Citrus Sinensis ID: 029131

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------20

MSELVARTGRHQQRYEAGCRLVAGCIPFKYRNRNCEEGDGDGDGDGRSEKIVEVLMINSTSGPGLLFPKGGWENDETVEEAALREALEEAGVRGHLKEFLGYYDFKSKTLQDEFSPEGLCKAAMFALLVKEELESWPEQSTRQRSWLTVPEAIECCRHPWMQEALEKGFLKLYADHMISTSKEANHIDSPVHCQGIFD

cccccccccccccccccccEEEEEEEEEccccccccccccccccccccccEEEEEEEEEccccccccccccccccccHHHHHHHHHHHHcccEEEEcEEcEEEEEEccccccccccccEEEEEEEEEEEEEcccccccccccEEEEEcHHHHHHHcccHHHHHHHHHHHHHHHccccccccccccccccccccccccc

ccEEEEccccccEEcccccEEEEEEEEEEEEEccccccccccccccccccEEEEEEEEccccccEEEccccccccccHHHHHHHHHHHHcccEEEEEccccEEEEcccccccccccccccEEEEEEEEEEHHHHcccHHHccccEEEcHHHHHHHHccHHHHHHHHHHHHHHHHHHcccccccccccccccccccccc

MSELVARTGRHQQRYEAGCRLVagcipfkyrnrnceegdgdgdgdgrSEKIVEVLMINstsgpgllfpkggwendETVEEAALREALEEAGVRGHLKEFLGyydfksktlqdefspegLCKAAMFALLVKEELeswpeqstrqrswltvpeaieccrhpwmQEALEKGFLKLYADHMIStskeanhidspvhcqgifd

mselvartgrhqqryeagcrlvaGCIPFKyrnrnceegdgdgdgdgRSEKIVEVLMINstsgpgllfpkgGWENDETVEEAALREALEEAGVRGHLKEFLGYYDFKSKTLQDEFSPEGLCKAAMFALLVKEELEswpeqstrqrswltVPEAIECCRHPWMQEALEKGFLKLYADHMISTskeanhidspVHCQGIFD

MSELVARTGRHQQRYEAGCRLVAGCIPFKYRNRNCEEgdgdgdgdgRSEKIVEVLMINSTSGPGLLFPKGGWENDETVeeaalrealeeaGVRGHLKEFLGYYDFKSKTLQDEFSPEGLCKAAMFALLVKEELESWPEQSTRQRSWLTVPEAIECCRHPWMQEALEKGFLKLYADHMISTSKEANHIDSPVHCQGIFD

*************RYEAGCRLVAGCIPFKYRNRNC***************IVEVLMINSTSGPGLLFPKGGWENDETVEEAALREALEEAGVRGHLKEFLGYYDFKSKTLQDEFSPEGLCKAAMFALLVKEELESWPEQSTRQRSWLTVPEAIECCRHPWMQEALEKGFLKLYADHMIST******************

*************RYEAGCRLVAGCIPFKYRNRNCEEGDGDGDGDGRSEKIVEVLMINSTSGPGLLFPKGGWENDETVEEAALREALEEAGVRGHLKEFLGYYDFKSKTLQDEFSPEGLCKAAMFALLVKEELESWPEQSTRQRSWLTVPEAIECCRHPWMQEALEKGFL****************************

***********QQRYEAGCRLVAGCIPFKYRNRNCEEGDGDGDGDGRSEKIVEVLMINSTSGPGLLFPKGGWENDETVEEAALREALEEAGVRGHLKEFLGYYDFKSKTLQDEFSPEGLCKAAMFALLVKEEL************WLTVPEAIECCRHPWMQEALEKGFLKLYADHMISTSKEANHIDSPVHCQGIFD

*SELVARTGRHQQRYEAGCRLVAGCIPFKYRNRN************RSEKIVEVLMINSTSGPGLLFPKGGWENDETVEEAALREALEEAGVRGHLKEFLGYYDFKSKTLQDEFSPEGLCKAAMFALLVKEELESWPEQSTRQRSWLTVPEAIECCRHPWMQEALEKGFLKLYADHM******************IF*

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MSELVARTGRHQQRYEAGCRLVAGCIPFKYRNRNCEEGDGDGDGDGRSEKIVEVLMINSTSGPGLLFPKGGWENDETVEEAALREALEEAGVRGHLKEFLGYYDFKSKTLQDEFSPEGLCKAAMFALLVKEELESWPEQSTRQRSWLTVPEAIECCRHPWMQEALEKGFLKLYADHMISTSKEANHIDSPVHCQGIFD

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		198	2.2.26 [Sep-21-2011]
Q9LHK1		180	Nudix hydrolase 16, mitoc	yes	no	0.863	0.95	0.674	4e-59
Q93ZY7		203	Nudix hydrolase 12, mitoc	no	no	0.974	0.950	0.485	9e-42
Q52K88		202	Nudix hydrolase 13, mitoc	no	no	0.944	0.925	0.484	4e-39
Q9LE73		207	Nudix hydrolase 4 OS=Arab	no	no	0.757	0.724	0.462	1e-36
Q9ZU95		182	Nudix hydrolase 17, mitoc	no	no	0.742	0.807	0.509	1e-35
Q9LQU5		176	Nudix hydrolase 18, mitoc	no	no	0.742	0.835	0.503	5e-35
Q8VY81		198	Nudix hydrolase 21, chlor	no	no	0.722	0.722	0.472	3e-33
Q09790		210	Diphosphoinositol polypho	yes	no	0.666	0.628	0.271	1e-10
P0C028		164	Diphosphoinositol polypho	yes	no	0.580	0.701	0.358	3e-09
P0C027		164	Diphosphoinositol polypho	yes	no	0.580	0.701	0.358	3e-09

>sp\|Q9LHK1\|NUD16_ARATH Nudix hydrolase 16, mitochondrial OS=Arabidopsis thaliana GN=NUDT16 PE=2 SV=1	Back alignment and function desciption

 Score =  227 bits (579), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 120/178 (67%), Positives = 142/178 (79%), Gaps = 7/178 (3%)

Query: 1   MSELVARTGRHQQRYEAGCRLVAGCIPFKYRNRNCEEGDGDGDGDGRSEKIVEVLMINST 60
           M +LVARTGR QQRYE G RLVAGCIPF+Y N        D DG+  S K+++VLMI+S+
Sbjct: 1   MCDLVARTGRLQQRYEDGSRLVAGCIPFRYVN-------SDKDGNSESGKVIQVLMISSS 53

Query: 61  SGPGLLFPKGGWENDETVEEAALREALEEAGVRGHLKEFLGYYDFKSKTLQDEFSPEGLC 120
           SGPGLLFPKGGWENDETV EAA REA+EEAGVRG L +FLG Y+FKSK+ QDEFSPEGLC
Sbjct: 54  SGPGLLFPKGGWENDETVREAAAREAVEEAGVRGILMDFLGNYEFKSKSHQDEFSPEGLC 113

Query: 121 KAAMFALLVKEELESWPEQSTRQRSWLTVPEAIECCRHPWMQEALEKGFLKLYADHMI 178
           KAAM+AL VKEEL +WPE  TR R WLT+ EA+E CRHPWM++AL +GF K + + M+
Sbjct: 114 KAAMYALYVKEELATWPEHETRTRKWLTIEEAVESCRHPWMKDALVEGFCKWHKEKMV 171

Probably mediates the hydrolysis of some nucleoside diphosphate derivatives.
Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 6EC: .EC: 1EC: .EC: -

>sp\|Q93ZY7\|NUD12_ARATH Nudix hydrolase 12, mitochondrial OS=Arabidopsis thaliana GN=NUDT12 PE=2 SV=1	Back alignment and function description

>sp\|Q52K88\|NUD13_ARATH Nudix hydrolase 13, mitochondrial OS=Arabidopsis thaliana GN=NUDT13 PE=1 SV=1	Back alignment and function description

>sp\|Q9LE73\|NUDT4_ARATH Nudix hydrolase 4 OS=Arabidopsis thaliana GN=NUDT4 PE=1 SV=1	Back alignment and function description

>sp\|Q9ZU95\|NUD17_ARATH Nudix hydrolase 17, mitochondrial OS=Arabidopsis thaliana GN=NUDT17 PE=2 SV=1	Back alignment and function description

>sp\|Q9LQU5\|NUD18_ARATH Nudix hydrolase 18, mitochondrial OS=Arabidopsis thaliana GN=NUDT18 PE=2 SV=1	Back alignment and function description

>sp\|Q8VY81\|NUD21_ARATH Nudix hydrolase 21, chloroplastic OS=Arabidopsis thaliana GN=NUDT21 PE=2 SV=1	Back alignment and function description

>sp\|Q09790\|APS1_SCHPO Diphosphoinositol polyphosphate phosphohydrolase aps1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=aps1 PE=1 SV=1	Back alignment and function description

>sp\|P0C028\|NUD11_MOUSE Diphosphoinositol polyphosphate phosphohydrolase 3-beta OS=Mus musculus GN=Nudt11 PE=1 SV=1	Back alignment and function description

>sp\|P0C027\|NUD10_MOUSE Diphosphoinositol polyphosphate phosphohydrolase 3-alpha OS=Mus musculus GN=Nudt10 PE=1 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		198
225441226		182	PREDICTED: nudix hydrolase 16, mitochond	0.909	0.989	0.787	2e-74
225465819		180	PREDICTED: nudix hydrolase 16, mitochond	0.868	0.955	0.766	8e-72
255543939		169	diphosphoinositol polyphosphate phosphoh	0.853	1.0	0.762	1e-69
356539521		174	PREDICTED: nudix hydrolase 16, mitochond	0.797	0.908	0.759	3e-66
356548857		175	PREDICTED: nudix hydrolase 16, mitochond	0.878	0.994	0.701	5e-66
224072923		168	predicted protein [Populus trichocarpa]	0.848	1.0	0.717	3e-65
356556803		175	PREDICTED: nudix hydrolase 16, mitochond	0.878	0.994	0.695	1e-64
297829800		180	hypothetical protein ARALYDRAFT_478618 [	0.858	0.944	0.683	9e-64
224139728		171	predicted protein [Populus trichocarpa]	0.863	1.0	0.752	1e-63
357515213		175	Nudix hydrolase [Medicago truncatula] gi	0.848	0.96	0.702	2e-63

>gi\|225441226\|ref\|XP_002272200.1\| PREDICTED: nudix hydrolase 16, mitochondrial [Vitis vinifera] gi\|147852980\|emb\|CAN81261.1\| hypothetical protein VITISV_019710 [Vitis vinifera] gi\|297739943\|emb\|CBI30125.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

 Score =  284 bits (726), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 148/188 (78%), Positives = 158/188 (84%), Gaps = 8/188 (4%)

Query: 1   MSELVARTGRHQQRYEAGCRLVAGCIPFKYRNRNCEEGDGDGDGDGRSEKIVEVLMINST 60
           MSELVARTGRHQQRYE GCRLVAGCIPFKYRN    E +G       S+KIVEVLMINST
Sbjct: 1   MSELVARTGRHQQRYEDGCRLVAGCIPFKYRNSV--ESNGAA-----SQKIVEVLMINST 53

Query: 61  SGPGLLFPKGGWENDETVEEAALREALEEAGVRGHLKEFLGYYDFKSKTLQDEFSPEGLC 120
           SGPGLLFPKGGWENDETVEEAALREALEEAGVRG LK FLG Y FKSKTLQDE  PEGLC
Sbjct: 54  SGPGLLFPKGGWENDETVEEAALREALEEAGVRGDLKHFLGCYLFKSKTLQDESCPEGLC 113

Query: 121 KAAMFALLVKEELESWPEQSTRQRSWLTVPEAIECCRHPWMQEALEKGFLKLYADHMIST 180
           KAAMFALLVKEEL SWPEQSTR+RSWLT+PEAIE CRHPWM++ALE+GF K + DH+   
Sbjct: 114 KAAMFALLVKEELPSWPEQSTRERSWLTIPEAIERCRHPWMRKALEEGFSKWHDDHLKIN 173

Query: 181 SKEAN-HI 187
            KE + HI
Sbjct: 174 GKEEDIHI 181

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|225465819\|ref\|XP_002264026.1\| PREDICTED: nudix hydrolase 16, mitochondrial [Vitis vinifera] gi\|296087852\|emb\|CBI35108.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|255543939\|ref\|XP_002513032.1\| diphosphoinositol polyphosphate phosphohydrolase, putative [Ricinus communis] gi\|223548043\|gb\|EEF49535.1\| diphosphoinositol polyphosphate phosphohydrolase, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|356539521\|ref\|XP_003538246.1\| PREDICTED: nudix hydrolase 16, mitochondrial-like [Glycine max]	Back alignment and taxonomy information

>gi\|356548857\|ref\|XP_003542815.1\| PREDICTED: nudix hydrolase 16, mitochondrial-like [Glycine max]	Back alignment and taxonomy information

>gi\|224072923\|ref\|XP_002303936.1\| predicted protein [Populus trichocarpa] gi\|222841368\|gb\|EEE78915.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|356556803\|ref\|XP_003546710.1\| PREDICTED: nudix hydrolase 16, mitochondrial-like [Glycine max]	Back alignment and taxonomy information

>gi\|297829800\|ref\|XP_002882782.1\| hypothetical protein ARALYDRAFT_478618 [Arabidopsis lyrata subsp. lyrata] gi\|297328622\|gb\|EFH59041.1\| hypothetical protein ARALYDRAFT_478618 [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

>gi\|224139728\|ref\|XP_002323248.1\| predicted protein [Populus trichocarpa] gi\|222867878\|gb\|EEF05009.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|357515213\|ref\|XP_003627895.1\| Nudix hydrolase [Medicago truncatula] gi\|355521917\|gb\|AET02371.1\| Nudix hydrolase [Medicago truncatula] gi\|388494930\|gb\|AFK35531.1\| unknown [Medicago truncatula]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		198
TAIR\|locus:2091275		180	NUDT16 "nudix hydrolase homolo	0.863	0.95	0.606	1.6e-54
TAIR\|locus:2010331		203	NUDT12 "nudix hydrolase homolo	0.964	0.940	0.445	2.7e-36
TAIR\|locus:2090842		202	NUDX13 "nudix hydrolase homolo	0.919	0.900	0.463	1.7e-34
TAIR\|locus:2014164		207	NUDT4 "nudix hydrolase homolog	0.792	0.758	0.408	7.1e-29
TAIR\|locus:2065440		182	NUDT17 "nudix hydrolase homolo	0.742	0.807	0.441	1e-27
TAIR\|locus:2006817		176	NUDT18 "nudix hydrolase homolo	0.742	0.835	0.447	1.7e-27
TAIR\|locus:2206835		198	NUDT21 "nudix hydrolase homolo	0.722	0.722	0.412	5.2e-26
UNIPROTKB\|G4MKT5		168	MGG_06680 "Nudix/MutT family p	0.621	0.732	0.302	1.2e-14
ASPGD\|ASPL0000000420		159	ndxD [Emericella nidulans (tax	0.585	0.729	0.305	2.6e-13
UNIPROTKB\|Q8NFP7		164	NUDT10 "Diphosphoinositol poly	0.580	0.701	0.328	1.4e-07

TAIR\|locus:2091275 NUDT16 "nudix hydrolase homolog 16" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 563 (203.2 bits), Expect = 1.6e-54, P = 1.6e-54
 Identities = 108/178 (60%), Positives = 130/178 (73%)

Query:     1 MSELVARTGRHQQRYEAGCRLVAGCIPFKYRNRNCEEXXXXXXXXXRSEKIVEVLMINST 60
             M +LVARTGR QQRYE G RLVAGCIPF+Y N + +           S K+++VLMI+S+
Sbjct:     1 MCDLVARTGRLQQRYEDGSRLVAGCIPFRYVNSDKD-------GNSESGKVIQVLMISSS 53

Query:    61 SGPGLLFPKGGWENDETVXXXXXXXXXXXXGVRGHLKEFLGYYDFKSKTLQDEFSPEGLC 120
             SGPGLLFPKGGWENDETV            GVRG L +FLG Y+FKSK+ QDEFSPEGLC
Sbjct:    54 SGPGLLFPKGGWENDETVREAAAREAVEEAGVRGILMDFLGNYEFKSKSHQDEFSPEGLC 113

Query:   121 KAAMFALLVKEELESWPEQSTRQRSWLTVPEAIECCRHPWMQEALEKGFLKLYADHMI 178
             KAAM+AL VKEEL +WPE  TR R WLT+ EA+E CRHPWM++AL +GF K + + M+
Sbjct:   114 KAAMYALYVKEELATWPEHETRTRKWLTIEEAVESCRHPWMKDALVEGFCKWHKEKMV 171

GO:0005739 "mitochondrion" evidence=ISM

GO:0016787 "hydrolase activity" evidence=IEA;ISS

TAIR\|locus:2010331 NUDT12 "nudix hydrolase homolog 12" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2090842 NUDX13 "nudix hydrolase homolog 13" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2014164 NUDT4 "nudix hydrolase homolog 4" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2065440 NUDT17 "nudix hydrolase homolog 17" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2006817 NUDT18 "nudix hydrolase homolog 18" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2206835 NUDT21 "nudix hydrolase homolog 21" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

UNIPROTKB\|G4MKT5 MGG_06680 "Nudix/MutT family protein" [Magnaporthe oryzae 70-15 (taxid:242507)]	Back alignment and assigned GO terms

ASPGD\|ASPL0000000420 ndxD [Emericella nidulans (taxid:162425)]	Back alignment and assigned GO terms

UNIPROTKB\|Q8NFP7 NUDT10 "Diphosphoinositol polyphosphate phosphohydrolase 3-alpha" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
Q9LHK1	NUD16_ARATH	3, ., 6, ., 1, ., -	0.6741	0.8636	0.95	yes	no

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

Prediction Level	EC number	Confidence of Prediction
3rd Layer	3.6.1	0.766
3rd Layer	3.6.1.13	0.824

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	GSVIVG00000650001	SubName- Full=Putative uncharacterized protein (Chromosome chr8 scaffold_106, whole genome shotgun sequence); (182 aa)
		(Vitis vinifera)
Predicted Functional Partners:
		Sorry, there are no predicted associations at the current settings.

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		198
cd04666		122	cd04666, Nudix_Hydrolase_9, Members of the Nudix h	7e-39
pfam00293		133	pfam00293, NUDIX, NUDIX domain	9e-13
cd03673		131	cd03673, Ap6A_hydrolase, Diadenosine hexaphosphate	3e-09
cd02883		123	cd02883, Nudix_Hydrolase, Nudix hydrolase is a sup	3e-08
COG1051		145	COG1051, COG1051, ADP-ribose pyrophosphatase [Nucl	2e-07
cd03671		147	cd03671, Ap4A_hydrolase_plant_like, Diadenosine te	7e-07
cd03675		134	cd03675, Nudix_Hydrolase_2, Contains a crystal str	7e-07
COG0494		161	COG0494, MutT, NTP pyrophosphohydrolases including	1e-06
cd03424		137	cd03424, ADPRase_NUDT5, ADP-ribose pyrophosphatase	1e-06
cd03428		130	cd03428, Ap4A_hydrolase_human_like, Diadenosine te	1e-06
cd04665		118	cd04665, Nudix_Hydrolase_8, Members of the Nudix h	4e-06
cd04680		120	cd04680, Nudix_Hydrolase_21, Members of the Nudix	6e-06
cd04687		128	cd04687, Nudix_Hydrolase_28, Members of the Nudix	9e-06
cd04511		130	cd04511, Nudix_Hydrolase_4, Members of the Nudix h	9e-06
cd03427		137	cd03427, MTH1, MutT homolog-1 (MTH1) is a member o	2e-05
PRK00714		156	PRK00714, PRK00714, RNA pyrophosphohydrolase; Revi	5e-05
cd03426		157	cd03426, CoAse, Coenzyme A pyrophosphatase (CoAse)	1e-04
TIGR02705		156	TIGR02705, nudix_YtkD, nucleoside triphosphatase Y	4e-04
cd04684		128	cd04684, Nudix_Hydrolase_25, Contains a crystal st	6e-04
cd04700		142	cd04700, DR1025_like, DR1025 from Deinococcus radi	6e-04
cd04669		121	cd04669, Nudix_Hydrolase_11, Members of the Nudix	8e-04
cd04673		122	cd04673, Nudix_Hydrolase_15, Members of the Nudix	0.001
PRK11762		185	PRK11762, nudE, adenosine nucleotide hydrolase Nud	0.002

>gnl\|CDD\|240024 cd04666, Nudix_Hydrolase_9, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X	Back alignment and domain information

 Score =  129 bits (326), Expect = 7e-39
 Identities = 50/143 (34%), Positives = 70/143 (48%), Gaps = 22/143 (15%)

Query: 21  LVAGCIPFKYRNRNCEEGDGDGDGDGRSEKIVEVLMINSTSGPGLLFPKGGWENDETVEE 80
           L AG IP++                      VEVL++ S      + PKGG E DE+  E
Sbjct: 1   LQAGAIPYRETG-----------------GEVEVLLVTSRRTGRWIVPKGGPEKDESPAE 43

Query: 81  AALREALEEAGVRGHL-KEFLGYYDFKSKTLQDEFSPEGLCKAAMFALLVKEELESWPEQ 139
           AA REA EEAGVRG + K  LG ++++ ++          C+ A+F L V EEL+ WPE 
Sbjct: 44  AAAREAWEEAGVRGKIGKRPLGRFEYRKRSKN----RPPRCEVAVFPLEVTEELDEWPEM 99

Query: 140 STRQRSWLTVPEAIECCRHPWMQ 162
             R+R W +  EA      P ++
Sbjct: 100 HQRKRKWFSPEEAALLVEEPELK 122

Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity and contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate specificity are determined by the N-terminal extension or by residues in variable loop regions. Mechanistically, substrate hydrolysis occurs by a nucleophilic substitution reaction, with variation in the numbers and roles of divalent cations required. Length = 122

>gnl\|CDD\|215841 pfam00293, NUDIX, NUDIX domain	Back alignment and domain information

>gnl\|CDD\|239645 cd03673, Ap6A_hydrolase, Diadenosine hexaphosphate (Ap6A) hydrolase is a member of the Nudix hydrolase superfamily	Back alignment and domain information

>gnl\|CDD\|239217 cd02883, Nudix_Hydrolase, Nudix hydrolase is a superfamily of enzymes found in all three kingdoms of life, and it catalyzes the hydrolysis of NUcleoside DIphosphates linked to other moieties, X	Back alignment and domain information

>gnl\|CDD\|223979 COG1051, COG1051, ADP-ribose pyrophosphatase [Nucleotide transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|239643 cd03671, Ap4A_hydrolase_plant_like, Diadenosine tetraphosphate (Ap4A) hydrolase is a member of the Nudix hydrolase superfamily	Back alignment and domain information

>gnl\|CDD\|239647 cd03675, Nudix_Hydrolase_2, Contains a crystal structure of the Nudix hydrolase from Nitrosomonas europaea, which has an unknown function	Back alignment and domain information

>gnl\|CDD\|223568 COG0494, MutT, NTP pyrophosphohydrolases including oxidative damage repair enzymes [DNA replication, recombination, and repair / General function prediction only]	Back alignment and domain information

>gnl\|CDD\|239516 cd03424, ADPRase_NUDT5, ADP-ribose pyrophosphatase (ADPRase) catalyzes the hydrolysis of ADP-ribose and a variety of additional ADP-sugar conjugates to AMP and ribose-5-phosphate	Back alignment and domain information

>gnl\|CDD\|239520 cd03428, Ap4A_hydrolase_human_like, Diadenosine tetraphosphate (Ap4A) hydrolase is a member of the Nudix hydrolase superfamily	Back alignment and domain information

>gnl\|CDD\|240023 cd04665, Nudix_Hydrolase_8, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X	Back alignment and domain information

>gnl\|CDD\|240036 cd04680, Nudix_Hydrolase_21, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X	Back alignment and domain information

>gnl\|CDD\|240043 cd04687, Nudix_Hydrolase_28, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X	Back alignment and domain information

>gnl\|CDD\|239948 cd04511, Nudix_Hydrolase_4, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X	Back alignment and domain information

>gnl\|CDD\|239519 cd03427, MTH1, MutT homolog-1 (MTH1) is a member of the Nudix hydrolase superfamily	Back alignment and domain information

>gnl\|CDD\|234820 PRK00714, PRK00714, RNA pyrophosphohydrolase; Reviewed	Back alignment and domain information

>gnl\|CDD\|239518 cd03426, CoAse, Coenzyme A pyrophosphatase (CoAse), a member of the Nudix hydrolase superfamily, functions to catalyze the elimination of oxidized inactive CoA, which can inhibit CoA-utilizing enzymes	Back alignment and domain information

>gnl\|CDD\|131752 TIGR02705, nudix_YtkD, nucleoside triphosphatase YtkD	Back alignment and domain information

>gnl\|CDD\|240040 cd04684, Nudix_Hydrolase_25, Contains a crystal structure of the Nudix hydrolase from Enterococcus faecalis, which has an unknown function	Back alignment and domain information

>gnl\|CDD\|240055 cd04700, DR1025_like, DR1025 from Deinococcus radiodurans, a member of the Nudix hydrolase superfamily, show nucleoside triphosphatase and dinucleoside polyphosphate pyrophosphatase activities	Back alignment and domain information

>gnl\|CDD\|240026 cd04669, Nudix_Hydrolase_11, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X	Back alignment and domain information

>gnl\|CDD\|240030 cd04673, Nudix_Hydrolase_15, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X	Back alignment and domain information

>gnl\|CDD\|183303 PRK11762, nudE, adenosine nucleotide hydrolase NudE; Provisional	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		198
cd03673		131	Ap6A_hydrolase Diadenosine hexaphosphate (Ap6A) hy	99.91
cd04666		122	Nudix_Hydrolase_9 Members of the Nudix hydrolase s	99.91
KOG2839		145	consensus Diadenosine and diphosphoinositol polyph	99.9
cd03428		130	Ap4A_hydrolase_human_like Diadenosine tetraphospha	99.88
cd04684		128	Nudix_Hydrolase_25 Contains a crystal structure of	99.87
PRK09438		148	nudB dihydroneopterin triphosphate pyrophosphatase	99.87
cd04695		131	Nudix_Hydrolase_36 Members of the Nudix hydrolase	99.87
cd03674		138	Nudix_Hydrolase_1 Members of the Nudix hydrolase s	99.86
cd03430		144	GDPMH GDP-mannose glycosyl hydrolase (AKA GDP-mann	99.85
cd04679		125	Nudix_Hydrolase_20 Members of the Nudix hydrolase	99.84
cd04700		142	DR1025_like DR1025 from Deinococcus radiodurans, a	99.84
cd04680		120	Nudix_Hydrolase_21 Members of the Nudix hydrolase	99.84
cd03675		134	Nudix_Hydrolase_2 Contains a crystal structure of	99.84
PRK15434		159	GDP-mannose mannosyl hydrolase NudD; Provisional	99.84
cd03672		145	Dcp2p mRNA decapping enzyme 2 (Dcp2p), the catalyt	99.83
cd04687		128	Nudix_Hydrolase_28 Members of the Nudix hydrolase	99.83
PLN02325		144	nudix hydrolase	99.83
PF00293		134	NUDIX: NUDIX domain; InterPro: IPR000086 The gener	99.83
cd04696		125	Nudix_Hydrolase_37 Members of the Nudix hydrolase	99.83
cd04664		129	Nudix_Hydrolase_7 Members of the Nudix hydrolase s	99.83
cd04673		122	Nudix_Hydrolase_15 Members of the Nudix hydrolase	99.83
cd04676		129	Nudix_Hydrolase_17 Members of the Nudix hydrolase	99.82
cd04677		132	Nudix_Hydrolase_18 Members of the Nudix hydrolase	99.82
cd03427		137	MTH1 MutT homolog-1 (MTH1) is a member of the Nudi	99.82
cd04681		130	Nudix_Hydrolase_22 Members of the Nudix hydrolase	99.82
cd04688		126	Nudix_Hydrolase_29 Members of the Nudix hydrolase	99.82
cd04690		118	Nudix_Hydrolase_31 Members of the Nudix hydrolase	99.81
cd04667		112	Nudix_Hydrolase_10 Members of the Nudix hydrolase	99.81
cd04689		125	Nudix_Hydrolase_30 Members of the Nudix hydrolase	99.81
cd04672		123	Nudix_Hydrolase_14 Members of the Nudix hydrolase	99.81
cd03671		147	Ap4A_hydrolase_plant_like Diadenosine tetraphospha	99.81
cd04678		129	Nudix_Hydrolase_19 Members of the Nudix hydrolase	99.8
cd04511		130	Nudix_Hydrolase_4 Members of the Nudix hydrolase s	99.8
COG1051		145	ADP-ribose pyrophosphatase [Nucleotide transport a	99.8
cd04669		121	Nudix_Hydrolase_11 Members of the Nudix hydrolase	99.8
PRK10546		135	pyrimidine (deoxy)nucleoside triphosphate pyrophos	99.8
cd04683		120	Nudix_Hydrolase_24 Members of the Nudix hydrolase	99.8
cd03429		131	NADH_pyrophosphatase NADH pyrophosphatase, a membe	99.8
cd04670		127	Nudix_Hydrolase_12 Members of the Nudix hydrolase	99.79
cd04686		131	Nudix_Hydrolase_27 Members of the Nudix hydrolase	99.79
PRK15472		141	nucleoside triphosphatase NudI; Provisional	99.79
cd04671		123	Nudix_Hydrolase_13 Members of the Nudix hydrolase	99.78
cd04682		122	Nudix_Hydrolase_23 Members of the Nudix hydrolase	99.78
cd03424		137	ADPRase_NUDT5 ADP-ribose pyrophosphatase (ADPRase)	99.78
cd03426		157	CoAse Coenzyme A pyrophosphatase (CoAse), a member	99.78
cd04691		117	Nudix_Hydrolase_32 Members of the Nudix hydrolase	99.77
PRK00714		156	RNA pyrophosphohydrolase; Reviewed	99.77
PRK00241		256	nudC NADH pyrophosphatase; Reviewed	99.77
cd04661		132	MRP_L46 Mitochondrial ribosomal protein L46 (MRP L	99.75
cd04697		126	Nudix_Hydrolase_38 Members of the Nudix hydrolase	99.75
PRK15393		180	NUDIX hydrolase YfcD; Provisional	99.74
cd04693		127	Nudix_Hydrolase_34 Members of the Nudix hydrolase	99.73
PRK05379		340	bifunctional nicotinamide mononucleotide adenylylt	99.73
PRK10776		129	nucleoside triphosphate pyrophosphohydrolase; Prov	99.72
cd02885		165	IPP_Isomerase Isopentenyl diphosphate (IPP) isomer	99.72
cd04665		118	Nudix_Hydrolase_8 Members of the Nudix hydrolase s	99.72
PRK11762		185	nudE adenosine nucleotide hydrolase NudE; Provisio	99.72
cd04662		126	Nudix_Hydrolase_5 Members of the Nudix hydrolase s	99.72
cd04692		144	Nudix_Hydrolase_33 Members of the Nudix hydrolase	99.71
PRK10729		202	nudF ADP-ribose pyrophosphatase NudF; Provisional	99.7
cd04699		129	Nudix_Hydrolase_39 Members of the Nudix hydrolase	99.69
cd03425		124	MutT_pyrophosphohydrolase The MutT pyrophosphohydr	99.69
TIGR00052		185	nudix-type nucleoside diphosphatase, YffH/AdpP fam	99.69
cd04694		143	Nudix_Hydrolase_35 Members of the Nudix hydrolase	99.68
cd02883		123	Nudix_Hydrolase Nudix hydrolase is a superfamily o	99.67
TIGR00586		128	mutt mutator mutT protein. All proteins in this fa	99.67
TIGR02705		156	nudix_YtkD nucleoside triphosphatase YtkD. The fun	99.66
cd04685		133	Nudix_Hydrolase_26 Members of the Nudix hydrolase	99.64
PRK03759		184	isopentenyl-diphosphate delta-isomerase; Provision	99.64
TIGR02150		158	IPP_isom_1 isopentenyl-diphosphate delta-isomerase	99.64
PRK15009		191	GDP-mannose pyrophosphatase NudK; Provisional	99.63
PRK10707		190	putative NUDIX hydrolase; Provisional	99.63
cd03676		180	Nudix_hydrolase_3 Members of the Nudix hydrolase s	99.62
cd03670		186	ADPRase_NUDT9 ADP-ribose pyrophosphatase (ADPRase)	99.62
cd04663		126	Nudix_Hydrolase_6 Members of the Nudix hydrolase s	99.56
cd04674		118	Nudix_Hydrolase_16 Members of the Nudix hydrolase	99.55
PRK08999		312	hypothetical protein; Provisional	99.55
COG2816		279	NPY1 NTP pyrophosphohydrolases containing a Zn-fin	99.52
PLN02709		222	nudix hydrolase	99.48
PLN03143		291	nudix hydrolase; Provisional	99.45
COG0494		161	MutT NTP pyrophosphohydrolases including oxidative	99.41
PLN02552		247	isopentenyl-diphosphate delta-isomerase	99.35
KOG3084		345	consensus NADH pyrophosphatase I of the Nudix fami	99.34
COG4119		161	Predicted NTP pyrophosphohydrolase [DNA replicatio	99.3
PLN02791		770	Nudix hydrolase homolog	99.26
KOG3041		225	consensus Nucleoside diphosphate-sugar hydrolase o	99.09
cd03431		118	DNA_Glycosylase_C DNA glycosylase (MutY in bacteri	99.01
KOG3069		246	consensus Peroxisomal NUDIX hydrolase [Replication	98.93
KOG0648		295	consensus Predicted NUDIX hydrolase FGF-2 and rela	98.74
COG1443		185	Idi Isopentenyldiphosphate isomerase [Lipid metabo	98.64
PLN02839		372	nudix hydrolase	98.53
PF14815		114	NUDIX_4: NUDIX domain; PDB: 1VRL_A 1RRQ_A 3G0Q_A 3	98.34
KOG4195		275	consensus Transient receptor potential-related cha	97.95
KOG2937		348	consensus Decapping enzyme complex, predicted pyro	97.65
PF13869		188	NUDIX_2: Nucleotide hydrolase; PDB: 3MDG_B 2J8Q_B	97.45
COG4112		203	Predicted phosphoesterase (MutT family) [General f	97.03
KOG4432		405	consensus Uncharacterized NUDIX family hydrolase [	97.02
KOG0142		225	consensus Isopentenyl pyrophosphate:dimethylallyl	96.75
KOG4548		263	consensus Mitochondrial ribosomal protein L17 [Tra	96.43
PRK10880		350	adenine DNA glycosylase; Provisional	95.74
KOG1689		221	consensus mRNA cleavage factor I subunit [RNA proc	95.73
KOG4313		306	consensus Thiamine pyrophosphokinase [Nucleotide t	95.25
KOG4432		405	consensus Uncharacterized NUDIX family hydrolase [	95.1
PF14443		126	DBC1: DBC1	91.2
PRK13910		289	DNA glycosylase MutY; Provisional	88.12
COG4111		322	Uncharacterized conserved protein [General functio	86.13

>cd03673 Ap6A_hydrolase Diadenosine hexaphosphate (Ap6A) hydrolase is a member of the Nudix hydrolase superfamily	Back alignment and domain information

Probab=99.91  E-value=3.1e-23  Score=151.92  Aligned_cols=129  Identities=27%  Similarity=0.328  Sum_probs=101.3

Q ss_pred             eEEeeEEEEeecCCCCCCCCCCCCCCCCCCCccEEEEEEecCCCCEEecceecCCCCCHHHHHHHHHHHHhCceeeecee
Q 029131           20 RLVAGCIPFKYRNRNCEEGDGDGDGDGRSEKIVEVLMINSTSGPGLLFPKGGWENDETVEEAALREALEEAGVRGHLKEF   99 (198)
Q Consensus        20 r~~~g~i~~~~~~~~~~~~~~~~~~~~~~~~~~~vLLv~r~~~~~W~lPgG~ve~gEs~~eaa~REl~EEtGl~~~~~~~   99 (198)
                      +.++++|+++.+                 ++..+|||+++.+.+.|.||||++++||++.+||.||++||||+.+.....
T Consensus         1 ~~~a~~ii~~~~-----------------~~~~~vLl~~~~~~~~w~~PgG~v~~gEs~~~aa~REl~EEtGl~~~~~~~   63 (131)
T cd03673           1 VLAAGGVVFRGS-----------------DGGIEVLLIHRPRGDDWSLPKGKLEPGETPPEAAVREVEEETGIRAEVGDP   63 (131)
T ss_pred             CeeEEEEEEEcc-----------------CCCeEEEEEEcCCCCcccCCCCccCCCCCHHHHHHHHHhhhhCCceEecce
Confidence            467899999886                 345699999998888899999999999999999999999999999998888


Q ss_pred             eEEEEeccCCccCCCCCCceEEEEEEEEEecccccC-CCCCcccceEEEehhHHHHhcCChHHHHHHHHHHH
Q 029131          100 LGYYDFKSKTLQDEFSPEGLCKAAMFALLVKEELES-WPEQSTRQRSWLTVPEAIECCRHPWMQEALEKGFL  170 (198)
Q Consensus       100 l~~~~~~~~~~~~~~~~~~~~~~~~f~~~~~~~~~~-~~~~e~~~~~W~~~~e~~~~~~~~~~~~~l~~~~~  170 (198)
                      ++.+.+..+....    ......++|.+........ .++.|+.+++|++++++.+++.++..+.++.. ++
T Consensus        64 ~~~~~~~~~~~~~----~~~~~~~~~~~~~~~~~~~~~~~~E~~~~~W~~~~el~~~~~~~~~~~~l~~-~~  130 (131)
T cd03673          64 LGTIRYWFSSSGK----RVHKTVHWWLMRALGGEFTPQPDEEVDEVRWLPPDEARDRLSYPNDRELLRA-AL  130 (131)
T ss_pred             EEEEEEeccCCCC----CcceEEEEEEEEEcCCCcccCCCCcEEEEEEcCHHHHHHHcCCHhHHHHHHH-hh
Confidence            8877665543211    1233566666665433222 24567888999999999999999999999988 54

Ap6A hydrolase specifically hydrolyzes diadenosine polyphosphates, but not ATP or diadenosine triphosphate, and it generates ATP as the product. Ap6A, the most preferred substrate, hydrolyzes to produce two ATP molecules, which is a novel hydrolysis mode for Ap6A. These results indicate that Ap6A hydrolase is a diadenosine polyphosphate hydrolase. It requires the presence of a divalent cation, such as Mn2+, Mg2+, Zn2+, and Co2+, for activity. Members of the Nudix superfamily are recognized by a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which forms a structural motif that functions as a metal binding and catalytic site.

>cd04666 Nudix_Hydrolase_9 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X	Back alignment and domain information

>KOG2839 consensus Diadenosine and diphosphoinositol polyphosphate phosphohydrolase [Signal transduction mechanisms]	Back alignment and domain information

>cd03428 Ap4A_hydrolase_human_like Diadenosine tetraphosphate (Ap4A) hydrolase is a member of the Nudix hydrolase superfamily	Back alignment and domain information

>cd04684 Nudix_Hydrolase_25 Contains a crystal structure of the Nudix hydrolase from Enterococcus faecalis, which has an unknown function	Back alignment and domain information

>PRK09438 nudB dihydroneopterin triphosphate pyrophosphatase; Provisional	Back alignment and domain information

>cd04695 Nudix_Hydrolase_36 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X	Back alignment and domain information

>cd03674 Nudix_Hydrolase_1 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X	Back alignment and domain information

>cd03430 GDPMH GDP-mannose glycosyl hydrolase (AKA GDP-mannose mannosyl hydrolase (GDPMH)) is a member of the Nudix hydrolase superfamily	Back alignment and domain information

>cd04679 Nudix_Hydrolase_20 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X	Back alignment and domain information

>cd04700 DR1025_like DR1025 from Deinococcus radiodurans, a member of the Nudix hydrolase superfamily, show nucleoside triphosphatase and dinucleoside polyphosphate pyrophosphatase activities	Back alignment and domain information

>cd04680 Nudix_Hydrolase_21 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X	Back alignment and domain information

>cd03675 Nudix_Hydrolase_2 Contains a crystal structure of the Nudix hydrolase from Nitrosomonas europaea, which has an unknown function	Back alignment and domain information

>PRK15434 GDP-mannose mannosyl hydrolase NudD; Provisional	Back alignment and domain information

>cd03672 Dcp2p mRNA decapping enzyme 2 (Dcp2p), the catalytic subunit, and Dcp1p are the two components of the decapping enzyme complex	Back alignment and domain information

>cd04687 Nudix_Hydrolase_28 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X	Back alignment and domain information

>PLN02325 nudix hydrolase	Back alignment and domain information

>PF00293 NUDIX: NUDIX domain; InterPro: IPR000086 The generic name 'NUDIX hydrolases' (NUcleoside DIphosphate linked to some other moiety X) has been coined for this domain family []	Back alignment and domain information

>cd04696 Nudix_Hydrolase_37 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X	Back alignment and domain information

>cd04664 Nudix_Hydrolase_7 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X	Back alignment and domain information

>cd04673 Nudix_Hydrolase_15 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X	Back alignment and domain information

>cd04676 Nudix_Hydrolase_17 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X	Back alignment and domain information

>cd04677 Nudix_Hydrolase_18 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X	Back alignment and domain information

>cd03427 MTH1 MutT homolog-1 (MTH1) is a member of the Nudix hydrolase superfamily	Back alignment and domain information

>cd04681 Nudix_Hydrolase_22 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X	Back alignment and domain information

>cd04688 Nudix_Hydrolase_29 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X	Back alignment and domain information

>cd04690 Nudix_Hydrolase_31 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X	Back alignment and domain information

>cd04667 Nudix_Hydrolase_10 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X	Back alignment and domain information

>cd04689 Nudix_Hydrolase_30 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X	Back alignment and domain information

>cd04672 Nudix_Hydrolase_14 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X	Back alignment and domain information

>cd03671 Ap4A_hydrolase_plant_like Diadenosine tetraphosphate (Ap4A) hydrolase is a member of the Nudix hydrolase superfamily	Back alignment and domain information

>cd04678 Nudix_Hydrolase_19 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X	Back alignment and domain information

>cd04511 Nudix_Hydrolase_4 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X	Back alignment and domain information

>COG1051 ADP-ribose pyrophosphatase [Nucleotide transport and metabolism]	Back alignment and domain information

>cd04669 Nudix_Hydrolase_11 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X	Back alignment and domain information

>PRK10546 pyrimidine (deoxy)nucleoside triphosphate pyrophosphohydrolase; Provisional	Back alignment and domain information

>cd04683 Nudix_Hydrolase_24 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X	Back alignment and domain information

>cd03429 NADH_pyrophosphatase NADH pyrophosphatase, a member of the Nudix hydrolase superfamily, catalyzes the cleavage of NADH into reduced nicotinamide mononucleotide (NMNH) and AMP	Back alignment and domain information

>cd04670 Nudix_Hydrolase_12 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X	Back alignment and domain information

>cd04686 Nudix_Hydrolase_27 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X	Back alignment and domain information

>PRK15472 nucleoside triphosphatase NudI; Provisional	Back alignment and domain information

>cd04671 Nudix_Hydrolase_13 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X	Back alignment and domain information

>cd04682 Nudix_Hydrolase_23 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X	Back alignment and domain information

>cd03424 ADPRase_NUDT5 ADP-ribose pyrophosphatase (ADPRase) catalyzes the hydrolysis of ADP-ribose and a variety of additional ADP-sugar conjugates to AMP and ribose-5-phosphate	Back alignment and domain information

>cd03426 CoAse Coenzyme A pyrophosphatase (CoAse), a member of the Nudix hydrolase superfamily, functions to catalyze the elimination of oxidized inactive CoA, which can inhibit CoA-utilizing enzymes	Back alignment and domain information

>cd04691 Nudix_Hydrolase_32 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X	Back alignment and domain information

>PRK00714 RNA pyrophosphohydrolase; Reviewed	Back alignment and domain information

>PRK00241 nudC NADH pyrophosphatase; Reviewed	Back alignment and domain information

>cd04661 MRP_L46 Mitochondrial ribosomal protein L46 (MRP L46) is a component of the large subunit (39S) of the mammalian mitochondrial ribosome and a member of the Nudix hydrolase superfamily	Back alignment and domain information

>cd04697 Nudix_Hydrolase_38 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X	Back alignment and domain information

>PRK15393 NUDIX hydrolase YfcD; Provisional	Back alignment and domain information

>cd04693 Nudix_Hydrolase_34 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X	Back alignment and domain information

>PRK05379 bifunctional nicotinamide mononucleotide adenylyltransferase/ADP-ribose pyrophosphatase; Provisional	Back alignment and domain information

>PRK10776 nucleoside triphosphate pyrophosphohydrolase; Provisional	Back alignment and domain information

>cd02885 IPP_Isomerase Isopentenyl diphosphate (IPP) isomerase, a member of the Nudix hydrolase superfamily, is a key enzyme in the isoprenoid biosynthetic pathway	Back alignment and domain information

>cd04665 Nudix_Hydrolase_8 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X	Back alignment and domain information

>PRK11762 nudE adenosine nucleotide hydrolase NudE; Provisional	Back alignment and domain information

>cd04662 Nudix_Hydrolase_5 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X	Back alignment and domain information

>cd04692 Nudix_Hydrolase_33 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X	Back alignment and domain information

>PRK10729 nudF ADP-ribose pyrophosphatase NudF; Provisional	Back alignment and domain information

>cd04699 Nudix_Hydrolase_39 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X	Back alignment and domain information

>cd03425 MutT_pyrophosphohydrolase The MutT pyrophosphohydrolase is a prototypical Nudix hydrolase that catalyzes the hydrolysis of nucleoside and deoxynucleoside triphosphates (NTPs and dNTPs) by substitution at a beta-phosphorus to yield a nucleotide monophosphate (NMP) and inorganic pyrophosphate (PPi)	Back alignment and domain information

>TIGR00052 nudix-type nucleoside diphosphatase, YffH/AdpP family	Back alignment and domain information

>cd04694 Nudix_Hydrolase_35 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X	Back alignment and domain information

>cd02883 Nudix_Hydrolase Nudix hydrolase is a superfamily of enzymes found in all three kingdoms of life, and it catalyzes the hydrolysis of NUcleoside DIphosphates linked to other moieties, X	Back alignment and domain information

>TIGR00586 mutt mutator mutT protein	Back alignment and domain information

>TIGR02705 nudix_YtkD nucleoside triphosphatase YtkD	Back alignment and domain information

>cd04685 Nudix_Hydrolase_26 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X	Back alignment and domain information

>PRK03759 isopentenyl-diphosphate delta-isomerase; Provisional	Back alignment and domain information

>TIGR02150 IPP_isom_1 isopentenyl-diphosphate delta-isomerase, type 1	Back alignment and domain information

>PRK15009 GDP-mannose pyrophosphatase NudK; Provisional	Back alignment and domain information

>PRK10707 putative NUDIX hydrolase; Provisional	Back alignment and domain information

>cd03676 Nudix_hydrolase_3 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X	Back alignment and domain information

>cd03670 ADPRase_NUDT9 ADP-ribose pyrophosphatase (ADPRase) catalyzes the hydrolysis of ADP-ribose to AMP and ribose-5-P	Back alignment and domain information

>cd04663 Nudix_Hydrolase_6 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X	Back alignment and domain information

>cd04674 Nudix_Hydrolase_16 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X	Back alignment and domain information

>PRK08999 hypothetical protein; Provisional	Back alignment and domain information

>COG2816 NPY1 NTP pyrophosphohydrolases containing a Zn-finger, probably nucleic-acid-binding [DNA replication, recombination, and repair]	Back alignment and domain information

>PLN02709 nudix hydrolase	Back alignment and domain information

>PLN03143 nudix hydrolase; Provisional	Back alignment and domain information

>COG0494 MutT NTP pyrophosphohydrolases including oxidative damage repair enzymes [DNA replication, recombination, and repair / General function prediction only]	Back alignment and domain information

>PLN02552 isopentenyl-diphosphate delta-isomerase	Back alignment and domain information

>KOG3084 consensus NADH pyrophosphatase I of the Nudix family of hydrolases [Replication, recombination and repair]	Back alignment and domain information

>COG4119 Predicted NTP pyrophosphohydrolase [DNA replication, recombination, and repair / General function prediction only]	Back alignment and domain information

>PLN02791 Nudix hydrolase homolog	Back alignment and domain information

>KOG3041 consensus Nucleoside diphosphate-sugar hydrolase of the MutT (NUDIX) family [Replication, recombination and repair]	Back alignment and domain information

>cd03431 DNA_Glycosylase_C DNA glycosylase (MutY in bacteria and hMYH in humans) is responsible for repairing misread AoxoG residues to CG by removing the inappropriately paired adenine base from the DNA backbone	Back alignment and domain information

>KOG3069 consensus Peroxisomal NUDIX hydrolase [Replication, recombination and repair]	Back alignment and domain information

>KOG0648 consensus Predicted NUDIX hydrolase FGF-2 and related proteins [Signal transduction mechanisms]	Back alignment and domain information

>COG1443 Idi Isopentenyldiphosphate isomerase [Lipid metabolism]	Back alignment and domain information

>PLN02839 nudix hydrolase	Back alignment and domain information

>PF14815 NUDIX_4: NUDIX domain; PDB: 1VRL_A 1RRQ_A 3G0Q_A 3FSQ_A 1RRS_A 3FSP_A	Back alignment and domain information

>KOG4195 consensus Transient receptor potential-related channel 7 [Inorganic ion transport and metabolism]	Back alignment and domain information

>KOG2937 consensus Decapping enzyme complex, predicted pyrophosphatase DCP2 [RNA processing and modification]	Back alignment and domain information

>PF13869 NUDIX_2: Nucleotide hydrolase; PDB: 3MDG_B 2J8Q_B 3Q2S_A 3P5T_D 3BAP_A 2CL3_A 3P6Y_A 3Q2T_B 3BHO_A 3N9U_A	Back alignment and domain information

>COG4112 Predicted phosphoesterase (MutT family) [General function prediction only]	Back alignment and domain information

>KOG4432 consensus Uncharacterized NUDIX family hydrolase [General function prediction only]	Back alignment and domain information

>KOG0142 consensus Isopentenyl pyrophosphate:dimethylallyl pyrophosphate isomerase [Secondary metabolites biosynthesis, transport and catabolism]	Back alignment and domain information

>KOG4548 consensus Mitochondrial ribosomal protein L17 [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PRK10880 adenine DNA glycosylase; Provisional	Back alignment and domain information

>KOG1689 consensus mRNA cleavage factor I subunit [RNA processing and modification]	Back alignment and domain information

>KOG4313 consensus Thiamine pyrophosphokinase [Nucleotide transport and metabolism]	Back alignment and domain information

>KOG4432 consensus Uncharacterized NUDIX family hydrolase [General function prediction only]	Back alignment and domain information

>PF14443 DBC1: DBC1	Back alignment and domain information

>PRK13910 DNA glycosylase MutY; Provisional	Back alignment and domain information

>COG4111 Uncharacterized conserved protein [General function prediction only]	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		198
3mcf_A		136	Crystal Structure Of Human Diphosphoinositol Polyph		1e-05
2duk_A		138	Crystal Structure Of Ms0616 Length = 138		1e-05
2fvv_A		194	Human Diphosphoinositol Polyphosphate Phosphohydrol		4e-04

>pdb|3MCF|A Chain A, Crystal Structure Of Human Diphosphoinositol Polyphosphate Phosphohydrolase 3-Alpha Length = 136

Back alignment and structure

Iteration: 1

Score = 46.2 bits (108), Expect = 1e-05, Method: Compositional matrix adjust. Identities = 41/126 (32%), Positives = 59/126 (46%), Gaps = 14/126 (11%) Query: 47 RSEKIVEVLMINSTSGPG-LLFPKGGWENDETVXXXXXXXXXXXXGVRGHLKEFLGYYDF 105 RSE+ EVL+++S+ P + P GG E +E GV+G L LG ++ Sbjct: 11 RSEREDEVLLVSSSRYPDRWIVPGGGMEPEEEPGGAAVREVYEEAGVKGKLGRLLGVFEQ 70 Query: 106 KSKTLQDEFSPEGLCKAAMFALLVKEELESWPEQST--RQRSWLTVPEAIEC--CRHPWM 161 QD PE + ++ L V E LE W + + R+R W V +AI+ C P Sbjct: 71 N----QD---PEH--RTYVYVLTVTELLEDWEDSVSIGRKREWFKVEDAIKVLQCHKPVH 121 Query: 162 QEALEK 167 E LEK Sbjct: 122 AEYLEK 127

PyMOL of 3mcf

>pdb|2DUK|A Chain A, Crystal Structure Of Ms0616 Length = 138

Back alignment and structure

>pdb|2FVV|A Chain A, Human Diphosphoinositol Polyphosphate Phosphohydrolase 1 Length = 194

Back alignment and structure

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		198
2fvv_A		194	Diphosphoinositol polyphosphate phosphohydrolase 1	5e-33
2pbt_A		134	AP4A hydrolase; nudix protein, diadenosine polypho	1e-14
1xsa_A		153	BIS(5'-nucleosyl)-tetraphosphatase; nudix enzyme,	4e-13
3fjy_A		364	Probable MUTT1 protein; dimer, protein structure i	1e-10
2b0v_A		153	Nudix hydrolase; structural genomics, PSI, protein	4e-10
1ktg_A		138	Diadenosine tetraphosphate hydrolase; nudix, AMP,	8e-10
3gg6_A		156	Nudix motif 18, nucleoside diphosphate-linked moie	2e-09
3exq_A		161	Nudix family hydrolase; protein structure initiati	5e-09
3shd_A		153	Phosphatase NUDJ; nudix fold, nudix motif, hydrola	6e-09
1vcd_A		126	NDX1; nudix protein, diadenosine polyphosphate, AP	3e-08
2yyh_A		139	MUTT domain, 8-OXO-DGTPase domain; nudix family pr	3e-08
3son_A		149	Hypothetical nudix hydrolase; structural genomics,	4e-08
2jvb_A		146	Protein PSU1, mRNA-decapping enzyme subunit 2; DCP	5e-08
3fcm_A		197	Hydrolase, nudix family; protein structure initiat	8e-08
3q1p_A		205	Phosphohydrolase (MUTT/nudix family protein); asym	2e-07
3id9_A		171	MUTT/nudix family protein; hydrolase, protein stru	2e-07
3fk9_A		188	Mutator MUTT protein; structural genomics, hydrola	3e-07
2azw_A		148	MUTT/nudix family protein; MUTT/nudix ,enterococcu	3e-07
3f13_A		163	Putative nudix hydrolase family member; structural	7e-07
3o8s_A		206	Nudix hydrolase, ADP-ribose pyrophosphatase; struc	1e-06
2b06_A		155	MUTT/nudix family protein; structural genomics, P	1e-06
3i9x_A		187	MUTT/nudix family protein; structural genomics, hy	1e-06
1sjy_A		159	MUTT/nudix family protein; nudix fold, alpha-beta-	1e-06
1k2e_A		156	Nudix homolog; nudix/MUTT-like fold, mixed alpha/b	6e-06
1nqz_A		194	COA pyrophosphatase (MUTT/nudix family protein); D	6e-06
3cng_A		189	Nudix hydrolase; structural genomics, APC7497, PSI	7e-06
3eds_A		153	MUTT/nudix family protein; MUT/nudix protein, prot	7e-06
2a6t_A		271	SPAC19A8.12; alpha/beta/alpha, RNA binding protein	8e-06
2o1c_A		150	DATP pyrophosphohydrolase; nudix NTP hydrolase NTP	9e-06
3h95_A		199	Nucleoside diphosphate-linked moiety X motif 6; NU	9e-06
2pqv_A		154	MUTT/nudix family protein; structu genomics, PSI-2	9e-06
3q93_A		176	7,8-dihydro-8-oxoguanine triphosphatase; structura	1e-05
4dyw_A		157	MUTT/nudix family protein; structural genomics, ni	1e-05
3grn_A		153	MUTT related protein; structural genomics, hydrola	2e-05
2dsc_A		212	ADP-sugar pyrophosphatase; nudix domain, ADPR, ADP	2e-05
1v8y_A		170	ADP-ribose pyrophosphatase; nudix motif, loop-heli	3e-05
3gz5_A		240	MUTT/nudix family protein; DNA binding protein, nu	1e-04
2kdv_A		164	RNA pyrophosphohydrolase; nudix family, magnesium,	1e-04
1vhz_A		198	ADP compounds hydrolase NUDE; structural genomics;	2e-04
2fml_A		273	MUTT/nudix family protein; structural genomics, PS	3e-04
2yvp_A		182	NDX2, MUTT/nudix family protein; nudix protein, AD	3e-04
2w4e_A		145	MUTT/nudix family protein; ADP-ribose pyrophosphat	3e-04
2qjt_B		352	Nicotinamide-nucleotide adenylyltransferase; two i	5e-04
1f3y_A		165	Diadenosine 5',5'''-P1,P4-tetraphosphate hydrolase	5e-04
1g0s_A		209	Hypothetical 23.7 kDa protein in ICC-TOLC intergen	6e-04
1rya_A		160	GDP-mannose mannosyl hydrolase; GDP-glucose, nudix	8e-04

>2fvv_A Diphosphoinositol polyphosphate phosphohydrolase 1; nudix, inositol polyphosphate metabolism, structural genomics, structural genomics consortium; HET: IHP; 1.25A {Homo sapiens} SCOP: d.113.1.1 PDB: 2q9p_A* 2duk_A 3mcf_A* Length = 194	Back alignment and structure

 Score =  115 bits (290), Expect = 5e-33
 Identities = 42/165 (25%), Positives = 73/165 (44%), Gaps = 32/165 (19%)

Query: 4   LVARTGRHQQRYEA-GCRLVAGCIPFKYRNRNCEEGDGDGDGDGRSEKIVEVLMINSTSG 62
           ++       + Y+  G +  A C+ F                  RSE   EVL+++S+  
Sbjct: 23  MMKLKSNQTRTYDGDGYKKRAACLCF------------------RSESEEEVLLVSSSRH 64

Query: 63  PG-LLFPKGGWENDETVEEAALREALEEAGVRGHLKEFLGYYDFKSKTLQDEFSPEGLCK 121
           P   + P GG E +E    AA+RE  EEAGV+G L   +G ++ + +            +
Sbjct: 65  PDRWIVPGGGMEPEEEPSVAAVREVCEEAGVKGTLGRLVGIFENQERK----------HR 114

Query: 122 AAMFALLVKEELESWPEQST--RQRSWLTVPEAIECCRHPWMQEA 164
             ++ L+V E LE W +     R+R W  + +AI+  ++    +A
Sbjct: 115 TYVYVLIVTEVLEDWEDSVNIGRKREWFKIEDAIKVLQYHKPVQA 159

PyMOL of 2fvv

>1xsa_A BIS(5'-nucleosyl)-tetraphosphatase; nudix enzyme, human AP4A hydrolase, alpha-beta; NMR {Homo sapiens} SCOP: d.113.1.1 PDB: 1xsb_A 1xsc_A* Length = 153	Back alignment and structure

>3fjy_A Probable MUTT1 protein; dimer, protein structure initiative II), NYSGXRC, 11181H, structural genomics; 2.15A {Bifidobacterium adolescentis atcc 1570ORGANISM_TAXID} Length = 364	Back alignment and structure

>2b0v_A Nudix hydrolase; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG, U function; 1.55A {Nitrosomonas europaea} SCOP: d.113.1.1 Length = 153	Back alignment and structure

>1ktg_A Diadenosine tetraphosphate hydrolase; nudix, AMP, magnesium cluster; HET: AMP; 1.80A {Caenorhabditis elegans} SCOP: d.113.1.1 PDB: 1kt9_A* Length = 138	Back alignment and structure

>3gg6_A Nudix motif 18, nucleoside diphosphate-linked moiety X motif 18; NUDT18, NXR1, nucleotide hydrolase, hydrolase, structural genomics; 2.10A {Homo sapiens} Length = 156	Back alignment and structure

>3exq_A Nudix family hydrolase; protein structure initiative II(PSI II), NYSGXRC, 11180K, structural genomics; 2.00A {Lactobacillus brevis atcc 367} Length = 161	Back alignment and structure

>3shd_A Phosphatase NUDJ; nudix fold, nudix motif, hydrolase, (D)NDP/(D)NTP binding, dephosphorylation; 2.50A {Escherichia coli} PDB: 3dku_A Length = 153	Back alignment and structure

>1vcd_A NDX1; nudix protein, diadenosine polyphosphate, AP6A, thermus THER HB8, hydrolase, riken structural genomics/proteomics initia RSGI; 1.70A {Thermus thermophilus} SCOP: d.113.1.1 PDB: 1vc8_A 1vc9_A* Length = 126	Back alignment and structure

>2yyh_A MUTT domain, 8-OXO-DGTPase domain; nudix family protein, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.80A {Aquifex aeolicus} Length = 139	Back alignment and structure

>3son_A Hypothetical nudix hydrolase; structural genomics, joint center for structural GENO JCSG, protein structure initiative, PSI-biology; HET: MSE; 1.71A {Listeria monocytogenes} Length = 149	Back alignment and structure

>2jvb_A Protein PSU1, mRNA-decapping enzyme subunit 2; DCP2, mRNA decay, cytoplasm, hydrolase, manganese, metal-binding, mRNA processing; NMR {Saccharomyces cerevisiae} Length = 146	Back alignment and structure

>3fcm_A Hydrolase, nudix family; protein structure initiative II(PSI II), NYSGXRC, 11180J, structural genomics; 2.20A {Clostridium perfringens atcc 13124} Length = 197	Back alignment and structure

>3q1p_A Phosphohydrolase (MUTT/nudix family protein); asymmetric dimer, RNA exonuclease, CDP-CHO pyrophosphatase; 1.80A {Bacillus cereus} PDB: 3q4i_A Length = 205	Back alignment and structure

>3id9_A MUTT/nudix family protein; hydrolase, protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.55A {Bacillus thuringiensis str} Length = 171	Back alignment and structure

>3fk9_A Mutator MUTT protein; structural genomics, hydrolase, PSI-2, protein structure initiative; 2.50A {Bacillus halodurans} Length = 188	Back alignment and structure

>2azw_A MUTT/nudix family protein; MUTT/nudix ,enterococcus faecalis, structural genomics, PSI, structure initiative; HET: 1PE; 1.90A {Enterococcus faecalis} SCOP: d.113.1.1 Length = 148	Back alignment and structure

>3f13_A Putative nudix hydrolase family member; structural genomics, PSI-2, protein structure initiative; 1.70A {Chromobacterium violaceum} Length = 163	Back alignment and structure

>3o8s_A Nudix hydrolase, ADP-ribose pyrophosphatase; structural genomics, joint center for structural genomics, J protein structure initiative; 2.27A {Streptococcus suis} Length = 206	Back alignment and structure

>2b06_A MUTT/nudix family protein; structural genomics, P protein structure initiative, midwest center for structural genomics, MCSG; 1.40A {Streptococcus pneumoniae} SCOP: d.113.1.1 Length = 155	Back alignment and structure

>3i9x_A MUTT/nudix family protein; structural genomics, hydrolase, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics; 2.20A {Listeria innocua} Length = 187	Back alignment and structure

>1sjy_A MUTT/nudix family protein; nudix fold, alpha-beta-alpha sandwich, structural genomics, BSGC structure funded by NIH; 1.39A {Deinococcus radiodurans} SCOP: d.113.1.1 PDB: 1soi_A 1su2_A* 1sz3_A* Length = 159	Back alignment and structure

>1k2e_A Nudix homolog; nudix/MUTT-like fold, mixed alpha/beta, dimer, putative NUDI hydrolase, structural genomics, unknown function; 1.80A {Pyrobaculum aerophilum} SCOP: d.113.1.1 PDB: 1jrk_A 1k26_A Length = 156	Back alignment and structure

>1nqz_A COA pyrophosphatase (MUTT/nudix family protein); D.radiodurans, hydrolase; 1.70A {Deinococcus radiodurans} SCOP: d.113.1.1 PDB: 1nqy_A Length = 194	Back alignment and structure

>3cng_A Nudix hydrolase; structural genomics, APC7497, PSI-2, protei structure initiative; 2.00A {Nitrosomonas europaea atcc 19718} Length = 189	Back alignment and structure

>2a6t_A SPAC19A8.12; alpha/beta/alpha, RNA binding protein,hydrolase; 2.50A {Schizosaccharomyces pombe} SCOP: a.242.1.1 d.113.1.7 PDB: 2qkm_B* Length = 271	Back alignment and structure

>2o1c_A DATP pyrophosphohydrolase; nudix NTP hydrolase NTP pyrophosphohydrolase MUTT dihydroneo triphosphate pyrophosphohydrolase folate biosynthesis; 1.80A {Escherichia coli} PDB: 2o5w_A Length = 150	Back alignment and structure

>3h95_A Nucleoside diphosphate-linked moiety X motif 6; NUDT6, nudix, hydrolase, GFG, GFG-1, FGF2AS, structural GENO structural genomics consortium, SGC; HET: FLC; 1.70A {Homo sapiens} Length = 199	Back alignment and structure

>2pqv_A MUTT/nudix family protein; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; 1.63A {Streptococcus pneumoniae} Length = 154	Back alignment and structure

>3q93_A 7,8-dihydro-8-oxoguanine triphosphatase; structural genomics, structural genomics consortium, SGC, NU MUTT-like, hydrolase, magnesium binding; 1.80A {Homo sapiens} PDB: 1iry_A 3zr0_A* 3zr1_A Length = 176	Back alignment and structure

>4dyw_A MUTT/nudix family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.50A {Burkholderia pseudomallei} Length = 157	Back alignment and structure

>3grn_A MUTT related protein; structural genomics, hydrolase, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics; 1.70A {Methanosarcina mazei} Length = 153	Back alignment and structure

>2dsc_A ADP-sugar pyrophosphatase; nudix domain, ADPR, ADP-ribose pyrophosphatase, NUDT5, hydrolase; HET: APR; 2.00A {Homo sapiens} PDB: 2dsd_A* 3bm4_A* 2dsb_A 3aca_A* 3ac9_A* 3l85_A* Length = 212	Back alignment and structure

>1v8y_A ADP-ribose pyrophosphatase; nudix motif, loop-helix-loop, MUTT family, riken structural genomics/proteomics initiative, RSGI; HET: APR; 1.65A {Thermus thermophilus} SCOP: d.113.1.1 PDB: 1v8v_A* 1v8n_A 1v8l_A* 1v8m_A* 1v8i_A 1v8r_A* 1v8s_A* 1v8t_A* 1v8w_A 1v8u_A Length = 170	Back alignment and structure

>3gz5_A MUTT/nudix family protein; DNA binding protein, nudix domain, WHTH domain; 2.20A {Shewanella oneidensis} PDB: 3gz6_A* 3gz8_A* Length = 240	Back alignment and structure

>2kdv_A RNA pyrophosphohydrolase; nudix family, magnesium, manganese, zinc; NMR {Escherichia coli} PDB: 2kdw_A Length = 164	Back alignment and structure

>1vhz_A ADP compounds hydrolase NUDE; structural genomics; HET: APR; 2.32A {Escherichia coli} SCOP: d.113.1.1 PDB: 1vhg_A* Length = 198	Back alignment and structure

>2fml_A MUTT/nudix family protein; structural genomics, PSI, protein structure initiative, midwest center structural genomics, MCSG; 2.26A {Enterococcus faecalis} SCOP: a.4.5.68 d.113.1.6 Length = 273	Back alignment and structure

>2yvp_A NDX2, MUTT/nudix family protein; nudix protein, ADP-ribose, FAD, hydrol structural genomics, NPPSFA; HET: RBY; 1.66A {Thermus thermophilus} PDB: 2yvn_A 2yvm_A* 2yvo_A* Length = 182	Back alignment and structure

>2w4e_A MUTT/nudix family protein; ADP-ribose pyrophosphatase, hydrolase; 2.00A {Deinococcus radiodurans} Length = 145	Back alignment and structure

>2qjt_B Nicotinamide-nucleotide adenylyltransferase; two individual domains, hydrolase; HET: AMP; 2.30A {Francisella tularensis} PDB: 2r5w_B Length = 352	Back alignment and structure

>1f3y_A Diadenosine 5',5'''-P1,P4-tetraphosphate hydrolase; enzyme,mixed 4-stranded beta sheet, 2-stranded antiparallel sheet; NMR {Lupinus angustifolius} SCOP: d.113.1.1 PDB: 1jkn_A* Length = 165	Back alignment and structure

>1g0s_A Hypothetical 23.7 kDa protein in ICC-TOLC intergenic region; nudix fold, hydrolase; 1.90A {Escherichia coli} SCOP: d.113.1.1 PDB: 1g9q_A* 1ga7_A 1khz_A* 1viq_A Length = 209	Back alignment and structure

>1rya_A GDP-mannose mannosyl hydrolase; GDP-glucose, nudix, nudix Mg-complex; HET: GDP; 1.30A {Escherichia coli} SCOP: d.113.1.5 PDB: 2gt2_A 2gt4_A* 2i8t_A* 2i8u_A* Length = 160	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		198
3i7u_A		134	AP4A hydrolase; nudix protein, diadenosine polypho	99.93
3u53_A		155	BIS(5'-nucleosyl)-tetraphosphatase [asymmetrical];	99.92
3son_A		149	Hypothetical nudix hydrolase; structural genomics,	99.9
1ktg_A		138	Diadenosine tetraphosphate hydrolase; nudix, AMP,	99.9
2pbt_A		134	AP4A hydrolase; nudix protein, diadenosine polypho	99.89
1vcd_A		126	NDX1; nudix protein, diadenosine polyphosphate, AP	99.89
3fcm_A		197	Hydrolase, nudix family; protein structure initiat	99.88
3i9x_A		187	MUTT/nudix family protein; structural genomics, hy	99.88
3grn_A		153	MUTT related protein; structural genomics, hydrola	99.88
3gg6_A		156	Nudix motif 18, nucleoside diphosphate-linked moie	99.87
3f6a_A		159	Hydrolase, nudix family; protein structure initiat	99.86
4dyw_A		157	MUTT/nudix family protein; structural genomics, ni	99.86
3gwy_A		140	Putative CTP pyrophosphohydrolase; structural geno	99.86
2b0v_A		153	Nudix hydrolase; structural genomics, PSI, protein	99.86
2azw_A		148	MUTT/nudix family protein; MUTT/nudix ,enterococcu	99.85
3shd_A		153	Phosphatase NUDJ; nudix fold, nudix motif, hydrola	99.85
2yyh_A		139	MUTT domain, 8-OXO-DGTPase domain; nudix family pr	99.85
2o1c_A		150	DATP pyrophosphohydrolase; nudix NTP hydrolase NTP	99.85
3id9_A		171	MUTT/nudix family protein; hydrolase, protein stru	99.85
3gz5_A		240	MUTT/nudix family protein; DNA binding protein, nu	99.85
3q1p_A		205	Phosphohydrolase (MUTT/nudix family protein); asym	99.84
2fb1_A		226	Conserved hypothetical protein; structural genomic	99.84
2fvv_A		194	Diphosphoinositol polyphosphate phosphohydrolase 1	99.84
3cng_A		189	Nudix hydrolase; structural genomics, APC7497, PSI	99.84
3fjy_A		364	Probable MUTT1 protein; dimer, protein structure i	99.84
1k2e_A		156	Nudix homolog; nudix/MUTT-like fold, mixed alpha/b	99.83
3ees_A		153	Probable pyrophosphohydrolase; nudix, RNA pyrophos	99.83
1rya_A		160	GDP-mannose mannosyl hydrolase; GDP-glucose, nudix	99.83
3o8s_A		206	Nudix hydrolase, ADP-ribose pyrophosphatase; struc	99.83
3exq_A		161	Nudix family hydrolase; protein structure initiati	99.82
2rrk_A		140	ORF135, CTP pyrophosphohydrolase; NMR {Escherichia	99.82
3q93_A		176	7,8-dihydro-8-oxoguanine triphosphatase; structura	99.82
3eds_A		153	MUTT/nudix family protein; MUT/nudix protein, prot	99.82
3fk9_A		188	Mutator MUTT protein; structural genomics, hydrola	99.82
2w4e_A		145	MUTT/nudix family protein; ADP-ribose pyrophosphat	99.82
1sjy_A		159	MUTT/nudix family protein; nudix fold, alpha-beta-	99.82
2fkb_A		180	Putative nudix hydrolase YFCD; putative protein, M	99.81
3h95_A		199	Nucleoside diphosphate-linked moiety X motif 6; NU	99.81
2kdv_A		164	RNA pyrophosphohydrolase; nudix family, magnesium,	99.81
3f13_A		163	Putative nudix hydrolase family member; structural	99.81
2pqv_A		154	MUTT/nudix family protein; structu genomics, PSI-2	99.81
3hhj_A		158	Mutator MUTT protein; niaid, ssgcid, decode, UW, S	99.81
1vhz_A		198	ADP compounds hydrolase NUDE; structural genomics;	99.8
3r03_A		144	Nudix hydrolase; structural genomics, PSI2, protei	99.8
1vk6_A		269	NADH pyrophosphatase; 1790429, structural genomics	99.8
3oga_A		165	Nucleoside triphosphatase NUDI; salmonella enteric	99.8
2jvb_A		146	Protein PSU1, mRNA-decapping enzyme subunit 2; DCP	99.79
2b06_A		155	MUTT/nudix family protein; structural genomics, P	99.79
1f3y_A		165	Diadenosine 5',5'''-P1,P4-tetraphosphate hydrolase	99.79
2yvp_A		182	NDX2, MUTT/nudix family protein; nudix protein, AD	99.79
1hzt_A		190	Isopentenyl diphosphate delta-isomerase; dimethyla	99.78
2fml_A		273	MUTT/nudix family protein; structural genomics, PS	99.78
1v8y_A		170	ADP-ribose pyrophosphatase; nudix motif, loop-heli	99.78
1mut_A		129	MUTT, nucleoside triphosphate pyrophosphohydrolase	99.77
2qjo_A		341	Bifunctional NMN adenylyltransferase/nudix hydrol;	99.77
3o6z_A		191	GDP-mannose pyrophosphatase NUDK; nudix, hydrolase	99.76
3q91_A		218	Uridine diphosphate glucose pyrophosphatase; struc	99.76
1mk1_A		207	ADPR pyrophosphatase; nudix hydrolase, adprase, ad	99.76
2qjt_B		352	Nicotinamide-nucleotide adenylyltransferase; two i	99.75
1nqz_A		194	COA pyrophosphatase (MUTT/nudix family protein); D	99.75
1x51_A		155	A/G-specific adenine DNA glycosylase; nudix domain	99.75
1g0s_A		209	Hypothetical 23.7 kDa protein in ICC-TOLC intergen	99.74
1q27_A		171	Putative nudix hydrolase DR0079; radiation resista	99.74
2a6t_A		271	SPAC19A8.12; alpha/beta/alpha, RNA binding protein	99.72
2dsc_A		212	ADP-sugar pyrophosphatase; nudix domain, ADPR, ADP	99.71
1q33_A		292	Pyrophosphatase, ADP-ribose pyrophosphatase; nudix	99.71
3e57_A		211	Uncharacterized protein TM1382; structural genomic	99.71
3fsp_A		369	A/G-specific adenine glycosylase; protein-DNA comp	99.67
1u20_A		212	U8 snoRNA-binding protein X29; modified nudix hydr	99.66
3qsj_A		232	Nudix hydrolase; structural genomics, PSI-biology,	99.56
2dho_A		235	Isopentenyl-diphosphate delta-isomerase 1; alpha/b	99.55
2pny_A		246	Isopentenyl-diphosphate delta-isomerase 2; caroten	99.54
3rh7_A		321	Hypothetical oxidoreductase; FMN-binding split bar	99.52
2xsq_A		217	U8 snoRNA-decapping enzyme; hydrolase, mRNA decapp	99.51
3dup_A		300	MUTT/nudix family protein; nudix superfamily hydro	99.51
3kvh_A		214	Protein syndesmos; NUDT16-like, NUDT16L1, nudix, R	99.26
3bho_A		208	Cleavage and polyadenylation specificity factor su	99.24

>3i7u_A AP4A hydrolase; nudix protein, diadenosine polyphosphate, S genomics, NPPSFA, national project on protein structural AN functional analyses; HET: PGE PG4; 1.80A {Aquifex aeolicus} PDB: 3i7v_A*	Back alignment and structure

Probab=99.93  E-value=5e-25  Score=162.00  Aligned_cols=127  Identities=28%  Similarity=0.392  Sum_probs=98.0

Q ss_pred             eEEeeEEEEeecCCCCCCCCCCCCCCCCCCCccEEEEEEecCCCCEEecceecCCCCCHHHHHHHHHHHHhCceeeecee
Q 029131           20 RLVAGCIPFKYRNRNCEEGDGDGDGDGRSEKIVEVLMINSTSGPGLLFPKGGWENDETVEEAALREALEEAGVRGHLKEF   99 (198)
Q Consensus        20 r~~~g~i~~~~~~~~~~~~~~~~~~~~~~~~~~~vLLv~r~~~~~W~lPgG~ve~gEs~~eaa~REl~EEtGl~~~~~~~   99 (198)
                      +.+||+|+++.+                     +|||+++. .+.|.||||++++|||+.+||+||++||||+.+.....
T Consensus         4 ~~aag~vv~~~~---------------------~vLL~~r~-~g~W~~PgG~ve~gEt~~~aa~RE~~EEtGl~~~~~~~   61 (134)
T 3i7u_A            4 EFSAGGVLFKDG---------------------EVLLIKTP-SNVWSFPKGNIEPGEKPEETAVREVWEETGVKGEILDY   61 (134)
T ss_dssp             EEEEEEEEEETT---------------------EEEEEECT-TSCEECCEEECCTTCCHHHHHHHHHHHHHSEEEEEEEE
T ss_pred             EEEEEEEEEECC---------------------EEEEEEeC-CCcEECCeeEecCCCCHHHHHHHHHHHhcCceEEEeee
Confidence            467888988764                     79999875 46899999999999999999999999999999998888


Q ss_pred             eEEEEeccCCccCCCCCCceEEEEEEEEEecccccCCCCCcccceEEEehhHHHHhcCChHHHHHHHHHHHHHHh
Q 029131          100 LGYYDFKSKTLQDEFSPEGLCKAAMFALLVKEELESWPEQSTRQRSWLTVPEAIECCRHPWMQEALEKGFLKLYA  174 (198)
Q Consensus       100 l~~~~~~~~~~~~~~~~~~~~~~~~f~~~~~~~~~~~~~~e~~~~~W~~~~e~~~~~~~~~~~~~l~~~~~~~l~  174 (198)
                      ++.+.+.....+..    .....++|.+...... ..+.+|+.+++|++++++.+++.++..+.++.+ +++.+.
T Consensus        62 l~~~~~~~~~~~~~----~~~~~~~f~~~~~~~~-~~~~~E~~~~~W~~~~e~~~~l~~~~~r~il~~-a~~l~~  130 (134)
T 3i7u_A           62 IGEIHYWYTLKGER----IFKTVKYYLMKYKEGE-PRPSWEVKDAKFFPIKEAKKLLKYKGDKEIFEK-ALKLKE  130 (134)
T ss_dssp             EEEEEEEEEETTEE----EEEEEEEEEEEEEEEC-CCCCTTSSEEEEEEHHHHHHHBCSHHHHHHHHH-HHHHHH
T ss_pred             eeeeeEEecCCCce----EEEEEEEEEEEEcCCc-CcCChhheEEEEEEHHHHhhhcCChHHHHHHHH-HHHHHH
Confidence            88766554432111    1223455666544332 335578889999999999999999999999988 766443

PyMOL of 3i7u

>3u53_A BIS(5'-nucleosyl)-tetraphosphatase [asymmetrical]; hydrolase; 2.71A {Homo sapiens} PDB: 1xsa_A 1xsb_A 1xsc_A*	Back alignment and structure

>3son_A Hypothetical nudix hydrolase; structural genomics, joint center for structural GENO JCSG, protein structure initiative, PSI-biology; HET: MSE; 1.71A {Listeria monocytogenes}	Back alignment and structure

>1ktg_A Diadenosine tetraphosphate hydrolase; nudix, AMP, magnesium cluster; HET: AMP; 1.80A {Caenorhabditis elegans} SCOP: d.113.1.1 PDB: 1kt9_A*	Back alignment and structure

>1vcd_A NDX1; nudix protein, diadenosine polyphosphate, AP6A, thermus THER HB8, hydrolase, riken structural genomics/proteomics initia RSGI; 1.70A {Thermus thermophilus} SCOP: d.113.1.1 PDB: 1vc8_A 1vc9_A*	Back alignment and structure

>3fcm_A Hydrolase, nudix family; protein structure initiative II(PSI II), NYSGXRC, 11180J, structural genomics; 2.20A {Clostridium perfringens atcc 13124}	Back alignment and structure

>3i9x_A MUTT/nudix family protein; structural genomics, hydrolase, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics; 2.20A {Listeria innocua}	Back alignment and structure

>3grn_A MUTT related protein; structural genomics, hydrolase, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics; 1.70A {Methanosarcina mazei}	Back alignment and structure

>3gg6_A Nudix motif 18, nucleoside diphosphate-linked moiety X motif 18; NUDT18, NXR1, nucleotide hydrolase, hydrolase, structural genomics; 2.10A {Homo sapiens}	Back alignment and structure

>3f6a_A Hydrolase, nudix family; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.02A {Clostridium perfringens atcc 13124}	Back alignment and structure

>4dyw_A MUTT/nudix family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.50A {Burkholderia pseudomallei}	Back alignment and structure

>3gwy_A Putative CTP pyrophosphohydrolase; structural genomics, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics; 2.00A {Bacteroides fragilis} SCOP: d.113.1.0	Back alignment and structure

>2b0v_A Nudix hydrolase; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG, U function; 1.55A {Nitrosomonas europaea} SCOP: d.113.1.1	Back alignment and structure

>2azw_A MUTT/nudix family protein; MUTT/nudix ,enterococcus faecalis, structural genomics, PSI, structure initiative; HET: 1PE; 1.90A {Enterococcus faecalis} SCOP: d.113.1.1	Back alignment and structure

>3shd_A Phosphatase NUDJ; nudix fold, nudix motif, hydrolase, (D)NDP/(D)NTP binding, dephosphorylation; 2.50A {Escherichia coli} PDB: 3dku_A	Back alignment and structure

>2yyh_A MUTT domain, 8-OXO-DGTPase domain; nudix family protein, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.80A {Aquifex aeolicus}	Back alignment and structure

>2o1c_A DATP pyrophosphohydrolase; nudix NTP hydrolase NTP pyrophosphohydrolase MUTT dihydroneo triphosphate pyrophosphohydrolase folate biosynthesis; 1.80A {Escherichia coli} PDB: 2o5w_A	Back alignment and structure

>3id9_A MUTT/nudix family protein; hydrolase, protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.55A {Bacillus thuringiensis str}	Back alignment and structure

>3gz5_A MUTT/nudix family protein; DNA binding protein, nudix domain, WHTH domain; 2.20A {Shewanella oneidensis} PDB: 3gz6_A* 3gz8_A*	Back alignment and structure

>3q1p_A Phosphohydrolase (MUTT/nudix family protein); asymmetric dimer, RNA exonuclease, CDP-CHO pyrophosphatase; 1.80A {Bacillus cereus} PDB: 3q4i_A	Back alignment and structure

>2fb1_A Conserved hypothetical protein; structural genomics, PSI, protein STRU initiative, midwest center for structural genomics, MCSG; 2.50A {Bacteroides thetaiotaomicron} SCOP: a.4.5.68 d.113.1.6	Back alignment and structure

>2fvv_A Diphosphoinositol polyphosphate phosphohydrolase 1; nudix, inositol polyphosphate metabolism, structural genomics, structural genomics consortium; HET: IHP; 1.25A {Homo sapiens} SCOP: d.113.1.1 PDB: 2q9p_A* 2duk_A 3mcf_A*	Back alignment and structure

>3cng_A Nudix hydrolase; structural genomics, APC7497, PSI-2, protei structure initiative; 2.00A {Nitrosomonas europaea atcc 19718}	Back alignment and structure

>3fjy_A Probable MUTT1 protein; dimer, protein structure initiative II), NYSGXRC, 11181H, structural genomics; 2.15A {Bifidobacterium adolescentis atcc 1570ORGANISM_TAXID}	Back alignment and structure

>1k2e_A Nudix homolog; nudix/MUTT-like fold, mixed alpha/beta, dimer, putative NUDI hydrolase, structural genomics, unknown function; 1.80A {Pyrobaculum aerophilum} SCOP: d.113.1.1 PDB: 1jrk_A 1k26_A	Back alignment and structure

>3ees_A Probable pyrophosphohydrolase; nudix, RNA pyrophosphohydrolase; 1.90A {Bdellovibrio bacteriovorus} PDB: 3eeu_A 3ef5_A* 3ffu_A*	Back alignment and structure

>1rya_A GDP-mannose mannosyl hydrolase; GDP-glucose, nudix, nudix Mg-complex; HET: GDP; 1.30A {Escherichia coli} SCOP: d.113.1.5 PDB: 2gt2_A 2gt4_A* 2i8t_A* 2i8u_A*	Back alignment and structure

>3o8s_A Nudix hydrolase, ADP-ribose pyrophosphatase; structural genomics, joint center for structural genomics, J protein structure initiative; 2.27A {Streptococcus suis}	Back alignment and structure

>3exq_A Nudix family hydrolase; protein structure initiative II(PSI II), NYSGXRC, 11180K, structural genomics; 2.00A {Lactobacillus brevis atcc 367}	Back alignment and structure

>2rrk_A ORF135, CTP pyrophosphohydrolase; NMR {Escherichia coli}	Back alignment and structure

>3q93_A 7,8-dihydro-8-oxoguanine triphosphatase; structural genomics, structural genomics consortium, SGC, NU MUTT-like, hydrolase, magnesium binding; 1.80A {Homo sapiens} PDB: 1iry_A 3zr0_A* 3zr1_A	Back alignment and structure

>3fk9_A Mutator MUTT protein; structural genomics, hydrolase, PSI-2, protein structure initiative; 2.50A {Bacillus halodurans}	Back alignment and structure

>2w4e_A MUTT/nudix family protein; ADP-ribose pyrophosphatase, hydrolase; 2.00A {Deinococcus radiodurans}	Back alignment and structure

>1sjy_A MUTT/nudix family protein; nudix fold, alpha-beta-alpha sandwich, structural genomics, BSGC structure funded by NIH; 1.39A {Deinococcus radiodurans} SCOP: d.113.1.1 PDB: 1soi_A 1su2_A* 1sz3_A*	Back alignment and structure

>2fkb_A Putative nudix hydrolase YFCD; putative protein, MAD, structural genomics, escherichia coli putative nudix hydrolase, PSI; HET: MSE; 2.00A {Escherichia coli K12} SCOP: d.113.1.2	Back alignment and structure

>3h95_A Nucleoside diphosphate-linked moiety X motif 6; NUDT6, nudix, hydrolase, GFG, GFG-1, FGF2AS, structural GENO structural genomics consortium, SGC; HET: FLC; 1.70A {Homo sapiens}	Back alignment and structure

>2kdv_A RNA pyrophosphohydrolase; nudix family, magnesium, manganese, zinc; NMR {Escherichia coli} PDB: 2kdw_A	Back alignment and structure

>3f13_A Putative nudix hydrolase family member; structural genomics, PSI-2, protein structure initiative; 1.70A {Chromobacterium violaceum}	Back alignment and structure

>2pqv_A MUTT/nudix family protein; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; 1.63A {Streptococcus pneumoniae}	Back alignment and structure

>3hhj_A Mutator MUTT protein; niaid, ssgcid, decode, UW, SBRI, infectious diseases, hydrol structural genomics; 2.10A {Bartonella henselae}	Back alignment and structure

>1vhz_A ADP compounds hydrolase NUDE; structural genomics; HET: APR; 2.32A {Escherichia coli} SCOP: d.113.1.1 PDB: 1vhg_A*	Back alignment and structure

>3r03_A Nudix hydrolase; structural genomics, PSI2, protein structure INIT NEW YORK SGX research center for structural genomics, nysgx; HET: ADP; 2.49A {Rhodospirillum rubrum} SCOP: d.113.1.0	Back alignment and structure

>1vk6_A NADH pyrophosphatase; 1790429, structural genomics, JCSG, PS protein structure initiative, joint center for structural G hydrolase; HET: MSE; 2.20A {Escherichia coli} SCOP: d.113.1.4 d.113.1.4 g.41.14.1 PDB: 2gb5_A	Back alignment and structure

>3oga_A Nucleoside triphosphatase NUDI; salmonella enterica subsp. enterica serovar typhimurium STR. unknown function; HET: PO4; 1.75A {Salmonella enterica subsp} PDB: 3n77_A	Back alignment and structure

>2jvb_A Protein PSU1, mRNA-decapping enzyme subunit 2; DCP2, mRNA decay, cytoplasm, hydrolase, manganese, metal-binding, mRNA processing; NMR {Saccharomyces cerevisiae}	Back alignment and structure

>2b06_A MUTT/nudix family protein; structural genomics, P protein structure initiative, midwest center for structural genomics, MCSG; 1.40A {Streptococcus pneumoniae} SCOP: d.113.1.1	Back alignment and structure

>1f3y_A Diadenosine 5',5'''-P1,P4-tetraphosphate hydrolase; enzyme,mixed 4-stranded beta sheet, 2-stranded antiparallel sheet; NMR {Lupinus angustifolius} SCOP: d.113.1.1 PDB: 1jkn_A*	Back alignment and structure

>2yvp_A NDX2, MUTT/nudix family protein; nudix protein, ADP-ribose, FAD, hydrol structural genomics, NPPSFA; HET: RBY; 1.66A {Thermus thermophilus} PDB: 2yvn_A 2yvm_A* 2yvo_A*	Back alignment and structure

>1hzt_A Isopentenyl diphosphate delta-isomerase; dimethylallyl, isoprenoids; 1.45A {Escherichia coli} SCOP: d.113.1.2 PDB: 1hx3_A 1r67_A 1x84_A* 1x83_A* 1ppv_A* 1nfz_A* 1nfs_A* 1ppw_A* 1pvf_A 2veh_A* 2vej_A 2vnp_A* 2vnq_A 2g74_A 2g73_A* 2b2k_A 1i9a_A 1q54_A* 1ow2_A* 3hyq_A*	Back alignment and structure

>2fml_A MUTT/nudix family protein; structural genomics, PSI, protein structure initiative, midwest center structural genomics, MCSG; 2.26A {Enterococcus faecalis} SCOP: a.4.5.68 d.113.1.6	Back alignment and structure

>1v8y_A ADP-ribose pyrophosphatase; nudix motif, loop-helix-loop, MUTT family, riken structural genomics/proteomics initiative, RSGI; HET: APR; 1.65A {Thermus thermophilus} SCOP: d.113.1.1 PDB: 1v8v_A* 1v8n_A 1v8l_A* 1v8m_A* 1v8i_A 1v8r_A* 1v8s_A* 1v8t_A* 1v8w_A 1v8u_A	Back alignment and structure

>1mut_A MUTT, nucleoside triphosphate pyrophosphohydrolase; DNA repair; NMR {Escherichia coli} SCOP: d.113.1.1 PDB: 1ppx_A* 1pun_A* 1puq_A* 1pus_A* 1tum_A* 3a6s_A* 3a6t_A* 3a6u_A* 3a6v_A*	Back alignment and structure

>2qjo_A Bifunctional NMN adenylyltransferase/nudix hydrol; two individual domains, hydrolase; HET: APR NAD; 2.60A {Synechocystis SP}	Back alignment and structure

>3o6z_A GDP-mannose pyrophosphatase NUDK; nudix, hydrolase, biofilm; 2.05A {Escherichia coli} SCOP: d.113.1.1 PDB: 3o52_A* 1viu_A 3o69_A 3o61_A	Back alignment and structure

>3q91_A Uridine diphosphate glucose pyrophosphatase; structural genomics, structural genomics consortium, SGC, NU MUTT-like, hydrolase, magnesium binding; 2.70A {Homo sapiens}	Back alignment and structure

>1mk1_A ADPR pyrophosphatase; nudix hydrolase, adprase, adenosine DI ribose, RV1700, hydrolase; HET: APR; 2.00A {Mycobacterium tuberculosis} SCOP: d.113.1.1 PDB: 1mp2_A 1mqe_A* 1mqw_A* 1mr2_A*	Back alignment and structure

>2qjt_B Nicotinamide-nucleotide adenylyltransferase; two individual domains, hydrolase; HET: AMP; 2.30A {Francisella tularensis} PDB: 2r5w_B	Back alignment and structure

>1nqz_A COA pyrophosphatase (MUTT/nudix family protein); D.radiodurans, hydrolase; 1.70A {Deinococcus radiodurans} SCOP: d.113.1.1 PDB: 1nqy_A	Back alignment and structure

>1x51_A A/G-specific adenine DNA glycosylase; nudix domain, DNA repair, alpha-3 isoform, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.113.1.3	Back alignment and structure

>1g0s_A Hypothetical 23.7 kDa protein in ICC-TOLC intergenic region; nudix fold, hydrolase; 1.90A {Escherichia coli} SCOP: d.113.1.1 PDB: 1g9q_A* 1ga7_A 1khz_A* 1viq_A	Back alignment and structure

>1q27_A Putative nudix hydrolase DR0079; radiation resistance; NMR {Deinococcus radiodurans} SCOP: d.113.1.2 PDB: 2o5f_A	Back alignment and structure

>2a6t_A SPAC19A8.12; alpha/beta/alpha, RNA binding protein,hydrolase; 2.50A {Schizosaccharomyces pombe} SCOP: a.242.1.1 d.113.1.7 PDB: 2qkm_B*	Back alignment and structure

>2dsc_A ADP-sugar pyrophosphatase; nudix domain, ADPR, ADP-ribose pyrophosphatase, NUDT5, hydrolase; HET: APR; 2.00A {Homo sapiens} PDB: 2dsd_A* 3bm4_A* 2dsb_A 3aca_A* 3ac9_A* 3l85_A*	Back alignment and structure

>1q33_A Pyrophosphatase, ADP-ribose pyrophosphatase; nudix fold, hydrolase; HET: BGC; 1.81A {Homo sapiens} SCOP: d.113.1.1 PDB: 1qvj_A*	Back alignment and structure

>3e57_A Uncharacterized protein TM1382; structural genomics, nudix hydrolase, PSI-2, protein structure initiative; 1.89A {Thermotoga maritima}	Back alignment and structure

>3fsp_A A/G-specific adenine glycosylase; protein-DNA complex, DNA glycosylase, transition state analog, DNA repair; HET: NRI; 2.20A {Geobacillus stearothermophilus} PDB: 3fsq_A* 1rrs_A* 1vrl_A* 1rrq_A* 3g0q_A*	Back alignment and structure

>1u20_A U8 snoRNA-binding protein X29; modified nudix hydrolase fold, hydrolase; 2.10A {Xenopus laevis} SCOP: d.113.1.1 PDB: 2a8t_A* 2a8q_A* 2a8p_A* 2a8r_A* 2a8s_A*	Back alignment and structure

>3qsj_A Nudix hydrolase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE; 1.70A {Alicyclobacillus acidocaldarius subsp}	Back alignment and structure

>2dho_A Isopentenyl-diphosphate delta-isomerase 1; alpha/beta protein; 1.60A {Homo sapiens} PDB: 2i6k_A* 2icj_A 2ick_A*	Back alignment and structure

>2pny_A Isopentenyl-diphosphate delta-isomerase 2; carotenoid biosynthesis, cholesterol biosynthesis, isomerase isoprene biosynthesis, lipid synthesis; HET: GOL; 1.81A {Homo sapiens}	Back alignment and structure

>3rh7_A Hypothetical oxidoreductase; FMN-binding split barrel, nudix, structural genomics, joint for structural genomics, JCSG; HET: FMN; 3.00A {Sinorhizobium meliloti}	Back alignment and structure

>2xsq_A U8 snoRNA-decapping enzyme; hydrolase, mRNA decapping, mRNA turnover, structural genomic consortium, SGC; HET: IMP; 1.72A {Homo sapiens} PDB: 3cou_A 3mgm_A	Back alignment and structure

>3dup_A MUTT/nudix family protein; nudix superfamily hydrolase, hydrolase 3 family, structural protein structure initiative, PSI; HET: MSE; 1.80A {Rhodospirillum rubrum atcc 11170}	Back alignment and structure

>3kvh_A Protein syndesmos; NUDT16-like, NUDT16L1, nudix, RNA regulation, RNA structural genomics consortium, SGC, RNA degradation, RNA B protein; 1.70A {Homo sapiens}	Back alignment and structure

>3bho_A Cleavage and polyadenylation specificity factor subunit 5; CPSF5, RNA processing, cleavage factor, diadenosine tetraphosphate, mRNA processing; HET: B4P; 1.80A {Homo sapiens} PDB: 3bap_A 3mdg_A 3mdi_A 2cl3_A 3n9u_A 3q2s_A 3q2t_A 2j8q_A 3p5t_A 3p6y_A	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		198
d2fvva1		135	d.113.1.1 (A:8-142) Diphosphoinositol polyphosphat	3e-16
d1xsba_		153	d.113.1.1 (A:) Diadenosine tetraphosphate hydrolas	5e-14
d2azwa1		147	d.113.1.1 (A:2-148) Hypothetical protein EF1141 {E	5e-10
d1vcda1		126	d.113.1.1 (A:1-126) AP6A hydrolase Ndx1 {Thermus t	4e-09
d1k2ea_		152	d.113.1.1 (A:) Hypothetical protein PAE3301 {Archa	6e-07
d1sjya_		158	d.113.1.1 (A:) Hypothetical protein DR1025 {Deinoc	4e-06
d1irya_		156	d.113.1.1 (A:) 7,8-dihydro-8-oxoguanine triphospha	5e-06
d2a6ta2		151	d.113.1.7 (A:95-245) mRNA decapping enzyme Dcp2p c	4e-05
d2b0va1		146	d.113.1.1 (A:4-149) Hypothetical protein NE0184 {N	5e-05
d1q33a_		292	d.113.1.1 (A:) NUDT9 (mitochondrial ADP-ribose pyr	5e-05
d1vk6a2		131	d.113.1.4 (A:126-256) NADH pyrophosphatase {Escher	0.002
d1u20a1		196	d.113.1.1 (A:14-209) U8 snorna-binding protein x29	0.003

>d2fvva1 d.113.1.1 (A:8-142) Diphosphoinositol polyphosphate phosphohydrolase {Human (Homo sapiens) [TaxId: 9606]} Length = 135	Back information, alignment and structure


class: Alpha and beta proteins (a+b)
fold: Nudix
superfamily: Nudix
family: MutT-like
domain: Diphosphoinositol polyphosphate phosphohydrolase
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 69.8 bits (170), Expect = 3e-16
 Identities = 42/156 (26%), Positives = 68/156 (43%), Gaps = 33/156 (21%)

Query: 16  EAGCRLVAGCIPFKYRNRNCEEGDGDGDGDGRSEKIVEVLMINSTSGPGL-LFPKGGWEN 74
             G +  A C+ F                  RSE   EVL+++S+  P   + P GG E 
Sbjct: 7   GDGYKKRAACLCF------------------RSESEEEVLLVSSSRHPDRWIVPGGGMEP 48

Query: 75  DETVEEAALREALEEAGVRGHLKEFLGYYDFKSKTLQDEFSPEGLCKAAMFALLVKEELE 134
           +E    AA+RE  EEAGV+G L   +G ++ + +            +  ++ L+V E LE
Sbjct: 49  EEEPSVAAVREVCEEAGVKGTLGRLVGIFENQERK----------HRTYVYVLIVTEVLE 98

Query: 135 SWPEQST--RQRSWLTVPEAIECCRH--PWMQEALE 166
            W +     R+R W  + +AI+  ++  P      E
Sbjct: 99  DWEDSVNIGRKREWFKIEDAIKVLQYHKPVQASYFE 134

PyMOL of d2fvva1

>d1xsba_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Human (Homo sapiens) [TaxId: 9606]} Length = 153	Back information, alignment and structure

>d2azwa1 d.113.1.1 (A:2-148) Hypothetical protein EF1141 {Enterococcus faecalis [TaxId: 1351]} Length = 147	Back information, alignment and structure

>d1vcda1 d.113.1.1 (A:1-126) AP6A hydrolase Ndx1 {Thermus thermophilus [TaxId: 274]} Length = 126	Back information, alignment and structure

>d1k2ea_ d.113.1.1 (A:) Hypothetical protein PAE3301 {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 152	Back information, alignment and structure

>d1sjya_ d.113.1.1 (A:) Hypothetical protein DR1025 {Deinococcus radiodurans [TaxId: 1299]} Length = 158	Back information, alignment and structure

>d1irya_ d.113.1.1 (A:) 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 {Human (Homo sapiens) [TaxId: 9606]} Length = 156	Back information, alignment and structure

>d2a6ta2 d.113.1.7 (A:95-245) mRNA decapping enzyme Dcp2p catalytic domain {Schizosaccharomyces pombe [TaxId: 4896]} Length = 151	Back information, alignment and structure

>d2b0va1 d.113.1.1 (A:4-149) Hypothetical protein NE0184 {Nitrosomonas europaea [TaxId: 915]} Length = 146	Back information, alignment and structure

>d1q33a_ d.113.1.1 (A:) NUDT9 (mitochondrial ADP-ribose pyrophosphatase) {Human (Homo sapiens) [TaxId: 9606]} Length = 292	Back information, alignment and structure

>d1vk6a2 d.113.1.4 (A:126-256) NADH pyrophosphatase {Escherichia coli [TaxId: 562]} Length = 131	Back information, alignment and structure

>d1u20a1 d.113.1.1 (A:14-209) U8 snorna-binding protein x29 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 196	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		198
d1vcda1		126	AP6A hydrolase Ndx1 {Thermus thermophilus [TaxId:	99.92
d1ktga_		137	Diadenosine tetraphosphate hydrolase (Ap4A hydrola	99.92
d2fb1a2		147	Hypothetical protein BT0354, N-terminal domain {Ba	99.9
d2fvva1		135	Diphosphoinositol polyphosphate phosphohydrolase {	99.9
d1xsba_		153	Diadenosine tetraphosphate hydrolase (Ap4A hydrola	99.88
d2azwa1		147	Hypothetical protein EF1141 {Enterococcus faecalis	99.88
d2b0va1		146	Hypothetical protein NE0184 {Nitrosomonas europaea	99.88
d1vk6a2		131	NADH pyrophosphatase {Escherichia coli [TaxId: 562	99.88
d1k2ea_		152	Hypothetical protein PAE3301 {Archaeon Pyrobaculum	99.86
d1irya_		156	7,8-dihydro-8-oxoguanine triphosphatase Hmth1 {Hum	99.85
d2a6ta2		151	mRNA decapping enzyme Dcp2p catalytic domain {Schi	99.84
d1sjya_		158	Hypothetical protein DR1025 {Deinococcus radiodura	99.84
d1jkna_		165	Diadenosine tetraphosphate hydrolase (Ap4A hydrola	99.84
d1ryaa_		160	GDP-mannose mannosyl hydrolase NudD {Escherichia c	99.84
d2b06a1		155	Hypothetical protein SP1235 (spr1115) {Streptococc	99.83
d2fmla2		202	Hypothetical protein EF2700, N-terminal domain {En	99.83
d1puna_		129	Nucleoside triphosphate pyrophosphorylase (MutT) {	99.82
d2fkba1		161	Hypothetical protein YfcD {Escherichia coli [TaxId	99.81
d1vhza_		186	ADP compounds hydrolase NudE {Escherichia coli [Ta	99.79
d1mqea_		202	ADP-ribose pyrophosphatase {Mycobacterium tubercul	99.79
d1v8ya_		158	ADP-ribose pyrophosphatase {Thermus thermophilus [	99.77
d2o5fa1		162	Hypothetical protein DR0079 {Deinococcus radiodura	99.74
d1nqza_		187	Coenzyme A pyrophosphatase {Deinococcus radioduran	99.72
d1hzta_		153	Isopentenyl diphosphate isomerase {Escherichia col	99.72
d1g0sa_		209	ADP-ribose pyrophosphatase {Escherichia coli [TaxI	99.71
d1q33a_		292	NUDT9 (mitochondrial ADP-ribose pyrophosphatase) {	99.68
d1rrqa2		127	Adenine glycosylase MutY, C-terminal domain {Bacil	99.64
d1viua_		189	ADP-ribose pyrophosphatase homologue YffH {Escheri	99.61
d1u20a1		196	U8 snorna-binding protein x29 {African clawed frog	99.51
d1x51a1		142	A/G-specific adenine DNA glycosylase {Human (Homo	99.3

>d1vcda1 d.113.1.1 (A:1-126) AP6A hydrolase Ndx1 {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Nudix
superfamily: Nudix
family: MutT-like
domain: AP6A hydrolase Ndx1
species: Thermus thermophilus [TaxId: 274]

Probab=99.92  E-value=3.4e-24  Score=154.22  Aligned_cols=123  Identities=28%  Similarity=0.265  Sum_probs=96.9

Q ss_pred             eEEeeEEEEeecCCCCCCCCCCCCCCCCCCCccEEEEEEecCCCCEEecceecCCCCCHHHHHHHHHHHHhCceeeecee
Q 029131           20 RLVAGCIPFKYRNRNCEEGDGDGDGDGRSEKIVEVLMINSTSGPGLLFPKGGWENDETVEEAALREALEEAGVRGHLKEF   99 (198)
Q Consensus        20 r~~~g~i~~~~~~~~~~~~~~~~~~~~~~~~~~~vLLv~r~~~~~W~lPgG~ve~gEs~~eaa~REl~EEtGl~~~~~~~   99 (198)
                      +..||+|+++.+                    .++||+++ +.+.|.||||++++|||+.+||.||++||||+++.....
T Consensus         2 ~v~agavv~~~~--------------------~~vLl~~~-~~g~w~~PgG~ve~gEt~~~aa~RE~~EEtGi~~~~~~~   60 (126)
T d1vcda1           2 ELGAGGVVFNAK--------------------REVLLLRD-RMGFWVFPKGHPEPGESLEEAAVREVWEETGVRAEVLLP   60 (126)
T ss_dssp             EEEEEEEEECTT--------------------SCEEEEEC-TTSCEECCEECCCTTCCHHHHHHHHHHHHHCCEEEEEEE
T ss_pred             EEEEEEEEEECC--------------------CEEEEEEc-CCCCEECCccccCCCCCHHHHHHHHHHHHcCCeeEEEEE
Confidence            578999998765                    26888775 457899999999999999999999999999999998888


Q ss_pred             eEEEEeccCCccCCCCCCceEEEEEEEEEecccccCCCCCcccceEEEehhHHHHhcCChHHHHHHHHHHHHHH
Q 029131          100 LGYYDFKSKTLQDEFSPEGLCKAAMFALLVKEELESWPEQSTRQRSWLTVPEAIECCRHPWMQEALEKGFLKLY  173 (198)
Q Consensus       100 l~~~~~~~~~~~~~~~~~~~~~~~~f~~~~~~~~~~~~~~e~~~~~W~~~~e~~~~~~~~~~~~~l~~~~~~~l  173 (198)
                      ++.+.+.....       .....++|.+.....  ..+++++.+++|++++++.+++.+|..+.+++. +++++
T Consensus        61 ~~~~~~~~~~~-------~~~~~~~~~~~~~~~--~~~~~e~~~~~W~~~~e~~~~~~~~~~~~il~~-~~~~l  124 (126)
T d1vcda1          61 LYPTRYVNPKG-------VEREVHWFLMRGEGA--PRLEEGMTGAGWFSPEEARALLAFPEDLGLLEV-ALERL  124 (126)
T ss_dssp             EEEEEEECTTS-------CEEEEEEEEEEEESC--CCCCTTCCEEEEECHHHHHHHBCSHHHHHHHHH-HHHHS
T ss_pred             EeeeeeccCCC-------eEEEEEEEEEEEcCC--CCCCccceEEEEEEHHHHhhccCChHHHHHHHH-HHHhC
Confidence            87766655432       123445555554432  234567888999999999999999999999988 87765

PyMOL of d1vcda1

>d1ktga_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Caenorhabditis elegans [TaxId: 6239]}	Back information, alignment and structure

>d2fb1a2 d.113.1.6 (A:3-149) Hypothetical protein BT0354, N-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]}	Back information, alignment and structure

>d2fvva1 d.113.1.1 (A:8-142) Diphosphoinositol polyphosphate phosphohydrolase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xsba_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2azwa1 d.113.1.1 (A:2-148) Hypothetical protein EF1141 {Enterococcus faecalis [TaxId: 1351]}	Back information, alignment and structure

>d2b0va1 d.113.1.1 (A:4-149) Hypothetical protein NE0184 {Nitrosomonas europaea [TaxId: 915]}	Back information, alignment and structure

>d1vk6a2 d.113.1.4 (A:126-256) NADH pyrophosphatase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1k2ea_ d.113.1.1 (A:) Hypothetical protein PAE3301 {Archaeon Pyrobaculum aerophilum [TaxId: 13773]}	Back information, alignment and structure

>d1irya_ d.113.1.1 (A:) 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2a6ta2 d.113.1.7 (A:95-245) mRNA decapping enzyme Dcp2p catalytic domain {Schizosaccharomyces pombe [TaxId: 4896]}	Back information, alignment and structure

>d1sjya_ d.113.1.1 (A:) Hypothetical protein DR1025 {Deinococcus radiodurans [TaxId: 1299]}	Back information, alignment and structure

>d1jkna_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Narrow-leaved blue lupine (Lupinus angustifolius) [TaxId: 3871]}	Back information, alignment and structure

>d1ryaa_ d.113.1.5 (A:) GDP-mannose mannosyl hydrolase NudD {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2b06a1 d.113.1.1 (A:1-155) Hypothetical protein SP1235 (spr1115) {Streptococcus pneumoniae [TaxId: 1313]}	Back information, alignment and structure

>d2fmla2 d.113.1.6 (A:3-204) Hypothetical protein EF2700, N-terminal domain {Enterococcus faecalis [TaxId: 1351]}	Back information, alignment and structure

>d1puna_ d.113.1.1 (A:) Nucleoside triphosphate pyrophosphorylase (MutT) {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2fkba1 d.113.1.2 (A:8-168) Hypothetical protein YfcD {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1vhza_ d.113.1.1 (A:) ADP compounds hydrolase NudE {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1mqea_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1v8ya_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d2o5fa1 d.113.1.2 (A:7-168) Hypothetical protein DR0079 {Deinococcus radiodurans str. R1 (Deinococcus radiodurans R1) [TaxId: 243230]}	Back information, alignment and structure

>d1nqza_ d.113.1.1 (A:) Coenzyme A pyrophosphatase {Deinococcus radiodurans [TaxId: 1299]}	Back information, alignment and structure

>d1hzta_ d.113.1.2 (A:) Isopentenyl diphosphate isomerase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1g0sa_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1q33a_ d.113.1.1 (A:) NUDT9 (mitochondrial ADP-ribose pyrophosphatase) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1rrqa2 d.113.1.3 (A:234-360) Adenine glycosylase MutY, C-terminal domain {Bacillus stearothermophilus [TaxId: 1422]}	Back information, alignment and structure

>d1viua_ d.113.1.1 (A:) ADP-ribose pyrophosphatase homologue YffH {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1u20a1 d.113.1.1 (A:14-209) U8 snorna-binding protein x29 {African clawed frog (Xenopus laevis) [TaxId: 8355]}	Back information, alignment and structure

>d1x51a1 d.113.1.3 (A:8-149) A/G-specific adenine DNA glycosylase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure