33
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 99.33
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 99.32
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 99.32
PF1337173 TPR_9: Tetratricopeptide repeat 99.32
PRK11906458 transcriptional regulator; Provisional 99.3
PF1337173 TPR_9: Tetratricopeptide repeat 99.3
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 99.3
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 99.29
COG1729262 Uncharacterized protein conserved in bacteria [Fun 99.29
PF13512142 TPR_18: Tetratricopeptide repeat 99.28
PRK15331165 chaperone protein SicA; Provisional 99.28
TIGR00540 409 hemY_coli hemY protein. This is an uncharacterized 99.28
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.27
PRK10153517 DNA-binding transcriptional activator CadC; Provis 99.26
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 99.26
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 99.25
PF06552186 TOM20_plant: Plant specific mitochondrial import r 99.25
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 99.24
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 99.21
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 99.21
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 99.18
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 99.18
PRK11906458 transcriptional regulator; Provisional 99.17
PF12688120 TPR_5: Tetratrico peptide repeat 99.16
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 99.16
KOG4555175 consensus TPR repeat-containing protein [Function 99.16
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 99.15
PRK14720 906 transcript cleavage factor/unknown domain fusion p 99.15
KOG4642 284 consensus Chaperone-dependent E3 ubiquitin protein 99.13
PRK10803263 tol-pal system protein YbgF; Provisional 99.13
KOG0495 913 consensus HAT repeat protein [RNA processing and m 99.12
COG4700251 Uncharacterized protein conserved in bacteria cont 99.11
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 99.1
COG4105254 ComL DNA uptake lipoprotein [General function pred 99.1
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 99.1
PF13512142 TPR_18: Tetratricopeptide repeat 99.1
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 99.1
KOG3785 557 consensus Uncharacterized conserved protein [Funct 99.09
KOG4340 459 consensus Uncharacterized conserved protein [Funct 99.05
KOG4234271 consensus TPR repeat-containing protein [General f 99.05
KOG0376 476 consensus Serine-threonine phosphatase 2A, catalyt 99.04
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 99.04
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.0
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 99.0
KOG2376 652 consensus Signal recognition particle, subunit Srp 98.97
COG1729262 Uncharacterized protein conserved in bacteria [Fun 98.96
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 98.94
COG4700251 Uncharacterized protein conserved in bacteria cont 98.94
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 98.94
PLN03218 1060 maturation of RBCL 1; Provisional 98.93
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 98.93
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 98.92
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.91
KOG4648 536 consensus Uncharacterized conserved protein, conta 98.91
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 98.9
KOG0551 390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 98.9
KOG2376 652 consensus Signal recognition particle, subunit Srp 98.87
PLN03218 1060 maturation of RBCL 1; Provisional 98.87
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 98.87
PF1342844 TPR_14: Tetratricopeptide repeat 98.85
PLN03077 857 Protein ECB2; Provisional 98.84
KOG4555175 consensus TPR repeat-containing protein [Function 98.8
KOG4340 459 consensus Uncharacterized conserved protein [Funct 98.79
KOG2796366 consensus Uncharacterized conserved protein [Funct 98.79
PF1342844 TPR_14: Tetratricopeptide repeat 98.79
PF1343134 TPR_17: Tetratricopeptide repeat 98.68
KOG1941 518 consensus Acetylcholine receptor-associated protei 98.67
PF06552186 TOM20_plant: Plant specific mitochondrial import r 98.66
COG4105254 ComL DNA uptake lipoprotein [General function pred 98.64
COG0457291 NrfG FOG: TPR repeat [General function prediction 98.63
COG0457291 NrfG FOG: TPR repeat [General function prediction 98.63
PF1343134 TPR_17: Tetratricopeptide repeat 98.62
KOG4642 284 consensus Chaperone-dependent E3 ubiquitin protein 98.6
PRK04841 903 transcriptional regulator MalT; Provisional 98.59
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 98.59
PF05843 280 Suf: Suppressor of forked protein (Suf); InterPro: 98.57
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 98.57
PLN03077 857 Protein ECB2; Provisional 98.56
KOG2796366 consensus Uncharacterized conserved protein [Funct 98.55
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 98.55
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 98.55
KOG2610 491 consensus Uncharacterized conserved protein [Funct 98.55
KOG2471 696 consensus TPR repeat-containing protein [General f 98.52
PRK04841 903 transcriptional regulator MalT; Provisional 98.49
PF03704146 BTAD: Bacterial transcriptional activator domain; 98.49
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.48
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 98.47
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 98.47
KOG1308 377 consensus Hsp70-interacting protein Hip/Transient 98.46
KOG1915 677 consensus Cell cycle control protein (crooked neck 98.42
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 98.39
KOG3785 557 consensus Uncharacterized conserved protein [Funct 98.38
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.38
KOG0551 390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 98.38
KOG2610 491 consensus Uncharacterized conserved protein [Funct 98.35
COG3118304 Thioredoxin domain-containing protein [Posttransla 98.33
COG3071 400 HemY Uncharacterized enzyme of heme biosynthesis [ 98.32
KOG1941 518 consensus Acetylcholine receptor-associated protei 98.26
KOG1585 308 consensus Protein required for fusion of vesicles 98.24
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 98.24
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 98.17
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 98.16
KOG1586288 consensus Protein required for fusion of vesicles 98.15
KOG1915 677 consensus Cell cycle control protein (crooked neck 98.14
KOG0376 476 consensus Serine-threonine phosphatase 2A, catalyt 98.13
COG2976207 Uncharacterized protein conserved in bacteria [Fun 98.11
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 98.11
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 98.09
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 98.09
KOG4507 886 consensus Uncharacterized conserved protein, conta 98.09
PF04781111 DUF627: Protein of unknown function (DUF627); Inte 98.02
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 98.0
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 98.0
PRK10941269 hypothetical protein; Provisional 97.97
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 97.97
KOG2396 568 consensus HAT (Half-A-TPR) repeat-containing prote 97.97
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 97.93
KOG2471 696 consensus TPR repeat-containing protein [General f 97.92
KOG3824 472 consensus Huntingtin interacting protein HYPE [Gen 97.92
PF03704146 BTAD: Bacterial transcriptional activator domain; 97.92
PRK10941269 hypothetical protein; Provisional 97.91
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 97.87
KOG3824 472 consensus Huntingtin interacting protein HYPE [Gen 97.86
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 97.86
KOG1310 758 consensus WD40 repeat protein [General function pr 97.83
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 97.83
KOG1586288 consensus Protein required for fusion of vesicles 97.81
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 97.8
KOG1308377 consensus Hsp70-interacting protein Hip/Transient 97.79
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 97.78
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 97.76
PF13281374 DUF4071: Domain of unknown function (DUF4071) 97.76
COG0790292 FOG: TPR repeat, SEL1 subfamily [General function 97.74
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 97.74
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 97.73
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 97.72
KOG2047 835 consensus mRNA splicing factor [RNA processing and 97.71
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 97.65
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 97.62
KOG1585308 consensus Protein required for fusion of vesicles 97.58
KOG1550 552 consensus Extracellular protein SEL-1 and related 97.53
COG3118304 Thioredoxin domain-containing protein [Posttransla 97.52
KOG3364149 consensus Membrane protein involved in organellar 97.47
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 97.46
PF13281374 DUF4071: Domain of unknown function (DUF4071) 97.45
PF04910 360 Tcf25: Transcriptional repressor TCF25; InterPro: 97.45
COG2976207 Uncharacterized protein conserved in bacteria [Fun 97.42
COG4976 287 Predicted methyltransferase (contains TPR repeat) 97.38
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 97.38
PF15015 569 NYD-SP12_N: Spermatogenesis-associated, N-terminal 97.35
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 97.33
KOG4507 886 consensus Uncharacterized conserved protein, conta 97.3
KOG4814 872 consensus Uncharacterized conserved protein [Funct 97.29
COG4649221 Uncharacterized protein conserved in bacteria [Fun 97.26
KOG2300 629 consensus Uncharacterized conserved protein [Funct 97.25
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 97.24
COG4976 287 Predicted methyltransferase (contains TPR repeat) 97.2
PF04781111 DUF627: Protein of unknown function (DUF627); Inte 97.19
PF08424 321 NRDE-2: NRDE-2, necessary for RNA interference; In 97.18
COG3914 620 Spy Predicted O-linked N-acetylglucosamine transfe 97.17
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 97.15
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 97.15
PF09986214 DUF2225: Uncharacterized protein conserved in bact 97.14
COG3898 531 Uncharacterized membrane-bound protein [Function u 97.12
KOG2047 835 consensus mRNA splicing factor [RNA processing and 97.12
PF08424 321 NRDE-2: NRDE-2, necessary for RNA interference; In 97.12
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 97.12
KOG2396 568 consensus HAT (Half-A-TPR) repeat-containing prote 97.09
COG5191 435 Uncharacterized conserved protein, contains HAT (H 97.07
PF09986214 DUF2225: Uncharacterized protein conserved in bact 97.05
KOG3364149 consensus Membrane protein involved in organellar 97.02
KOG18391236 consensus Uncharacterized protein CLU1/cluA/TIF31 97.0
KOG1550 552 consensus Extracellular protein SEL-1 and related 97.0
KOG0530318 consensus Protein farnesyltransferase, alpha subun 96.95
PF04910360 Tcf25: Transcriptional repressor TCF25; InterPro: 96.95
KOG0546372 consensus HSP90 co-chaperone CPR7/Cyclophilin [Pos 96.93
PF15015 569 NYD-SP12_N: Spermatogenesis-associated, N-terminal 96.92
COG2912269 Uncharacterized conserved protein [Function unknow 96.86
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 96.85
COG0790292 FOG: TPR repeat, SEL1 subfamily [General function 96.84
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 96.83
COG2912269 Uncharacterized conserved protein [Function unknow 96.8
KOG0530 318 consensus Protein farnesyltransferase, alpha subun 96.79
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 96.78
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 96.73
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 96.7
COG5191 435 Uncharacterized conserved protein, contains HAT (H 96.69
PF10373 278 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterP 96.65
PRK13184 932 pknD serine/threonine-protein kinase; Reviewed 96.63
KOG1258 577 consensus mRNA processing protein [RNA processing 96.57
KOG2300629 consensus Uncharacterized conserved protein [Funct 96.57
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 96.56
KOG1310 758 consensus WD40 repeat protein [General function pr 96.54
PF08631 278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 96.48
KOG2581 493 consensus 26S proteasome regulatory complex, subun 96.45
PF1286294 Apc5: Anaphase-promoting complex subunit 5 96.45
COG3629280 DnrI DNA-binding transcriptional activator of the 96.39
COG3914 620 Spy Predicted O-linked N-acetylglucosamine transfe 96.36
COG3898 531 Uncharacterized membrane-bound protein [Function u 96.28
KOG4814 872 consensus Uncharacterized conserved protein [Funct 96.26
PF1057980 Rapsyn_N: Rapsyn N-terminal myristoylation and lin 96.25
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 96.11
PF1286294 Apc5: Anaphase-promoting complex subunit 5 96.11
PF0772036 TPR_3: Tetratricopeptide repeat; InterPro: IPR0117 96.09
COG3629280 DnrI DNA-binding transcriptional activator of the 96.02
PF1057980 Rapsyn_N: Rapsyn N-terminal myristoylation and lin 96.01
PF10373 278 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterP 96.01
KOG2422 665 consensus Uncharacterized conserved protein [Funct 95.96
PF0772036 TPR_3: Tetratricopeptide repeat; InterPro: IPR0117 95.9
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 95.9
PF07079 549 DUF1347: Protein of unknown function (DUF1347); In 95.84
PRK15180 831 Vi polysaccharide biosynthesis protein TviD; Provi 95.78
PF1051638 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat 95.77
PF1051638 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat 95.75
COG4649221 Uncharacterized protein conserved in bacteria [Fun 95.74
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 95.7
KOG0529 421 consensus Protein geranylgeranyltransferase type I 95.69
PRK15180 831 Vi polysaccharide biosynthesis protein TviD; Provi 95.58
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 95.44
KOG18391236 consensus Uncharacterized protein CLU1/cluA/TIF31 95.24
PRK13184 932 pknD serine/threonine-protein kinase; Reviewed 95.14
COG3947361 Response regulator containing CheY-like receiver a 95.1
PF11817247 Foie-gras_1: Foie gras liver health family 1; Inte 94.76
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 94.7
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 94.64
KOG3616 1636 consensus Selective LIM binding factor [Transcript 94.63
KOG0890 2382 consensus Protein kinase of the PI-3 kinase family 94.5
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 94.49
PF10255 404 Paf67: RNA polymerase I-associated factor PAF67; I 94.45
PF14863141 Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB 94.23
KOG2041 1189 consensus WD40 repeat protein [General function pr 94.23
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 94.08
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 94.06
COG4455 273 ImpE Protein of avirulence locus involved in tempe 93.99
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 93.98
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 93.78
KOG4151 748 consensus Myosin assembly protein/sexual cycle pro 93.74
COG3947361 Response regulator containing CheY-like receiver a 93.72
smart0038633 HAT HAT (Half-A-TPR) repeats. Present in several R 93.7
KOG3807 556 consensus Predicted membrane protein ST7 (tumor su 93.66
KOG0529 421 consensus Protein geranylgeranyltransferase type I 93.63
KOG2422 665 consensus Uncharacterized conserved protein [Funct 93.45
PF11817247 Foie-gras_1: Foie gras liver health family 1; Inte 93.23
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 93.2
PF10345 608 Cohesin_load: Cohesin loading factor; InterPro: IP 93.04
KOG0546372 consensus HSP90 co-chaperone CPR7/Cyclophilin [Pos 92.97
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 92.59
PF1285434 PPR_1: PPR repeat 92.51
COG4455273 ImpE Protein of avirulence locus involved in tempe 92.41
KOG2041 1189 consensus WD40 repeat protein [General function pr 92.4
PF10255 404 Paf67: RNA polymerase I-associated factor PAF67; I 92.33
COG4941415 Predicted RNA polymerase sigma factor containing a 92.33
KOG2581 493 consensus 26S proteasome regulatory complex, subun 92.25
PF14863141 Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB 92.14
PF10345 608 Cohesin_load: Cohesin loading factor; InterPro: IP 91.94
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 91.75
KOG1464 440 consensus COP9 signalosome, subunit CSN2 [Posttran 91.71
KOG0686 466 consensus COP9 signalosome, subunit CSN1 [Posttran 91.44
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 91.14
KOG3616 1636 consensus Selective LIM binding factor [Transcript 90.63
PF1285434 PPR_1: PPR repeat 90.41
PF09670 379 Cas_Cas02710: CRISPR-associated protein (Cas_Cas02 90.34
PF08311126 Mad3_BUB1_I: Mad3/BUB1 homology region 1; InterPro 90.23
KOG3807 556 consensus Predicted membrane protein ST7 (tumor su 90.09
PF1304150 PPR_2: PPR repeat family 89.7
KOG1258577 consensus mRNA processing protein [RNA processing 89.55
PF09797365 NatB_MDM20: N-acetyltransferase B complex (NatB) n 89.05
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 88.96
PF13226 277 DUF4034: Domain of unknown function (DUF4034) 88.79
PF11846193 DUF3366: Domain of unknown function (DUF3366); Int 88.66
KOG0687 393 consensus 26S proteasome regulatory complex, subun 88.46
PHA02537230 M terminase endonuclease subunit; Provisional 88.24
KOG4014248 consensus Uncharacterized conserved protein (conta 88.19
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 87.65
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 87.15
PF11846193 DUF3366: Domain of unknown function (DUF3366); Int 86.99
PRK11619 644 lytic murein transglycosylase; Provisional 86.75
KOG4151 748 consensus Myosin assembly protein/sexual cycle pro 86.74
KOG3783 546 consensus Uncharacterized conserved protein [Funct 86.29
cd0268275 MIT_AAA_Arch MIT: domain contained within Microtub 86.13
PF09670379 Cas_Cas02710: CRISPR-associated protein (Cas_Cas02 86.0
COG5187 412 RPN7 26S proteasome regulatory complex component, 85.91
PRK15490 578 Vi polysaccharide biosynthesis protein TviE; Provi 85.86
PF13226277 DUF4034: Domain of unknown function (DUF4034) 84.6
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 83.95
KOG0890 2382 consensus Protein kinase of the PI-3 kinase family 83.78
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 83.35
PF10952140 DUF2753: Protein of unknown function (DUF2753); In 83.01
PF07219108 HemY_N: HemY protein N-terminus; InterPro: IPR0108 82.87
COG5107 660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 82.74
PF09797365 NatB_MDM20: N-acetyltransferase B complex (NatB) n 81.9
COG5107 660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 81.84
COG1747 711 Uncharacterized N-terminal domain of the transcrip 81.82
PF04190260 DUF410: Protein of unknown function (DUF410) ; Int 81.16
PF0218432 HAT: HAT (Half-A-TPR) repeat; InterPro: IPR003107 80.36
COG5159 421 RPN6 26S proteasome regulatory complex component [ 80.24
COG5536328 BET4 Protein prenyltransferase, alpha subunit [Pos 80.2
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
Probab=99.91  E-value=3.8e-24  Score=161.22  Aligned_cols=172  Identities=21%  Similarity=0.225  Sum_probs=124.1

Q ss_pred             cccccCCCCCCchHhhhcchhhhhccchhhhhhccccc--chhhHHHHHHHHhhHHHhcccHHHHHHHHHHHHccCCCcH
Q 029105           14 RSLQQFPNLPFDQQDQEHGLSGAELEKNDDNNEHQEPF--DAKQLALSFEAQGNNLAEDGKFREALGKWEAALNLRPENA   91 (199)
Q Consensus        14 ~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~A~~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~A~~~~~~~l~~~~~~~   91 (199)
                      +.+...|++|...  -++|+++-..|+..+|...|.++  ..|..+++++++|+++..+|.+++|...|.++++..|+.+
T Consensus       311 ral~~~P~F~~Ay--~NlanALkd~G~V~ea~~cYnkaL~l~p~hadam~NLgni~~E~~~~e~A~~ly~~al~v~p~~a  388 (966)
T KOG4626|consen  311 RALELQPNFPDAY--NNLANALKDKGSVTEAVDCYNKALRLCPNHADAMNNLGNIYREQGKIEEATRLYLKALEVFPEFA  388 (966)
T ss_pred             HHHhcCCCchHHH--hHHHHHHHhccchHHHHHHHHHHHHhCCccHHHHHHHHHHHHHhccchHHHHHHHHHHhhChhhh
Confidence            4455555555332  35566777777777777777776  6677777777777777777777777777777777777777


Q ss_pred             HHHHHHHHHHHHcCCHHHHHHHHHHHhhcccccHHHHHHHHHHHHhcCChHHHHHHHHHHHhcCCCcHHHHHHHHHHHHH
Q 029105           92 VLHEQKAQVLLELGDAWNALKAATRATELEQSWAEAWITLGRAQLNFGEPDKAIESFERALAIKPDSEEARDDRQTALHL  171 (199)
Q Consensus        92 ~~~~~la~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~lg~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~l~~~~~~  171 (199)
                      .++.+||.+|.++|++++|+.+|+.++++.|...+++.++|..|..+|+.+.|+++|.+++.++|..++++.+|+.+|..
T Consensus       389 aa~nNLa~i~kqqgnl~~Ai~~YkealrI~P~fAda~~NmGnt~ke~g~v~~A~q~y~rAI~~nPt~AeAhsNLasi~kD  468 (966)
T KOG4626|consen  389 AAHNNLASIYKQQGNLDDAIMCYKEALRIKPTFADALSNMGNTYKEMGDVSAAIQCYTRAIQINPTFAEAHSNLASIYKD  468 (966)
T ss_pred             hhhhhHHHHHHhcccHHHHHHHHHHHHhcCchHHHHHHhcchHHHHhhhHHHHHHHHHHHHhcCcHHHHHHhhHHHHhhc
Confidence            77777777777777777777777777777777777777777777777777777777777777777777777777777777


Q ss_pred             Hhhhhhhhhhcccccc
Q 029105          172 VKRRKHLHLSGLSNDA  187 (199)
Q Consensus       172 ~~~~~~a~~~~~~~~~  187 (199)
                      .|+..+|..++..+..
T Consensus       469 sGni~~AI~sY~~aLk  484 (966)
T KOG4626|consen  469 SGNIPEAIQSYRTALK  484 (966)
T ss_pred             cCCcHHHHHHHHHHHc
Confidence            7777777766655544



>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF15015 NYD-SP12_N: Spermatogenesis-associated, N-terminal Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>KOG4814 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2300 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG5191 Uncharacterized conserved protein, contains HAT (Half-A-TPR) repeat [General function prediction only] Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>KOG1839 consensus Uncharacterized protein CLU1/cluA/TIF31 involved in mitochondrial morphology/distribution, also found associated with eIF-3 [General function prediction only] Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG0530 consensus Protein farnesyltransferase, alpha subunit/protein geranylgeranyltransferase type I, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>KOG0546 consensus HSP90 co-chaperone CPR7/Cyclophilin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF15015 NYD-SP12_N: Spermatogenesis-associated, N-terminal Back     alignment and domain information
>COG2912 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>COG2912 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0530 consensus Protein farnesyltransferase, alpha subunit/protein geranylgeranyltransferase type I, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>COG5191 Uncharacterized conserved protein, contains HAT (Half-A-TPR) repeat [General function prediction only] Back     alignment and domain information
>PF10373 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterPro: IPR018834 Est1 is a protein which recruits or activates telomerase at the site of polymerisation [, ] Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>KOG2300 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>KOG2581 consensus 26S proteasome regulatory complex, subunit RPN3/PSMD3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>KOG4814 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>PF07720 TPR_3: Tetratricopeptide repeat; InterPro: IPR011716 This entry includes tetratricopeptide-like repeats found in the LcrH/SycD-like chaperones [] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane Back     alignment and domain information
>PF10373 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterPro: IPR018834 Est1 is a protein which recruits or activates telomerase at the site of polymerisation [, ] Back     alignment and domain information
>KOG2422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF07720 TPR_3: Tetratricopeptide repeat; InterPro: IPR011716 This entry includes tetratricopeptide-like repeats found in the LcrH/SycD-like chaperones [] Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>KOG0529 consensus Protein geranylgeranyltransferase type II, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>KOG1839 consensus Uncharacterized protein CLU1/cluA/TIF31 involved in mitochondrial morphology/distribution, also found associated with eIF-3 [General function prediction only] Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>PF11817 Foie-gras_1: Foie gras liver health family 1; InterPro: IPR021773 Mutating the gene foie gras in zebrafish has been shown to affect development; the mutants develop large, lipid-filled hepatocytes in the liver, resembling those in individuals with fatty liver disease [] Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>PF10255 Paf67: RNA polymerase I-associated factor PAF67; InterPro: IPR019382 RNA polymerase I is a multi-subunit enzyme and its transcription competence is dependent on the presence of PAF67 [] Back     alignment and domain information
>PF14863 Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB: 2YHE_C 2CG2_A 2CG3_A 2CFU_A 2CFZ_A Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>COG4455 ImpE Protein of avirulence locus involved in temperature-dependent protein secretion [General function prediction only] Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>KOG4151 consensus Myosin assembly protein/sexual cycle protein and related proteins [Posttranslational modification, protein turnover, chaperones; Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>smart00386 HAT HAT (Half-A-TPR) repeats Back     alignment and domain information
>KOG3807 consensus Predicted membrane protein ST7 (tumor suppressor in humans) [General function prediction only] Back     alignment and domain information
>KOG0529 consensus Protein geranylgeranyltransferase type II, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF11817 Foie-gras_1: Foie gras liver health family 1; InterPro: IPR021773 Mutating the gene foie gras in zebrafish has been shown to affect development; the mutants develop large, lipid-filled hepatocytes in the liver, resembling those in individuals with fatty liver disease [] Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>KOG0546 consensus HSP90 co-chaperone CPR7/Cyclophilin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>COG4455 ImpE Protein of avirulence locus involved in temperature-dependent protein secretion [General function prediction only] Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF10255 Paf67: RNA polymerase I-associated factor PAF67; InterPro: IPR019382 RNA polymerase I is a multi-subunit enzyme and its transcription competence is dependent on the presence of PAF67 [] Back     alignment and domain information
>COG4941 Predicted RNA polymerase sigma factor containing a TPR repeat domain [Transcription] Back     alignment and domain information
>KOG2581 consensus 26S proteasome regulatory complex, subunit RPN3/PSMD3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14863 Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB: 2YHE_C 2CG2_A 2CG3_A 2CFU_A 2CFZ_A Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG0686 consensus COP9 signalosome, subunit CSN1 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>PF09670 Cas_Cas02710: CRISPR-associated protein (Cas_Cas02710) Back     alignment and domain information
>PF08311 Mad3_BUB1_I: Mad3/BUB1 homology region 1; InterPro: IPR013212 Proteins containing this domain are checkpoint proteins involved in cell division Back     alignment and domain information
>KOG3807 consensus Predicted membrane protein ST7 (tumor suppressor in humans) [General function prediction only] Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>PF09797 NatB_MDM20: N-acetyltransferase B complex (NatB) non catalytic subunit; InterPro: IPR019183 This is the non-catalytic subunit of the N-terminal acetyltransferase B complex (NatB) Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13226 DUF4034: Domain of unknown function (DUF4034) Back     alignment and domain information
>PF11846 DUF3366: Domain of unknown function (DUF3366); InterPro: IPR021797 This domain is functionally uncharacterised Back     alignment and domain information
>KOG0687 consensus 26S proteasome regulatory complex, subunit RPN7/PSMD6 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02537 M terminase endonuclease subunit; Provisional Back     alignment and domain information
>KOG4014 consensus Uncharacterized conserved protein (contains TPR repeat) [Function unknown] Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>PF11846 DUF3366: Domain of unknown function (DUF3366); InterPro: IPR021797 This domain is functionally uncharacterised Back     alignment and domain information
>PRK11619 lytic murein transglycosylase; Provisional Back     alignment and domain information
>KOG4151 consensus Myosin assembly protein/sexual cycle protein and related proteins [Posttranslational modification, protein turnover, chaperones; Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG3783 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd02682 MIT_AAA_Arch MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>PF09670 Cas_Cas02710: CRISPR-associated protein (Cas_Cas02710) Back     alignment and domain information
>COG5187 RPN7 26S proteasome regulatory complex component, contains PCI domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15490 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PF13226 DUF4034: Domain of unknown function (DUF4034) Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>PF10952 DUF2753: Protein of unknown function (DUF2753); InterPro: IPR020206 This entry represents a group of uncharacterised proteins Back     alignment and domain information
>PF07219 HemY_N: HemY protein N-terminus; InterPro: IPR010817 This entry represents the N terminus (approximately 150 residues) of bacterial HemY porphyrin biosynthesis proteins Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PF09797 NatB_MDM20: N-acetyltransferase B complex (NatB) non catalytic subunit; InterPro: IPR019183 This is the non-catalytic subunit of the N-terminal acetyltransferase B complex (NatB) Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>COG1747 Uncharacterized N-terminal domain of the transcription elongation factor GreA [Function unknown] Back     alignment and domain information
>PF04190 DUF410: Protein of unknown function (DUF410) ; InterPro: IPR007317 This is a family of conserved eukaryotic proteins with undetermined function Back     alignment and domain information
>PF02184 HAT: HAT (Half-A-TPR) repeat; InterPro: IPR003107 The HAT (Half A TPR) repeat has a repetitive pattern characterised by three aromatic residues with a conserved spacing Back     alignment and domain information
>COG5159 RPN6 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5536 BET4 Protein prenyltransferase, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query199
1na0_A125 Design Of Stable Alpha-Helical Arrays From An Ideal 3e-09
2wqh_A125 Crystal Structure Of Ctpr3y3 Length = 125 4e-09
2fo7_A136 Crystal Structure Of An 8 Repeat Consensus Tpr Supe 3e-08
3pe3_A 723 Structure Of Human O-Glcnac Transferase And Its Com 1e-07
3kd7_A125 Designed Tpr Module (Ctpr390) In Complex With Its P 2e-07
4gco_A126 Central Domain Of Stress-Induced Protein-1 (Sti-1) 3e-06
2c2l_A 281 Crystal Structure Of The Chip U-Box E3 Ubiquitin Li 2e-05
1wao_1 477 Pp5 Structure Length = 477 2e-05
2bug_A140 Solution Structure Of The Tpr Domain From Protein P 2e-05
1na3_A91 Design Of Stable Alpha-Helical Arrays From An Ideal 3e-05
3q47_B137 Crystal Structure Of Tpr Domain Of Chip Complexed W 3e-05
2vyi_A131 Crystal Structure Of The Tpr Domain Of Human Sgt Le 3e-05
1a17_A166 Tetratricopeptide Repeats Of Protein Phosphatase 5 3e-05
3vtx_A184 Crystal Structure Of Mama Protein Length = 184 4e-05
2lni_A133 Solution Nmr Structure Of Stress-Induced-Phosphopro 9e-05
1w3b_A388 The Superhelical Tpr Domain Of O-Linked Glcnac Tran 1e-04
3cvq_A327 Structure Of Peroxisomal Targeting Signal 1 (pts1) 2e-04
3cv0_A327 Structure Of Peroxisomal Targeting Signal 1 (Pts1) 2e-04
4eqf_A365 Trip8b-1a#206-567 Interacting With The Carboxy-Term 3e-04
2l6j_A111 Tah1 Complexed By Meevd Length = 111 4e-04
2avp_A70 Crystal Structure Of An 8 Repeat Consensus Tpr Supe 6e-04
>pdb|1NA0|A Chain A, Design Of Stable Alpha-Helical Arrays From An Idealized Tpr Motif Length = 125 Back     alignment and structure

Iteration: 1

Score = 58.2 bits (139), Expect = 3e-09, Method: Compositional matrix adjust. Identities = 34/99 (34%), Positives = 54/99 (54%) Query: 64 GNNLAEDGKFREALGKWEAALNLRPENAVLHEQKAQVLLELGDAWNALKAATRATELEQS 123 GN + G + EA+ ++ AL L P NA + GD A++ +A EL+ + Sbjct: 16 GNAYYKQGDYDEAIEYYQKALELDPNNAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPN 75 Query: 124 WAEAWITLGRAQLNFGEPDKAIESFERALAIKPDSEEAR 162 AEAW LG A G+ D+AIE +++AL + P++ EA+ Sbjct: 76 NAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPNNAEAK 114
>pdb|2WQH|A Chain A, Crystal Structure Of Ctpr3y3 Length = 125 Back     alignment and structure
>pdb|2FO7|A Chain A, Crystal Structure Of An 8 Repeat Consensus Tpr Superhelix (Trigonal Crystal Form) Length = 136 Back     alignment and structure
>pdb|3PE3|A Chain A, Structure Of Human O-Glcnac Transferase And Its Complex With A Peptide Substrate Length = 723 Back     alignment and structure
>pdb|3KD7|A Chain A, Designed Tpr Module (Ctpr390) In Complex With Its Peptide-Ligand (Hsp90 Peptide) Length = 125 Back     alignment and structure
>pdb|4GCO|A Chain A, Central Domain Of Stress-Induced Protein-1 (Sti-1) From C.Elegans Length = 126 Back     alignment and structure
>pdb|2C2L|A Chain A, Crystal Structure Of The Chip U-Box E3 Ubiquitin Ligase Length = 281 Back     alignment and structure
>pdb|1WAO|1 Chain 1, Pp5 Structure Length = 477 Back     alignment and structure
>pdb|1NA3|A Chain A, Design Of Stable Alpha-Helical Arrays From An Idealized Tpr Motif Length = 91 Back     alignment and structure
>pdb|3Q47|B Chain B, Crystal Structure Of Tpr Domain Of Chip Complexed With Pseudophosphorylated Smad1 Peptide Length = 137 Back     alignment and structure
>pdb|2VYI|A Chain A, Crystal Structure Of The Tpr Domain Of Human Sgt Length = 131 Back     alignment and structure
>pdb|1A17|A Chain A, Tetratricopeptide Repeats Of Protein Phosphatase 5 Length = 166 Back     alignment and structure
>pdb|3VTX|A Chain A, Crystal Structure Of Mama Protein Length = 184 Back     alignment and structure
>pdb|2LNI|A Chain A, Solution Nmr Structure Of Stress-Induced-Phosphoprotein 1 Sti1 From Homo Sapiens, Northeast Structural Genomics Consortium Target Hr4403e Length = 133 Back     alignment and structure
>pdb|1W3B|A Chain A, The Superhelical Tpr Domain Of O-Linked Glcnac Transferase Reveals Structural Similarities To Importin Alpha. Length = 388 Back     alignment and structure
>pdb|3CVQ|A Chain A, Structure Of Peroxisomal Targeting Signal 1 (pts1) Binding Domain Of Trypanosoma Brucei Peroxin 5 (tbpex5)complexed To Pts1 Peptide (7- Skl) Length = 327 Back     alignment and structure
>pdb|3CV0|A Chain A, Structure Of Peroxisomal Targeting Signal 1 (Pts1) Binding Domain Of Trypanosoma Brucei Peroxin 5 (Tbpex5)complexed To T. Brucei Phosphoglucoisomerase (Pgi) Pts1 Peptide Length = 327 Back     alignment and structure
>pdb|4EQF|A Chain A, Trip8b-1a#206-567 Interacting With The Carboxy-Terminal Seven Residues Of Hcn2 Length = 365 Back     alignment and structure
>pdb|2L6J|A Chain A, Tah1 Complexed By Meevd Length = 111 Back     alignment and structure
>pdb|2AVP|A Chain A, Crystal Structure Of An 8 Repeat Consensus Tpr Superhelix Length = 70 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query199
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 4e-21
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 4e-19
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 1e-18
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 5e-18
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 1e-09
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 4e-09
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 4e-08
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 3e-06
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 3e-04
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 2e-18
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 3e-18
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 5e-17
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 9e-10
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 2e-09
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 3e-09
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 3e-05
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 2e-18
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 1e-15
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 2e-13
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 3e-09
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 4e-05
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 3e-18
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 4e-18
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 5e-18
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 7e-18
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 6e-15
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 1e-06
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 2e-17
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 2e-17
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 3e-16
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 6e-16
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 6e-16
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 1e-15
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 1e-15
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 1e-15
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 2e-15
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 1e-14
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 4e-08
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 1e-06
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 2e-17
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 6e-17
3uq3_A 258 Heat shock protein STI1; HSP90, peptide binding, c 2e-13
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 4e-13
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 1e-12
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 7e-12
3uq3_A 258 Heat shock protein STI1; HSP90, peptide binding, c 5e-06
3q49_B137 STIP1 homology and U box-containing protein 1; E3 2e-16
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 3e-16
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 1e-15
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 1e-14
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 2e-14
2q7f_A 243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 4e-11
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 8e-16
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 1e-15
3cv0_A 327 Peroxisome targeting signal 1 receptor PEX5; TPR m 1e-15
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 4e-14
3cv0_A 327 Peroxisome targeting signal 1 receptor PEX5; TPR m 1e-12
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 7e-11
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 2e-06
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 2e-15
1xnf_A 275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 2e-15
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 2e-12
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 8e-10
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 5e-09
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 2e-06
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 2e-15
2kat_A115 Uncharacterized protein; NESG, structure, structur 2e-15
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 3e-15
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 4e-14
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 4e-13
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 9e-13
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 4e-12
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 2e-11
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 1e-09
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 3e-05
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 3e-15
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 6e-10
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 4e-15
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 1e-14
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 2e-06
1fch_A 368 Peroxisomal targeting signal 1 receptor; protein-p 4e-15
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 2e-13
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 1e-11
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 5e-07
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 6e-15
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 2e-14
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 2e-14
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 3e-10
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 9e-15
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 2e-06
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 1e-14
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 5e-11
3u4t_A 272 TPR repeat-containing protein; structural genomics 1e-14
3u4t_A272 TPR repeat-containing protein; structural genomics 5e-14
3u4t_A272 TPR repeat-containing protein; structural genomics 2e-11
3u4t_A272 TPR repeat-containing protein; structural genomics 6e-10
3u4t_A 272 TPR repeat-containing protein; structural genomics 3e-05
4eqf_A365 PEX5-related protein; accessory protein, tetratric 2e-14
4eqf_A 365 PEX5-related protein; accessory protein, tetratric 3e-14
4eqf_A365 PEX5-related protein; accessory protein, tetratric 3e-11
4eqf_A 365 PEX5-related protein; accessory protein, tetratric 1e-08
2c2l_A 281 CHIP, carboxy terminus of HSP70-interacting protei 4e-14
2xpi_A 597 Anaphase-promoting complex subunit CUT9; cell cycl 5e-14
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 1e-13
2xpi_A 597 Anaphase-promoting complex subunit CUT9; cell cycl 3e-13
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 2e-12
2xpi_A 597 Anaphase-promoting complex subunit CUT9; cell cycl 7e-11
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 1e-09
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 2e-09
2xpi_A 597 Anaphase-promoting complex subunit CUT9; cell cycl 2e-05
2xpi_A 597 Anaphase-promoting complex subunit CUT9; cell cycl 1e-04
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 5e-14
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 9e-12
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 7e-14
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 9e-13
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 4e-12
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 7e-14
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 7e-10
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 7e-14
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 8e-14
2ho1_A 252 Type 4 fimbrial biogenesis protein PILF; type IV p 3e-12
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 6e-12
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 9e-10
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 1e-13
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 9e-08
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 7e-04
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 2e-13
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 2e-13
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 1e-10
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 3e-09
2pl2_A 217 Hypothetical conserved protein TTC0263; TPR, prote 1e-08
2pl2_A 217 Hypothetical conserved protein TTC0263; TPR, prote 5e-06
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 3e-13
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 3e-13
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 4e-13
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 9e-13
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 1e-12
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 1e-12
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 1e-12
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 2e-12
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 4e-12
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 6e-12
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 4e-11
2gw1_A 514 Mitochondrial precursor proteins import receptor; 3e-13
2gw1_A 514 Mitochondrial precursor proteins import receptor; 8e-13
2gw1_A514 Mitochondrial precursor proteins import receptor; 1e-12
2gw1_A514 Mitochondrial precursor proteins import receptor; 2e-12
2gw1_A514 Mitochondrial precursor proteins import receptor; 2e-12
2gw1_A 514 Mitochondrial precursor proteins import receptor; 3e-12
2gw1_A 514 Mitochondrial precursor proteins import receptor; 1e-05
2gw1_A514 Mitochondrial precursor proteins import receptor; 3e-05
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 3e-13
3hym_B 330 Cell division cycle protein 16 homolog; APC, anaph 4e-13
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 2e-09
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 5e-09
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 2e-08
3hym_B 330 Cell division cycle protein 16 homolog; APC, anaph 9e-08
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 4e-12
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 2e-10
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 7e-08
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 1e-06
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 2e-05
2vq2_A 225 PILW, putative fimbrial biogenesis and twitching m 2e-11
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 8e-10
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 3e-09
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 3e-08
2vq2_A 225 PILW, putative fimbrial biogenesis and twitching m 4e-05
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 6e-11
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-10
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 3e-10
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 4e-10
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 4e-10
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 4e-10
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 7e-10
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 7e-10
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-09
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 3e-09
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 4e-09
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 5e-09
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-08
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-08
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-05
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 6e-05
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-04
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-04
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 3e-04
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 9e-04
2l6j_A111 TPR repeat-containing protein associated with HSP; 7e-11
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 8e-11
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 3e-10
4g1t_A 472 Interferon-induced protein with tetratricopeptide 4e-10
4g1t_A472 Interferon-induced protein with tetratricopeptide 9e-08
4g1t_A472 Interferon-induced protein with tetratricopeptide 2e-07
4g1t_A472 Interferon-induced protein with tetratricopeptide 7e-06
4g1t_A 472 Interferon-induced protein with tetratricopeptide 3e-05
4g1t_A 472 Interferon-induced protein with tetratricopeptide 8e-05
4g1t_A472 Interferon-induced protein with tetratricopeptide 2e-04
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 7e-10
4a1s_A 411 PINS, partner of inscuteable; cell cycle, LGN, mit 1e-09
4a1s_A 411 PINS, partner of inscuteable; cell cycle, LGN, mit 3e-08
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 2e-06
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 6e-06
3k9i_A117 BH0479 protein; putative protein binding protein, 2e-09
3k9i_A117 BH0479 protein; putative protein binding protein, 1e-06
3k9i_A117 BH0479 protein; putative protein binding protein, 2e-04
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 3e-09
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 3e-08
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 4e-09
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 5e-09
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 5e-09
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 1e-08
3sf4_A 406 G-protein-signaling modulator 2; tetratricopeptide 2e-08
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 3e-04
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 6e-04
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 2e-08
3ro2_A 338 PINS homolog, G-protein-signaling modulator 2; TPR 2e-08
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 7e-05
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 8e-05
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 2e-08
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 2e-07
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 7e-07
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 3e-08
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 1e-07
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 7e-07
2h6f_A 382 Protein farnesyltransferase/geranylgeranyltransfer 1e-06
2h6f_A 382 Protein farnesyltransferase/geranylgeranyltransfer 4e-05
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 2e-06
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 8e-06
3q15_A 378 PSP28, response regulator aspartate phosphatase H; 5e-06
3q15_A378 PSP28, response regulator aspartate phosphatase H; 7e-04
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 6e-06
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 2e-05
3ulq_A 383 Response regulator aspartate phosphatase F; tetrat 2e-05
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 3e-05
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 8e-05
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 5e-04
3qww_A433 SET and MYND domain-containing protein 2; methyltr 6e-04
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 Back     alignment and structure
 Score = 83.4 bits (207), Expect = 4e-21
 Identities = 27/120 (22%), Positives = 60/120 (50%)

Query: 54  KQLALSFEAQGNNLAEDGKFREALGKWEAALNLRPENAVLHEQKAQVLLELGDAWNALKA 113
              A   + +GN   +   F  A+  +  A+ L P NAV    +A    +LG+   A++ 
Sbjct: 9   SAEAERLKTEGNEQMKVENFEAAVHFYGKAIELNPANAVYFCNRAAAYSKLGNYAGAVQD 68

Query: 114 ATRATELEQSWAEAWITLGRAQLNFGEPDKAIESFERALAIKPDSEEARDDRQTALHLVK 173
             RA  ++ ++++A+  +G A  +  +  +A+  +++AL + PD+E  + + + A   ++
Sbjct: 69  CERAICIDPAYSKAYGRMGLALSSLNKHVEAVAYYKKALELDPDNETYKSNLKIAELKLR 128


>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Length = 166 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Length = 118 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Length = 133 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Length = 126 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Length = 164 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Length = 137 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 148 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Length = 127 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Length = 126 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Length = 131 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Length = 281 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Length = 477 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Length = 111 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Length = 372 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Length = 198 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Length = 91 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Length = 162 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Length = 336 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Length = 99 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Length = 370 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Length = 457 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Length = 338 Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Length = 159 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Length = 382 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Length = 382 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Length = 176 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Length = 158 Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Length = 433 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query199
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.95
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.95
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.94
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.94
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.94
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.94
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.92
2h6f_A 382 Protein farnesyltransferase/geranylgeranyltransfer 99.92
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.92
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.91
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.91
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.9
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.9
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.9
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.9
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.89
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.89
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.89
2h6f_A 382 Protein farnesyltransferase/geranylgeranyltransfer 99.89
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.89
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.89
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.89
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 99.89
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.89
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.89
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.89
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.89
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.89
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.88
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.88
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.88
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.88
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.88
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.88
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.88
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.88
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 99.87
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.87
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.87
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.87
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.87
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.87
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.87
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.87
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.87
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.87
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.87
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 99.87
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.87
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.87
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.87
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.87
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.86
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.86
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.86
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.86
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 99.86
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.86
3u4t_A272 TPR repeat-containing protein; structural genomics 99.86
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.86
3u4t_A272 TPR repeat-containing protein; structural genomics 99.85
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.85
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 99.85
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.85
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.85
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.85
3q49_B137 STIP1 homology and U box-containing protein 1; E3 99.85
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.85
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 99.85
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.84
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.84
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 99.83
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 99.83
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 99.83
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.83
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.83
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 99.83
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 99.83
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.83
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.82
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.82
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.82
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 99.82
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.82
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.82
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.81
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.81
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 99.81
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.8
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 99.8
2gw1_A 514 Mitochondrial precursor proteins import receptor; 99.8
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.8
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 99.8
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.8
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.8
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.79
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.79
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.79
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.79
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.79
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.79
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.79
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.78
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 99.78
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.78
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 99.78
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.78
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 99.77
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.77
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.77
3k9i_A117 BH0479 protein; putative protein binding protein, 99.77
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.77
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.76
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.76
2c2l_A 281 CHIP, carboxy terminus of HSP70-interacting protei 99.76
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.76
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.75
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.75
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.75
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.75
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 99.75
4g1t_A 472 Interferon-induced protein with tetratricopeptide 99.74
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.74
3u3w_A293 Transcriptional activator PLCR protein; ternary co 99.74
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.73
4g1t_A 472 Interferon-induced protein with tetratricopeptide 99.73
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 99.73
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 99.73
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.73
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 99.73
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.72
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.72
4a1s_A 411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.72
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 99.72
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.72
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 99.72
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.71
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 99.71
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.7
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.7
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 99.7
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 99.7
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 99.69
3q49_B137 STIP1 homology and U box-containing protein 1; E3 99.69
3k9i_A117 BH0479 protein; putative protein binding protein, 99.69
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 99.69
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.69
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.68
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.68
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 99.68
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.68
2kat_A115 Uncharacterized protein; NESG, structure, structur 99.67
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 99.66
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 99.66
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 99.66
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.66
2l6j_A111 TPR repeat-containing protein associated with HSP; 99.66
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 99.65
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 99.65
2l6j_A111 TPR repeat-containing protein associated with HSP; 99.65
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 99.64
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 99.64
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 99.64
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 99.64
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 99.64
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.63
3dss_A 331 Geranylgeranyl transferase type-2 subunit alpha; p 99.63
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 99.62
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 99.62
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 99.62
3u3w_A293 Transcriptional activator PLCR protein; ternary co 99.61
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.6
1hz4_A 373 MALT regulatory protein; two-helix bundles, helix 99.59
3q7a_A 349 Farnesyltransferase alpha subunit; protein prenylt 99.59
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 99.58
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.58
2xm6_A 490 Protein corresponding to locus C5321 from CFT073 s 99.58
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 99.58
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 99.57
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 99.57
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 99.57
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 99.57
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 99.56
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.56
3e4b_A 452 ALGK; tetratricopeptide repeat, superhelix, algina 99.53
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 99.53
1hz4_A 373 MALT regulatory protein; two-helix bundles, helix 99.51
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 99.5
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 99.49
2kat_A115 Uncharacterized protein; NESG, structure, structur 99.47
1klx_A138 Cysteine rich protein B; structural genomics, heli 99.46
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.45
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 99.44
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 99.42
1pc2_A152 Mitochondria fission protein; unknown function; NM 99.38
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.36
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 99.35
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 99.35
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 99.34
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 99.33
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.33
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 99.31
1klx_A138 Cysteine rich protein B; structural genomics, heli 99.3
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.26
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 99.26
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 99.24
3qww_A433 SET and MYND domain-containing protein 2; methyltr 99.21
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 99.19
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 99.19
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 99.17
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 99.06
1pc2_A152 Mitochondria fission protein; unknown function; NM 99.05
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 99.05
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 99.03
3qww_A433 SET and MYND domain-containing protein 2; methyltr 99.01
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 98.98
4e6h_A 679 MRNA 3'-END-processing protein RNA14; HAT domain, 98.92
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 98.79
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 98.67
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 98.6
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 98.52
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 98.51
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 98.5
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 98.48
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 98.46
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 98.43
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.4
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 98.3
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 98.02
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 97.98
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 97.87
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 97.83
1ya0_A 497 SMG-7 transcript variant 2; alpha-helical repeat, 97.73
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 97.66
2ff4_A 388 Probable regulatory protein EMBR; winged-helix, te 97.52
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 97.52
1ya0_A 497 SMG-7 transcript variant 2; alpha-helical repeat, 97.44
3kae_A242 CDC27, possible protein of nuclear scaffold; tetra 97.29
1zbp_A 273 Hypothetical protein VPA1032; alpha-beta protein, 97.27
3txn_A 394 26S proteasome regulatory complex subunit P42B; PC 97.18
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.72
4b4t_S 523 RPN3, 26S proteasome regulatory subunit RPN3; hydr 96.65
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 96.58
3kae_A242 CDC27, possible protein of nuclear scaffold; tetra 96.53
4fhn_B 1139 Nucleoporin NUP120; protein complex,structural pro 96.46
1zbp_A 273 Hypothetical protein VPA1032; alpha-beta protein, 96.41
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.41
4b4t_R 429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 96.4
3txn_A394 26S proteasome regulatory complex subunit P42B; PC 96.38
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 96.35
4b4t_P 445 26S proteasome regulatory subunit RPN5; hydrolase, 95.98
4b4t_P 445 26S proteasome regulatory subunit RPN5; hydrolase, 95.95
4fhn_B 1139 Nucleoporin NUP120; protein complex,structural pro 95.94
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 95.74
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 95.54
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 95.36
4b4t_R 429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 95.33
1qsa_A 618 Protein (soluble lytic transglycosylase SLT70); al 95.24
4gq2_M950 Nucleoporin NUP120; beta propeller alpha helical, 94.19
2wpv_A 312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 93.56
4b4t_S 523 RPN3, 26S proteasome regulatory subunit RPN3; hydr 93.48
1qsa_A 618 Protein (soluble lytic transglycosylase SLT70); al 93.09
3lpz_A 336 GET4 (YOR164C homolog); protein targeting, tail-an 90.86
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 89.92
3esl_A202 Checkpoint serine/threonine-protein kinase BUB1; m 88.78
3t5v_B 455 Nuclear mRNA export protein THP1; PCI, mRNA nuclea 88.54
4gq2_M950 Nucleoporin NUP120; beta propeller alpha helical, 88.4
3ax2_A73 Mitochondrial import receptor subunit TOM20 homol; 87.98
3t5v_B 455 Nuclear mRNA export protein THP1; PCI, mRNA nuclea 87.29
3t5x_A203 PCI domain-containing protein 2; PCI, mRNA nuclear 86.76
3t5x_A203 PCI domain-containing protein 2; PCI, mRNA nuclear 85.42
2cfu_A 658 SDSA1; SDS-hydrolase, lactamase, hydrolase; HET: 1 84.68
2ijq_A161 Hypothetical protein; structural genomics, PSI, pr 83.14
4aez_C223 MAD3, mitotic spindle checkpoint component MAD3; c 83.05
3ax2_A73 Mitochondrial import receptor subunit TOM20 homol; 82.84
3re2_A472 Predicted protein; menin, multiple endocrine neopl 82.74
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 82.21
2crb_A97 Nuclear receptor binding factor 2; NRBF-2, MIT dom 82.18
2crb_A97 Nuclear receptor binding factor 2; NRBF-2, MIT dom 82.11
1om2_A95 Protein (mitochondrial import receptor subunit TOM 81.99
3mv2_A325 Coatomer subunit alpha; vesicular membrane coat CO 81.25
4a1g_A152 Mitotic checkpoint serine/threonine-protein kinas; 80.5
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
Probab=99.95  E-value=1.6e-27  Score=156.19  Aligned_cols=145  Identities=12%  Similarity=0.020  Sum_probs=132.8

Q ss_pred             hcchhhhhccchhhhhhccccc--chhhHHHHHHHHhhHHHhcccHHHHHHHHHHHHccCCCcHHHHHHHHHHHHHcCCH
Q 029105           30 EHGLSGAELEKNDDNNEHQEPF--DAKQLALSFEAQGNNLAEDGKFREALGKWEAALNLRPENAVLHEQKAQVLLELGDA  107 (199)
Q Consensus        30 ~~g~~~~~~~~~~~A~~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~A~~~~~~~l~~~~~~~~~~~~la~~~~~~~~~  107 (199)
                      .+|.++...|++++|+..+.++  ..|..+..++.+|.+|+..|++++|+..|+++++++|+++.+|..+|.++...|++
T Consensus         2 ~LG~~~~~~~~~e~ai~~~~~a~~~~p~~~~~~~~la~~y~~~~~~~~A~~~~~~al~~~p~~~~a~~~lg~~~~~~~~~   81 (150)
T 4ga2_A            2 PLGSMRRSKADVERYIASVQGSTPSPRQKSIKGFYFAKLYYEAKEYDLAKKYICTYINVQERDPKAHRFLGLLYELEENT   81 (150)
T ss_dssp             -----CCCHHHHHHHHHHHHHHSCSHHHHHTTHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCH
T ss_pred             HhHHHHHHcChHHHHHHHHHHhcccCcccHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCch
Confidence            4688999999999999999988  78889999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHhhcccccHHHHHHHHHHHHhcCChHHHHHH-HHHHHhcCCCcHHHHHHHHHHHHHHhh
Q 029105          108 WNALKAATRATELEQSWAEAWITLGRAQLNFGEPDKAIES-FERALAIKPDSEEARDDRQTALHLVKR  174 (199)
Q Consensus       108 ~~A~~~~~~al~~~p~~~~~~~~lg~~~~~~~~~~~A~~~-~~~al~~~p~~~~~~~~l~~~~~~~~~  174 (199)
                      ++|+..|+++++++|+++.+++.+|.++...|++++|... ++++++++|+++.++...+.++...|+
T Consensus        82 ~~A~~~~~~al~~~p~~~~~~~~la~~~~~~~~~~~aa~~~~~~al~l~P~~~~~~~l~~~ll~~~G~  149 (150)
T 4ga2_A           82 DKAVECYRRSVELNPTQKDLVLKIAELLCKNDVTDGRAKYWVERAAKLFPGSPAVYKLKEQLLDCEGE  149 (150)
T ss_dssp             HHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHCSSSSHHHHHHHHHHHHSTTCHHHHHHHHHHHHTCCC
T ss_pred             HHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCChHHHHHHHHHHHHHhCcCCHHHHHHHHHHHHHhCc
Confidence            9999999999999999999999999999999999887765 599999999999999999988876654



>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3kae_A CDC27, possible protein of nuclear scaffold; tetratricopeptide repeat protein, protein binding; 2.30A {Encephalitozoon cuniculi} Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>4b4t_S RPN3, 26S proteasome regulatory subunit RPN3; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3kae_A CDC27, possible protein of nuclear scaffold; tetratricopeptide repeat protein, protein binding; 2.30A {Encephalitozoon cuniculi} Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1qsa_A Protein (soluble lytic transglycosylase SLT70); alpha-superhelix, transferase; HET: GOL; 1.65A {Escherichia coli} SCOP: a.118.5.1 d.2.1.6 PDB: 1qte_A* 1sly_A* Back     alignment and structure
>4gq2_M Nucleoporin NUP120; beta propeller alpha helical, component of nuclear pore COMP transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4fhm_B Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure
>4b4t_S RPN3, 26S proteasome regulatory subunit RPN3; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1qsa_A Protein (soluble lytic transglycosylase SLT70); alpha-superhelix, transferase; HET: GOL; 1.65A {Escherichia coli} SCOP: a.118.5.1 d.2.1.6 PDB: 1qte_A* 1sly_A* Back     alignment and structure
>3lpz_A GET4 (YOR164C homolog); protein targeting, tail-anchored protein biogenesis, GET PAT GET5 binding, protein transport; 1.98A {Chaetomium thermophilum} Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>3esl_A Checkpoint serine/threonine-protein kinase BUB1; mitotic spindle checkpoint, TPR motif, all-alpha domain, MAD3-like domain; HET: NHE; 1.74A {Saccharomyces cerevisiae} Back     alignment and structure
>3t5v_B Nuclear mRNA export protein THP1; PCI, mRNA nuclear export, mRNA, nuclear, transcription; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>4gq2_M Nucleoporin NUP120; beta propeller alpha helical, component of nuclear pore COMP transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4fhm_B Back     alignment and structure
>3ax2_A Mitochondrial import receptor subunit TOM20 homol; protein-protein complex, membrane protein-transport protein; 1.90A {Rattus norvegicus} PDB: 2v1s_A 3awr_A 2v1t_A 3ax5_A 3ax3_A Back     alignment and structure
>3t5v_B Nuclear mRNA export protein THP1; PCI, mRNA nuclear export, mRNA, nuclear, transcription; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3t5x_A PCI domain-containing protein 2; PCI, mRNA nuclear export, transcription; 2.12A {Homo sapiens} Back     alignment and structure
>3t5x_A PCI domain-containing protein 2; PCI, mRNA nuclear export, transcription; 2.12A {Homo sapiens} Back     alignment and structure
>2cfu_A SDSA1; SDS-hydrolase, lactamase, hydrolase; HET: 1DB; 1.9A {Pseudomonas aeruginosa} SCOP: d.106.1.3 d.157.1.13 PDB: 2cfz_A* 2cg2_A 2cg3_A* Back     alignment and structure
>2ijq_A Hypothetical protein; structural genomics, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 1.88A {Haloarcula marismortui} SCOP: a.246.2.1 Back     alignment and structure
>4aez_C MAD3, mitotic spindle checkpoint component MAD3; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3ax2_A Mitochondrial import receptor subunit TOM20 homol; protein-protein complex, membrane protein-transport protein; 1.90A {Rattus norvegicus} PDB: 2v1s_A 3awr_A 2v1t_A 3ax5_A 3ax3_A Back     alignment and structure
>3re2_A Predicted protein; menin, multiple endocrine neoplasia 1, tumor suppressor, MIX lineage leukemia, unknown function; 1.95A {Nematostella vectensis} Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>2crb_A Nuclear receptor binding factor 2; NRBF-2, MIT domain, helix bundle, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.7.16.1 Back     alignment and structure
>2crb_A Nuclear receptor binding factor 2; NRBF-2, MIT domain, helix bundle, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.7.16.1 Back     alignment and structure
>1om2_A Protein (mitochondrial import receptor subunit TOM20); mitochondrial protein import across outer membrane, receptor for presequences; NMR {Rattus norvegicus} SCOP: a.23.4.1 Back     alignment and structure
>3mv2_A Coatomer subunit alpha; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_A Back     alignment and structure
>4a1g_A Mitotic checkpoint serine/threonine-protein kinas; cell cycle, transferase, spindle assembly checkpoint, mitosi repeat, KNL1, KMN network; 2.60A {Homo sapiens} PDB: 2lah_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 199
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 8e-13
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 7e-12
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 1e-11
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 1e-07
d1w3ba_ 388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 2e-07
d1w3ba_ 388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 3e-07
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 5e-07
d1w3ba_ 388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 7e-05
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 0.002
d1zbpa1 264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 3e-10
d1zbpa1264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 2e-06
d1zbpa1 264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 6e-05
d2c2la1201 a.118.8.1 (A:24-224) STIP1 homology and U box-cont 7e-10
d2c2la1201 a.118.8.1 (A:24-224) STIP1 homology and U box-cont 0.004
d1ya0a1 497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 1e-09
d1a17a_159 a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo 3e-08
d1elra_128 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 5e-07
d1fcha_ 323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 8e-07
d1fcha_323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 9e-05
d1ihga1169 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos tau 2e-06
d1elwa_117 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 5e-06
d1nzna_122 a.118.8.1 (A:) Mitochondria fission protein Fis1 { 5e-06
d1dcea1334 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltr 6e-06
d1kt1a1168 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {M 7e-06
d2fbna1153 a.118.8.1 (A:22-174) Putative 70 kda peptidylproly 2e-05
d1xnfa_259 a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli 8e-05
d1hh8a_192 a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF- 1e-04
d1hh8a_192 a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF- 8e-04
d1p5qa1170 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal d 0.001
d2hr2a1156 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {C 0.002
d2ff4a2179 a.118.8.3 (A:105-283) Probable regulatory protein 0.002
d2h6fa1 315 a.118.6.1 (A:55-369) Protein farnesyltransferase a 0.002
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 63.9 bits (154), Expect = 8e-13
 Identities = 27/107 (25%), Positives = 44/107 (41%)

Query: 64  GNNLAEDGKFREALGKWEAALNLRPENAVLHEQKAQVLLELGDAWNALKAATRATELEQS 123
            N L E G   EA   +  AL L P +A      A +  E G+   A++   +A E+   
Sbjct: 278 ANALKEKGSVAEAEDCYNTALRLCPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPE 337

Query: 124 WAEAWITLGRAQLNFGEPDKAIESFERALAIKPDSEEARDDRQTALH 170
           +A A   L       G+  +A+  ++ A+ I P   +A  +    L 
Sbjct: 338 FAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLK 384


>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 201 Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 201 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Length = 159 Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Length = 169 Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Length = 122 Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 334 Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 168 Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Length = 153 Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Length = 192 Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Length = 192 Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Length = 156 Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 179 Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 315 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query199
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.91
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.91
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.9
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.89
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.89
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.89
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.88
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.87
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.87
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.86
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.86
d2h6fa1 315 Protein farnesyltransferase alpha-subunit {Human ( 99.86
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.85
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 99.85
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.85
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.83
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 99.83
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.83
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.82
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 99.81
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.81
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.8
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.79
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.76
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.75
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.74
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.74
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.74
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 99.71
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 99.69
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 99.68
d1dcea1 334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.67
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 99.67
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 99.65
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 99.64
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.64
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 99.64
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.62
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 99.6
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 99.5
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.45
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 99.43
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.41
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 99.4
d1zbpa1 264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 99.39
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 99.36
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 99.36
d1hz4a_ 366 Transcription factor MalT domain III {Escherichia 99.34
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.32
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 99.15
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 99.11
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 99.09
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 98.96
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 98.83
d1ouva_ 265 Cysteine rich protein C (HcpC) {Helicobacter pylor 98.78
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 98.58
d1b89a_ 336 Clathrin heavy chain proximal leg segment {Cow (Bo 95.5
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 95.5
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 95.13
d1b89a_ 336 Clathrin heavy chain proximal leg segment {Cow (Bo 89.38
d2crba183 Nuclear receptor binding factor 2, NRBF2, N-termin 88.7
d2crba183 Nuclear receptor binding factor 2, NRBF2, N-termin 88.45
d2cfua2505 Alkylsulfatase SdsA1 {Pseudomonas aeruginosa [TaxI 88.27
d2cfua2505 Alkylsulfatase SdsA1 {Pseudomonas aeruginosa [TaxI 81.6
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 81.18
d1om2a_95 Mitochondrial import receptor subunit Tom20 {Rat ( 80.47
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor)
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.91  E-value=1.4e-23  Score=151.57  Aligned_cols=160  Identities=17%  Similarity=0.132  Sum_probs=115.6

Q ss_pred             hhcchhhhhccchhhhhhccccc--chhhHHHHHHHHhhHHHhcccHHHHHHHHHHHHccCCCcHHHHHHH---------
Q 029105           29 QEHGLSGAELEKNDDNNEHQEPF--DAKQLALSFEAQGNNLAEDGKFREALGKWEAALNLRPENAVLHEQK---------   97 (199)
Q Consensus        29 ~~~g~~~~~~~~~~~A~~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~A~~~~~~~l~~~~~~~~~~~~l---------   97 (199)
                      ++.|..++..|++++|+..|.++  .+|.++.++..+|.++...|++++|+..|.++++++|+++..+..+         
T Consensus        23 ~~~g~~~~~~g~~~~A~~~~~~al~~~P~~~~a~~~lg~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~~~  102 (323)
T d1fcha_          23 FEEGLRRLQEGDLPNAVLLFEAAVQQDPKHMEAWQYLGTTQAENEQELLAISALRRCLELKPDNQTALMALAVSFTNESL  102 (323)
T ss_dssp             HHHHHHHHHTTCHHHHHHHHHHHHHSCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTC
T ss_pred             HHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCChHHHHHHHHhhhcccccccccccccccccccccc
Confidence            45677777777777777777776  6666777777777777777777777777777776666655544444         


Q ss_pred             ----------------------------------------------------------------------------HHHH
Q 029105           98 ----------------------------------------------------------------------------AQVL  101 (199)
Q Consensus        98 ----------------------------------------------------------------------------a~~~  101 (199)
                                                                                                  |.++
T Consensus       103 ~~~A~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~al~~~p~~~~~~~~~~l~~~~  182 (323)
T d1fcha_         103 QRQACEILRDWLRYTPAYAHLVTPAEEGAGGAGLGPSKRILGSLLSDSLFLEVKELFLAAVRLDPTSIDPDVQCGLGVLF  182 (323)
T ss_dssp             HHHHHHHHHHHHHTSTTTGGGCC---------------CTTHHHHHHHHHHHHHHHHHHHHHHSTTSCCHHHHHHHHHHH
T ss_pred             ccccccchhhHHHhccchHHHHHhhhhhhhhcccccchhhHHHHHHhhHHHHHHHHHHHHHHHhhcccccccchhhHHHH
Confidence                                                                                        4455


Q ss_pred             HHcCCHHHHHHHHHHHhhcccccHHHHHHHHHHHHhcCChHHHHHHHHHHHhcCCCcHHHHHHHHHHHHHHhhhhhhhhh
Q 029105          102 LELGDAWNALKAATRATELEQSWAEAWITLGRAQLNFGEPDKAIESFERALAIKPDSEEARDDRQTALHLVKRRKHLHLS  181 (199)
Q Consensus       102 ~~~~~~~~A~~~~~~al~~~p~~~~~~~~lg~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~l~~~~~~~~~~~~a~~~  181 (199)
                      ...|++++|+..+++++..+|+++.+|..+|.++..+|++++|+..|+++++++|+++.++.++|.++..+|++++|...
T Consensus       183 ~~~~~~~~A~~~~~~al~~~p~~~~~~~~lg~~~~~~g~~~~A~~~~~~al~~~p~~~~a~~~lg~~~~~~g~~~~A~~~  262 (323)
T d1fcha_         183 NLSGEYDKAVDCFTAALSVRPNDYLLWNKLGATLANGNQSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAVEH  262 (323)
T ss_dssp             HHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHTCHHHHHHH
T ss_pred             HHHHHHhhhhcccccccccccccccchhhhhhcccccccchhHHHHHHHHHHHhhccHHHHHHHHHHHHHCCCHHHHHHH
Confidence            55555666666667777777777777888888888888888888888888888888888888888888888888887776


Q ss_pred             cccccch
Q 029105          182 GLSNDAN  188 (199)
Q Consensus       182 ~~~~~~~  188 (199)
                      +..+.+.
T Consensus       263 ~~~al~l  269 (323)
T d1fcha_         263 FLEALNM  269 (323)
T ss_dssp             HHHHHHH
T ss_pred             HHHHHHh
Confidence            6655543



>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2crba1 a.7.16.1 (A:8-90) Nuclear receptor binding factor 2, NRBF2, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2crba1 a.7.16.1 (A:8-90) Nuclear receptor binding factor 2, NRBF2, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cfua2 d.157.1.13 (A:20-524) Alkylsulfatase SdsA1 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2cfua2 d.157.1.13 (A:20-524) Alkylsulfatase SdsA1 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1om2a_ a.23.4.1 (A:) Mitochondrial import receptor subunit Tom20 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure