Citrus Sinensis ID: 029172
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 198 | ||||||
| 255583634 | 280 | conserved hypothetical protein [Ricinus | 0.863 | 0.610 | 0.647 | 1e-51 | |
| 224071571 | 275 | predicted protein [Populus trichocarpa] | 0.838 | 0.603 | 0.618 | 7e-50 | |
| 449459702 | 279 | PREDICTED: thylakoid lumenal protein At1 | 0.853 | 0.605 | 0.589 | 2e-45 | |
| 297741150 | 261 | unnamed protein product [Vitis vinifera] | 0.767 | 0.582 | 0.630 | 3e-45 | |
| 297741151 | 201 | unnamed protein product [Vitis vinifera] | 0.732 | 0.721 | 0.640 | 5e-45 | |
| 359474379 | 596 | PREDICTED: uncharacterized protein LOC10 | 0.722 | 0.239 | 0.658 | 8e-45 | |
| 388505216 | 273 | unknown [Lotus japonicus] | 0.782 | 0.567 | 0.592 | 1e-41 | |
| 255638223 | 199 | unknown [Glycine max] | 0.787 | 0.783 | 0.606 | 4e-41 | |
| 356540500 | 260 | PREDICTED: thylakoid lumenal protein At1 | 0.762 | 0.580 | 0.578 | 8e-39 | |
| 357481967 | 147 | Thylakoid lumenal protein [Medicago trun | 0.727 | 0.979 | 0.579 | 4e-38 |
| >gi|255583634|ref|XP_002532572.1| conserved hypothetical protein [Ricinus communis] gi|223527699|gb|EEF29806.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 207 bits (528), Expect = 1e-51, Method: Compositional matrix adjust.
Identities = 112/173 (64%), Positives = 130/173 (75%), Gaps = 2/173 (1%)
Query: 1 MALSSISPLSIKSLNFCSSSSKGPYQLHALSKPLWVACQISSKTESDGQFPDCSNNQCAG 60
MA +SISPLSIKS+N SSS+ PY L + SKP + CQ++ TE + + DCS +
Sbjct: 1 MAFTSISPLSIKSVNISPSSSRSPYHLPSQSKPFHILCQLA--TEREDRILDCSTTRYKV 58
Query: 61 PYAKLKNWRVFVSTALAAAVVASCSSNISALADLNKYEAETRGEFGIGSAAQFGSADLRK 120
++K KNWR VSTALAAA + + A ADLNK+EAE RGEFGIGSAAQFGSADLRK
Sbjct: 59 HHSKPKNWRTLVSTALAAAAAVNLGFGLPAAADLNKFEAELRGEFGIGSAAQFGSADLRK 118
Query: 121 AVHVKENFRRANFTSADMRESDFSGSKFNGAYLEKAVAYKANFTVDEICLPLL 173
AVHV ENFRRANFTSADMRESDFSGS FNGAYLEKAVAYKANFT ++ L+
Sbjct: 119 AVHVNENFRRANFTSADMRESDFSGSTFNGAYLEKAVAYKANFTGADLSDTLM 171
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224071571|ref|XP_002303521.1| predicted protein [Populus trichocarpa] gi|222840953|gb|EEE78500.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|449459702|ref|XP_004147585.1| PREDICTED: thylakoid lumenal protein At1g12250, chloroplastic-like [Cucumis sativus] gi|449520611|ref|XP_004167327.1| PREDICTED: thylakoid lumenal protein At1g12250, chloroplastic-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|297741150|emb|CBI31881.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|297741151|emb|CBI31882.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|359474379|ref|XP_002265958.2| PREDICTED: uncharacterized protein LOC100250522 isoform 2 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|388505216|gb|AFK40674.1| unknown [Lotus japonicus] | Back alignment and taxonomy information |
|---|
| >gi|255638223|gb|ACU19425.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356540500|ref|XP_003538726.1| PREDICTED: thylakoid lumenal protein At1g12250, chloroplastic-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|357481967|ref|XP_003611269.1| Thylakoid lumenal protein [Medicago truncatula] gi|355512604|gb|AES94227.1| Thylakoid lumenal protein [Medicago truncatula] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 198 | ||||||
| TAIR|locus:2202033 | 280 | AT1G12250 "AT1G12250" [Arabido | 0.707 | 0.5 | 0.530 | 2.6e-31 |
| TAIR|locus:2202033 AT1G12250 "AT1G12250" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 344 (126.2 bits), Expect = 2.6e-31, P = 2.6e-31
Identities = 79/149 (53%), Positives = 95/149 (63%)
Query: 18 SSSSKGPYQLHALSKPLWVACQISSKTESDGQFPDCSNNQ--CAGPYAKLKNWRXXXXXX 75
SS S+ PY H + L Q+SS+ S+ + D SN + C A+ W+
Sbjct: 21 SSVSRSPY--H-FQRYLLRRLQLSSR--SNLEIKDSSNTREGCCSS-AESNTWKRILSAA 74
Query: 76 XXXXXXXXXXXXXXXLADLNKYEAETRGEFGIGSAAQFGSADLRKAVHVKENFRRANFTS 135
+A+LN++EA+TRGEFGIGSAAQ+GSADL K VH ENFRRANFTS
Sbjct: 75 MAAAVIASSSGVPA-MAELNRFEADTRGEFGIGSAAQYGSADLSKTVHSNENFRRANFTS 133
Query: 136 ADMRESDFSGSKFNGAYLEKAVAYKANFT 164
ADMRESDFSGS FNGAYLEKAVAYKANF+
Sbjct: 134 ADMRESDFSGSTFNGAYLEKAVAYKANFS 162
Parameters:
V=100
filter=SEG
E=0.001
ctxfactor=1.00
Query ----- As Used ----- ----- Computed ----
Frame MatID Matrix name Lambda K H Lambda K H
+0 0 BLOSUM62 0.320 0.133 0.417 same same same
Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a
Query
Frame MatID Length Eff.Length E S W T X E2 S2
+0 0 198 165 0.00093 107 3 11 22 0.37 32
30 0.45 34
Statistics:
Database: /share/blast/go-seqdb.fasta
Title: go_20130330-seqdb.fasta
Posted: 5:47:42 AM PDT Apr 1, 2013
Created: 5:47:42 AM PDT Apr 1, 2013
Format: XDF-1
# of letters in database: 169,044,731
# of sequences in database: 368,745
# of database sequences satisfying E: 1
No. of states in DFA: 602 (64 KB)
Total size of DFA: 162 KB (2095 KB)
Time to generate neighborhood: 0.00u 0.00s 0.00t Elapsed: 00:00:00
No. of threads or processors used: 24
Search cpu time: 13.07u 0.12s 13.19t Elapsed: 00:00:00
Total cpu time: 13.07u 0.12s 13.19t Elapsed: 00:00:00
Start: Fri May 10 08:51:28 2013 End: Fri May 10 08:51:28 2013
|
|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 198 | |||
| pfam00805 | 40 | pfam00805, Pentapeptide, Pentapeptide repeats (8 c | 3e-06 | |
| COG1357 | 238 | COG1357, COG1357, Pentapeptide repeats containing | 2e-05 | |
| COG1357 | 238 | COG1357, COG1357, Pentapeptide repeats containing | 4e-05 | |
| pfam00805 | 40 | pfam00805, Pentapeptide, Pentapeptide repeats (8 c | 9e-05 | |
| COG1357 | 238 | COG1357, COG1357, Pentapeptide repeats containing | 0.001 | |
| COG1357 | 238 | COG1357, COG1357, Pentapeptide repeats containing | 0.002 | |
| COG1357 | 238 | COG1357, COG1357, Pentapeptide repeats containing | 0.002 | |
| COG1357 | 238 | COG1357, COG1357, Pentapeptide repeats containing | 0.002 |
| >gnl|CDD|109845 pfam00805, Pentapeptide, Pentapeptide repeats (8 copies) | Back alignment and domain information |
|---|
Score = 42.0 bits (100), Expect = 3e-06
Identities = 15/38 (39%), Positives = 19/38 (50%)
Query: 127 NFRRANFTSADMRESDFSGSKFNGAYLEKAVAYKANFT 164
N AN AD+R +D SG+ GA L A AN +
Sbjct: 2 NLSGANLRGADLRGADLSGADLTGANLSGANLSGANLS 39
|
These repeats are found in many cyanobacterial proteins. The repeats were first identified in hglK. The function of these repeats is unknown. The structure of this repeat has been predicted to be a beta-helix. The repeat can be approximately described as A(D/N)LXX, where X can be any amino acid. Length = 40 |
| >gnl|CDD|224276 COG1357, COG1357, Pentapeptide repeats containing protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|224276 COG1357, COG1357, Pentapeptide repeats containing protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|109845 pfam00805, Pentapeptide, Pentapeptide repeats (8 copies) | Back alignment and domain information |
|---|
| >gnl|CDD|224276 COG1357, COG1357, Pentapeptide repeats containing protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|224276 COG1357, COG1357, Pentapeptide repeats containing protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|224276 COG1357, COG1357, Pentapeptide repeats containing protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|224276 COG1357, COG1357, Pentapeptide repeats containing protein [Function unknown] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 198 | |||
| PRK15197 | 291 | secreted effector protein PipB; Provisional | 99.35 | |
| PF13599 | 78 | Pentapeptide_4: Pentapeptide repeats (9 copies); P | 99.28 | |
| PRK15377 | 782 | E3 ubiquitin-protein ligase SopA; Provisional | 99.22 | |
| PRK15377 | 782 | E3 ubiquitin-protein ligase SopA; Provisional | 99.22 | |
| KOG1665 | 302 | consensus AFH1-interacting protein FIP2, contains | 99.18 | |
| PF13599 | 78 | Pentapeptide_4: Pentapeptide repeats (9 copies); P | 99.14 | |
| PRK09718 | 512 | hypothetical protein; Validated | 99.05 | |
| KOG1665 | 302 | consensus AFH1-interacting protein FIP2, contains | 99.03 | |
| PRK09718 | 512 | hypothetical protein; Validated | 98.83 |
| >PRK15197 secreted effector protein PipB; Provisional | Back alignment and domain information |
|---|
Probab=99.35 E-value=4.3e-13 Score=119.00 Aligned_cols=34 Identities=9% Similarity=0.073 Sum_probs=14.8
Q ss_pred cCceecCcccCCCccCCc-cCCCCcCCCCccCCCC
Q 029172 159 YKANFTVDEICLPLLVSL-PMATPVFPAGFCAPFP 192 (198)
Q Consensus 159 ~~A~f~~AdLs~A~f~~a-~L~~~vf~~~~~~~~~ 192 (198)
.+++|.+++|.+++|.++ .|.++.|.....+|+|
T Consensus 242 s~A~L~gAnL~~A~L~~a~~L~gad~~ga~~tp~~ 276 (291)
T PRK15197 242 TDTKLNGAKLDKIALTLAKALTGADLTGSQHTPTP 276 (291)
T ss_pred CCCCCCCCCCCccccccCCCCCCCcccCCccCCCC
Confidence 333333333333333444 4444455555555544
|
|
| >PF13599 Pentapeptide_4: Pentapeptide repeats (9 copies); PDB: 2XTY_A 2XTW_C 2XTX_B 3PSS_B 3PSZ_B 3NB2_B 3NAW_B 3SQV_A 2W7Z_B 2XT2_A | Back alignment and domain information |
|---|
| >PRK15377 E3 ubiquitin-protein ligase SopA; Provisional | Back alignment and domain information |
|---|
| >PRK15377 E3 ubiquitin-protein ligase SopA; Provisional | Back alignment and domain information |
|---|
| >KOG1665 consensus AFH1-interacting protein FIP2, contains BTB/POZ domain and pentapeptide repeats [General function prediction only] | Back alignment and domain information |
|---|
| >PF13599 Pentapeptide_4: Pentapeptide repeats (9 copies); PDB: 2XTY_A 2XTW_C 2XTX_B 3PSS_B 3PSZ_B 3NB2_B 3NAW_B 3SQV_A 2W7Z_B 2XT2_A | Back alignment and domain information |
|---|
| >PRK09718 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >KOG1665 consensus AFH1-interacting protein FIP2, contains BTB/POZ domain and pentapeptide repeats [General function prediction only] | Back alignment and domain information |
|---|
| >PRK09718 hypothetical protein; Validated | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 198 | |||
| 2f3l_A | 184 | RFR-domain; beta helix, unknown function; 2.11A {C | 7e-11 | |
| 2f3l_A | 184 | RFR-domain; beta helix, unknown function; 2.11A {C | 4e-07 | |
| 2f3l_A | 184 | RFR-domain; beta helix, unknown function; 2.11A {C | 1e-06 | |
| 2f3l_A | 184 | RFR-domain; beta helix, unknown function; 2.11A {C | 3e-05 | |
| 2f3l_A | 184 | RFR-domain; beta helix, unknown function; 2.11A {C | 2e-04 | |
| 3n90_A | 152 | P15, thylakoid lumenal 15 kDa protein 1, chloropla | 7e-09 | |
| 3n90_A | 152 | P15, thylakoid lumenal 15 kDa protein 1, chloropla | 1e-05 | |
| 3n90_A | 152 | P15, thylakoid lumenal 15 kDa protein 1, chloropla | 4e-05 | |
| 3n90_A | 152 | P15, thylakoid lumenal 15 kDa protein 1, chloropla | 5e-05 | |
| 3n90_A | 152 | P15, thylakoid lumenal 15 kDa protein 1, chloropla | 7e-04 | |
| 2bm5_A | 186 | MFPA, RV3361C, pentapeptide repeat family protein; | 1e-07 | |
| 2bm5_A | 186 | MFPA, RV3361C, pentapeptide repeat family protein; | 6e-07 | |
| 2bm5_A | 186 | MFPA, RV3361C, pentapeptide repeat family protein; | 2e-06 | |
| 2bm5_A | 186 | MFPA, RV3361C, pentapeptide repeat family protein; | 3e-06 | |
| 2bm5_A | 186 | MFPA, RV3361C, pentapeptide repeat family protein; | 6e-06 | |
| 2bm5_A | 186 | MFPA, RV3361C, pentapeptide repeat family protein; | 8e-06 | |
| 2bm5_A | 186 | MFPA, RV3361C, pentapeptide repeat family protein; | 1e-05 | |
| 2bm5_A | 186 | MFPA, RV3361C, pentapeptide repeat family protein; | 1e-05 | |
| 2bm5_A | 186 | MFPA, RV3361C, pentapeptide repeat family protein; | 1e-05 | |
| 2bm5_A | 186 | MFPA, RV3361C, pentapeptide repeat family protein; | 2e-05 | |
| 2xty_A | 217 | QNRB1; cell cycle, pentapeptide repeat, PRP, antib | 1e-07 | |
| 2xty_A | 217 | QNRB1; cell cycle, pentapeptide repeat, PRP, antib | 4e-07 | |
| 2xty_A | 217 | QNRB1; cell cycle, pentapeptide repeat, PRP, antib | 2e-06 | |
| 2xty_A | 217 | QNRB1; cell cycle, pentapeptide repeat, PRP, antib | 6e-06 | |
| 2xty_A | 217 | QNRB1; cell cycle, pentapeptide repeat, PRP, antib | 7e-06 | |
| 2xty_A | 217 | QNRB1; cell cycle, pentapeptide repeat, PRP, antib | 8e-06 | |
| 2xty_A | 217 | QNRB1; cell cycle, pentapeptide repeat, PRP, antib | 9e-06 | |
| 2xty_A | 217 | QNRB1; cell cycle, pentapeptide repeat, PRP, antib | 2e-05 | |
| 2xty_A | 217 | QNRB1; cell cycle, pentapeptide repeat, PRP, antib | 3e-05 | |
| 2xty_A | 217 | QNRB1; cell cycle, pentapeptide repeat, PRP, antib | 4e-05 | |
| 2xty_A | 217 | QNRB1; cell cycle, pentapeptide repeat, PRP, antib | 4e-05 | |
| 2xty_A | 217 | QNRB1; cell cycle, pentapeptide repeat, PRP, antib | 1e-04 | |
| 2xty_A | 217 | QNRB1; cell cycle, pentapeptide repeat, PRP, antib | 2e-04 | |
| 2xty_A | 217 | QNRB1; cell cycle, pentapeptide repeat, PRP, antib | 4e-04 | |
| 2xt2_A | 200 | ALBG, MCBG-like protein; cell cycle, right handed | 3e-07 | |
| 2xt2_A | 200 | ALBG, MCBG-like protein; cell cycle, right handed | 3e-07 | |
| 2xt2_A | 200 | ALBG, MCBG-like protein; cell cycle, right handed | 1e-05 | |
| 2xt2_A | 200 | ALBG, MCBG-like protein; cell cycle, right handed | 1e-05 | |
| 2xt2_A | 200 | ALBG, MCBG-like protein; cell cycle, right handed | 1e-05 | |
| 2xt2_A | 200 | ALBG, MCBG-like protein; cell cycle, right handed | 2e-05 | |
| 2xt2_A | 200 | ALBG, MCBG-like protein; cell cycle, right handed | 2e-05 | |
| 2xt2_A | 200 | ALBG, MCBG-like protein; cell cycle, right handed | 4e-05 | |
| 2xt2_A | 200 | ALBG, MCBG-like protein; cell cycle, right handed | 6e-05 | |
| 2xt2_A | 200 | ALBG, MCBG-like protein; cell cycle, right handed | 8e-05 | |
| 3pss_A | 216 | QNR; pentapeptide repeat, antibiotic resistance, D | 7e-07 | |
| 3pss_A | 216 | QNR; pentapeptide repeat, antibiotic resistance, D | 3e-05 | |
| 3pss_A | 216 | QNR; pentapeptide repeat, antibiotic resistance, D | 4e-05 | |
| 3pss_A | 216 | QNR; pentapeptide repeat, antibiotic resistance, D | 1e-04 | |
| 3pss_A | 216 | QNR; pentapeptide repeat, antibiotic resistance, D | 3e-04 | |
| 3pss_A | 216 | QNR; pentapeptide repeat, antibiotic resistance, D | 7e-04 | |
| 3du1_X | 257 | ALL3740 protein, HETL; right-handed beta helix, re | 1e-06 | |
| 3du1_X | 257 | ALL3740 protein, HETL; right-handed beta helix, re | 2e-06 | |
| 3du1_X | 257 | ALL3740 protein, HETL; right-handed beta helix, re | 2e-06 | |
| 3du1_X | 257 | ALL3740 protein, HETL; right-handed beta helix, re | 3e-06 | |
| 3du1_X | 257 | ALL3740 protein, HETL; right-handed beta helix, re | 4e-06 | |
| 3du1_X | 257 | ALL3740 protein, HETL; right-handed beta helix, re | 4e-06 | |
| 3du1_X | 257 | ALL3740 protein, HETL; right-handed beta helix, re | 6e-06 | |
| 3du1_X | 257 | ALL3740 protein, HETL; right-handed beta helix, re | 7e-06 | |
| 3du1_X | 257 | ALL3740 protein, HETL; right-handed beta helix, re | 2e-05 | |
| 3du1_X | 257 | ALL3740 protein, HETL; right-handed beta helix, re | 2e-05 | |
| 3du1_X | 257 | ALL3740 protein, HETL; right-handed beta helix, re | 9e-05 | |
| 3du1_X | 257 | ALL3740 protein, HETL; right-handed beta helix, re | 1e-04 | |
| 3du1_X | 257 | ALL3740 protein, HETL; right-handed beta helix, re | 3e-04 | |
| 3nb2_A | 613 | Secreted effector protein; pentapeptide, HECT doma | 1e-06 | |
| 3nb2_A | 613 | Secreted effector protein; pentapeptide, HECT doma | 6e-06 | |
| 3nb2_A | 613 | Secreted effector protein; pentapeptide, HECT doma | 3e-05 | |
| 3nb2_A | 613 | Secreted effector protein; pentapeptide, HECT doma | 2e-04 | |
| 3nb2_A | 613 | Secreted effector protein; pentapeptide, HECT doma | 3e-04 | |
| 3nb2_A | 613 | Secreted effector protein; pentapeptide, HECT doma | 6e-04 | |
| 2qyu_A | 627 | Secreted effector protein; ubiquitin E3 ligase, li | 2e-06 | |
| 2qyu_A | 627 | Secreted effector protein; ubiquitin E3 ligase, li | 3e-06 | |
| 2qyu_A | 627 | Secreted effector protein; ubiquitin E3 ligase, li | 4e-06 | |
| 2qyu_A | 627 | Secreted effector protein; ubiquitin E3 ligase, li | 6e-06 | |
| 2qyu_A | 627 | Secreted effector protein; ubiquitin E3 ligase, li | 4e-05 | |
| 2j8k_A | 201 | NP275-NP276; pentapeptide repeat protein, PRP, rig | 4e-06 | |
| 2j8k_A | 201 | NP275-NP276; pentapeptide repeat protein, PRP, rig | 4e-06 | |
| 2j8k_A | 201 | NP275-NP276; pentapeptide repeat protein, PRP, rig | 5e-06 | |
| 2j8k_A | 201 | NP275-NP276; pentapeptide repeat protein, PRP, rig | 1e-05 | |
| 2j8k_A | 201 | NP275-NP276; pentapeptide repeat protein, PRP, rig | 1e-05 | |
| 2j8k_A | 201 | NP275-NP276; pentapeptide repeat protein, PRP, rig | 1e-05 | |
| 2j8k_A | 201 | NP275-NP276; pentapeptide repeat protein, PRP, rig | 2e-05 | |
| 2j8k_A | 201 | NP275-NP276; pentapeptide repeat protein, PRP, rig | 3e-05 | |
| 2j8k_A | 201 | NP275-NP276; pentapeptide repeat protein, PRP, rig | 4e-05 | |
| 2j8k_A | 201 | NP275-NP276; pentapeptide repeat protein, PRP, rig | 4e-05 | |
| 2j8k_A | 201 | NP275-NP276; pentapeptide repeat protein, PRP, rig | 4e-05 | |
| 2j8k_A | 201 | NP275-NP276; pentapeptide repeat protein, PRP, rig | 5e-05 | |
| 2j8k_A | 201 | NP275-NP276; pentapeptide repeat protein, PRP, rig | 2e-04 | |
| 2j8k_A | 201 | NP275-NP276; pentapeptide repeat protein, PRP, rig | 8e-04 | |
| 2o6w_A | 150 | Repeat five residue (RFR) protein or pentapeptide | 8e-06 | |
| 2o6w_A | 150 | Repeat five residue (RFR) protein or pentapeptide | 1e-05 | |
| 2o6w_A | 150 | Repeat five residue (RFR) protein or pentapeptide | 4e-05 | |
| 2o6w_A | 150 | Repeat five residue (RFR) protein or pentapeptide | 4e-05 | |
| 2o6w_A | 150 | Repeat five residue (RFR) protein or pentapeptide | 7e-05 | |
| 2o6w_A | 150 | Repeat five residue (RFR) protein or pentapeptide | 1e-04 | |
| 2o6w_A | 150 | Repeat five residue (RFR) protein or pentapeptide | 2e-04 | |
| 2w7z_A | 214 | EFSQNR, pentapeptide repeat family protein; glutar | 9e-06 | |
| 2w7z_A | 214 | EFSQNR, pentapeptide repeat family protein; glutar | 1e-05 | |
| 2w7z_A | 214 | EFSQNR, pentapeptide repeat family protein; glutar | 1e-05 | |
| 2w7z_A | 214 | EFSQNR, pentapeptide repeat family protein; glutar | 2e-05 | |
| 2w7z_A | 214 | EFSQNR, pentapeptide repeat family protein; glutar | 1e-04 | |
| 2w7z_A | 214 | EFSQNR, pentapeptide repeat family protein; glutar | 1e-04 | |
| 2w7z_A | 214 | EFSQNR, pentapeptide repeat family protein; glutar | 3e-04 |
| >2f3l_A RFR-domain; beta helix, unknown function; 2.11A {Cyanothece SP} SCOP: b.80.8.1 PDB: 2g0y_A Length = 184 | Back alignment and structure |
|---|
Score = 57.5 bits (140), Expect = 7e-11
Identities = 17/73 (23%), Positives = 30/73 (41%)
Query: 92 ADLNKYEAETRGEFGIGSAAQFGSADLRKAVHVKENFRRANFTSADMRESDFSGSKFNGA 151
DL + + GS+A + L ++ A FT+AD+ +S+FS + GA
Sbjct: 33 PDLGTDDDDKAMAMVTGSSASYEDVKLIGEDFSGKSLTYAQFTNADLTDSNFSEADLRGA 92
Query: 152 YLEKAVAYKANFT 164
+ A+
Sbjct: 93 VFNGSALIGADLH 105
|
| >2f3l_A RFR-domain; beta helix, unknown function; 2.11A {Cyanothece SP} SCOP: b.80.8.1 PDB: 2g0y_A Length = 184 | Back alignment and structure |
|---|
| >2f3l_A RFR-domain; beta helix, unknown function; 2.11A {Cyanothece SP} SCOP: b.80.8.1 PDB: 2g0y_A Length = 184 | Back alignment and structure |
|---|
| >2f3l_A RFR-domain; beta helix, unknown function; 2.11A {Cyanothece SP} SCOP: b.80.8.1 PDB: 2g0y_A Length = 184 | Back alignment and structure |
|---|
| >2f3l_A RFR-domain; beta helix, unknown function; 2.11A {Cyanothece SP} SCOP: b.80.8.1 PDB: 2g0y_A Length = 184 | Back alignment and structure |
|---|
| >3n90_A P15, thylakoid lumenal 15 kDa protein 1, chloroplastic; right-handed quadrilateral beta helix; 1.70A {Arabidopsis thaliana} Length = 152 | Back alignment and structure |
|---|
| >3n90_A P15, thylakoid lumenal 15 kDa protein 1, chloroplastic; right-handed quadrilateral beta helix; 1.70A {Arabidopsis thaliana} Length = 152 | Back alignment and structure |
|---|
| >3n90_A P15, thylakoid lumenal 15 kDa protein 1, chloroplastic; right-handed quadrilateral beta helix; 1.70A {Arabidopsis thaliana} Length = 152 | Back alignment and structure |
|---|
| >3n90_A P15, thylakoid lumenal 15 kDa protein 1, chloroplastic; right-handed quadrilateral beta helix; 1.70A {Arabidopsis thaliana} Length = 152 | Back alignment and structure |
|---|
| >3n90_A P15, thylakoid lumenal 15 kDa protein 1, chloroplastic; right-handed quadrilateral beta helix; 1.70A {Arabidopsis thaliana} Length = 152 | Back alignment and structure |
|---|
| >2bm5_A MFPA, RV3361C, pentapeptide repeat family protein; pentapeptide repeat protein, fluroquinolone resistance, DNA gyrase, DNA mimicry; 2.0A {Mycobacterium tuberculosis} SCOP: b.80.8.1 PDB: 2bm4_A 2bm6_A 2bm7_A Length = 186 | Back alignment and structure |
|---|
| >2bm5_A MFPA, RV3361C, pentapeptide repeat family protein; pentapeptide repeat protein, fluroquinolone resistance, DNA gyrase, DNA mimicry; 2.0A {Mycobacterium tuberculosis} SCOP: b.80.8.1 PDB: 2bm4_A 2bm6_A 2bm7_A Length = 186 | Back alignment and structure |
|---|
| >2bm5_A MFPA, RV3361C, pentapeptide repeat family protein; pentapeptide repeat protein, fluroquinolone resistance, DNA gyrase, DNA mimicry; 2.0A {Mycobacterium tuberculosis} SCOP: b.80.8.1 PDB: 2bm4_A 2bm6_A 2bm7_A Length = 186 | Back alignment and structure |
|---|
| >2bm5_A MFPA, RV3361C, pentapeptide repeat family protein; pentapeptide repeat protein, fluroquinolone resistance, DNA gyrase, DNA mimicry; 2.0A {Mycobacterium tuberculosis} SCOP: b.80.8.1 PDB: 2bm4_A 2bm6_A 2bm7_A Length = 186 | Back alignment and structure |
|---|
| >2bm5_A MFPA, RV3361C, pentapeptide repeat family protein; pentapeptide repeat protein, fluroquinolone resistance, DNA gyrase, DNA mimicry; 2.0A {Mycobacterium tuberculosis} SCOP: b.80.8.1 PDB: 2bm4_A 2bm6_A 2bm7_A Length = 186 | Back alignment and structure |
|---|
| >2bm5_A MFPA, RV3361C, pentapeptide repeat family protein; pentapeptide repeat protein, fluroquinolone resistance, DNA gyrase, DNA mimicry; 2.0A {Mycobacterium tuberculosis} SCOP: b.80.8.1 PDB: 2bm4_A 2bm6_A 2bm7_A Length = 186 | Back alignment and structure |
|---|
| >2bm5_A MFPA, RV3361C, pentapeptide repeat family protein; pentapeptide repeat protein, fluroquinolone resistance, DNA gyrase, DNA mimicry; 2.0A {Mycobacterium tuberculosis} SCOP: b.80.8.1 PDB: 2bm4_A 2bm6_A 2bm7_A Length = 186 | Back alignment and structure |
|---|
| >2bm5_A MFPA, RV3361C, pentapeptide repeat family protein; pentapeptide repeat protein, fluroquinolone resistance, DNA gyrase, DNA mimicry; 2.0A {Mycobacterium tuberculosis} SCOP: b.80.8.1 PDB: 2bm4_A 2bm6_A 2bm7_A Length = 186 | Back alignment and structure |
|---|
| >2bm5_A MFPA, RV3361C, pentapeptide repeat family protein; pentapeptide repeat protein, fluroquinolone resistance, DNA gyrase, DNA mimicry; 2.0A {Mycobacterium tuberculosis} SCOP: b.80.8.1 PDB: 2bm4_A 2bm6_A 2bm7_A Length = 186 | Back alignment and structure |
|---|
| >2bm5_A MFPA, RV3361C, pentapeptide repeat family protein; pentapeptide repeat protein, fluroquinolone resistance, DNA gyrase, DNA mimicry; 2.0A {Mycobacterium tuberculosis} SCOP: b.80.8.1 PDB: 2bm4_A 2bm6_A 2bm7_A Length = 186 | Back alignment and structure |
|---|
| >2xty_A QNRB1; cell cycle, pentapeptide repeat, PRP, antibiotic resistance, handed quadrilateral beta-helix; 1.80A {Klebsiella pneumoniae} PDB: 2xtw_A 2xtx_A Length = 217 | Back alignment and structure |
|---|
| >2xty_A QNRB1; cell cycle, pentapeptide repeat, PRP, antibiotic resistance, handed quadrilateral beta-helix; 1.80A {Klebsiella pneumoniae} PDB: 2xtw_A 2xtx_A Length = 217 | Back alignment and structure |
|---|
| >2xty_A QNRB1; cell cycle, pentapeptide repeat, PRP, antibiotic resistance, handed quadrilateral beta-helix; 1.80A {Klebsiella pneumoniae} PDB: 2xtw_A 2xtx_A Length = 217 | Back alignment and structure |
|---|
| >2xty_A QNRB1; cell cycle, pentapeptide repeat, PRP, antibiotic resistance, handed quadrilateral beta-helix; 1.80A {Klebsiella pneumoniae} PDB: 2xtw_A 2xtx_A Length = 217 | Back alignment and structure |
|---|
| >2xty_A QNRB1; cell cycle, pentapeptide repeat, PRP, antibiotic resistance, handed quadrilateral beta-helix; 1.80A {Klebsiella pneumoniae} PDB: 2xtw_A 2xtx_A Length = 217 | Back alignment and structure |
|---|
| >2xty_A QNRB1; cell cycle, pentapeptide repeat, PRP, antibiotic resistance, handed quadrilateral beta-helix; 1.80A {Klebsiella pneumoniae} PDB: 2xtw_A 2xtx_A Length = 217 | Back alignment and structure |
|---|
| >2xty_A QNRB1; cell cycle, pentapeptide repeat, PRP, antibiotic resistance, handed quadrilateral beta-helix; 1.80A {Klebsiella pneumoniae} PDB: 2xtw_A 2xtx_A Length = 217 | Back alignment and structure |
|---|
| >2xty_A QNRB1; cell cycle, pentapeptide repeat, PRP, antibiotic resistance, handed quadrilateral beta-helix; 1.80A {Klebsiella pneumoniae} PDB: 2xtw_A 2xtx_A Length = 217 | Back alignment and structure |
|---|
| >2xty_A QNRB1; cell cycle, pentapeptide repeat, PRP, antibiotic resistance, handed quadrilateral beta-helix; 1.80A {Klebsiella pneumoniae} PDB: 2xtw_A 2xtx_A Length = 217 | Back alignment and structure |
|---|
| >2xty_A QNRB1; cell cycle, pentapeptide repeat, PRP, antibiotic resistance, handed quadrilateral beta-helix; 1.80A {Klebsiella pneumoniae} PDB: 2xtw_A 2xtx_A Length = 217 | Back alignment and structure |
|---|
| >2xty_A QNRB1; cell cycle, pentapeptide repeat, PRP, antibiotic resistance, handed quadrilateral beta-helix; 1.80A {Klebsiella pneumoniae} PDB: 2xtw_A 2xtx_A Length = 217 | Back alignment and structure |
|---|
| >2xty_A QNRB1; cell cycle, pentapeptide repeat, PRP, antibiotic resistance, handed quadrilateral beta-helix; 1.80A {Klebsiella pneumoniae} PDB: 2xtw_A 2xtx_A Length = 217 | Back alignment and structure |
|---|
| >2xty_A QNRB1; cell cycle, pentapeptide repeat, PRP, antibiotic resistance, handed quadrilateral beta-helix; 1.80A {Klebsiella pneumoniae} PDB: 2xtw_A 2xtx_A Length = 217 | Back alignment and structure |
|---|
| >2xty_A QNRB1; cell cycle, pentapeptide repeat, PRP, antibiotic resistance, handed quadrilateral beta-helix; 1.80A {Klebsiella pneumoniae} PDB: 2xtw_A 2xtx_A Length = 217 | Back alignment and structure |
|---|
| >2xt2_A ALBG, MCBG-like protein; cell cycle, right handed quadrilateral beta helix; 2.00A {Xanthomonas albilineans} PDB: 2xt4_A Length = 200 | Back alignment and structure |
|---|
| >2xt2_A ALBG, MCBG-like protein; cell cycle, right handed quadrilateral beta helix; 2.00A {Xanthomonas albilineans} PDB: 2xt4_A Length = 200 | Back alignment and structure |
|---|
| >2xt2_A ALBG, MCBG-like protein; cell cycle, right handed quadrilateral beta helix; 2.00A {Xanthomonas albilineans} PDB: 2xt4_A Length = 200 | Back alignment and structure |
|---|
| >2xt2_A ALBG, MCBG-like protein; cell cycle, right handed quadrilateral beta helix; 2.00A {Xanthomonas albilineans} PDB: 2xt4_A Length = 200 | Back alignment and structure |
|---|
| >2xt2_A ALBG, MCBG-like protein; cell cycle, right handed quadrilateral beta helix; 2.00A {Xanthomonas albilineans} PDB: 2xt4_A Length = 200 | Back alignment and structure |
|---|
| >2xt2_A ALBG, MCBG-like protein; cell cycle, right handed quadrilateral beta helix; 2.00A {Xanthomonas albilineans} PDB: 2xt4_A Length = 200 | Back alignment and structure |
|---|
| >2xt2_A ALBG, MCBG-like protein; cell cycle, right handed quadrilateral beta helix; 2.00A {Xanthomonas albilineans} PDB: 2xt4_A Length = 200 | Back alignment and structure |
|---|
| >2xt2_A ALBG, MCBG-like protein; cell cycle, right handed quadrilateral beta helix; 2.00A {Xanthomonas albilineans} PDB: 2xt4_A Length = 200 | Back alignment and structure |
|---|
| >2xt2_A ALBG, MCBG-like protein; cell cycle, right handed quadrilateral beta helix; 2.00A {Xanthomonas albilineans} PDB: 2xt4_A Length = 200 | Back alignment and structure |
|---|
| >2xt2_A ALBG, MCBG-like protein; cell cycle, right handed quadrilateral beta helix; 2.00A {Xanthomonas albilineans} PDB: 2xt4_A Length = 200 | Back alignment and structure |
|---|
| >3pss_A QNR; pentapeptide repeat, antibiotic resistance, DNA topoisomeras cell cycle; HET: MLY; 2.00A {Aeromonas hydrophila} PDB: 3psz_A Length = 216 | Back alignment and structure |
|---|
| >3pss_A QNR; pentapeptide repeat, antibiotic resistance, DNA topoisomeras cell cycle; HET: MLY; 2.00A {Aeromonas hydrophila} PDB: 3psz_A Length = 216 | Back alignment and structure |
|---|
| >3pss_A QNR; pentapeptide repeat, antibiotic resistance, DNA topoisomeras cell cycle; HET: MLY; 2.00A {Aeromonas hydrophila} PDB: 3psz_A Length = 216 | Back alignment and structure |
|---|
| >3pss_A QNR; pentapeptide repeat, antibiotic resistance, DNA topoisomeras cell cycle; HET: MLY; 2.00A {Aeromonas hydrophila} PDB: 3psz_A Length = 216 | Back alignment and structure |
|---|
| >3pss_A QNR; pentapeptide repeat, antibiotic resistance, DNA topoisomeras cell cycle; HET: MLY; 2.00A {Aeromonas hydrophila} PDB: 3psz_A Length = 216 | Back alignment and structure |
|---|
| >3pss_A QNR; pentapeptide repeat, antibiotic resistance, DNA topoisomeras cell cycle; HET: MLY; 2.00A {Aeromonas hydrophila} PDB: 3psz_A Length = 216 | Back alignment and structure |
|---|
| >3du1_X ALL3740 protein, HETL; right-handed beta helix, repeated five residue fold, pentape repeat protein, structural protein; 2.00A {Nostoc SP} Length = 257 | Back alignment and structure |
|---|
| >3du1_X ALL3740 protein, HETL; right-handed beta helix, repeated five residue fold, pentape repeat protein, structural protein; 2.00A {Nostoc SP} Length = 257 | Back alignment and structure |
|---|
| >3du1_X ALL3740 protein, HETL; right-handed beta helix, repeated five residue fold, pentape repeat protein, structural protein; 2.00A {Nostoc SP} Length = 257 | Back alignment and structure |
|---|
| >3du1_X ALL3740 protein, HETL; right-handed beta helix, repeated five residue fold, pentape repeat protein, structural protein; 2.00A {Nostoc SP} Length = 257 | Back alignment and structure |
|---|
| >3du1_X ALL3740 protein, HETL; right-handed beta helix, repeated five residue fold, pentape repeat protein, structural protein; 2.00A {Nostoc SP} Length = 257 | Back alignment and structure |
|---|
| >3du1_X ALL3740 protein, HETL; right-handed beta helix, repeated five residue fold, pentape repeat protein, structural protein; 2.00A {Nostoc SP} Length = 257 | Back alignment and structure |
|---|
| >3du1_X ALL3740 protein, HETL; right-handed beta helix, repeated five residue fold, pentape repeat protein, structural protein; 2.00A {Nostoc SP} Length = 257 | Back alignment and structure |
|---|
| >3du1_X ALL3740 protein, HETL; right-handed beta helix, repeated five residue fold, pentape repeat protein, structural protein; 2.00A {Nostoc SP} Length = 257 | Back alignment and structure |
|---|
| >3du1_X ALL3740 protein, HETL; right-handed beta helix, repeated five residue fold, pentape repeat protein, structural protein; 2.00A {Nostoc SP} Length = 257 | Back alignment and structure |
|---|
| >3du1_X ALL3740 protein, HETL; right-handed beta helix, repeated five residue fold, pentape repeat protein, structural protein; 2.00A {Nostoc SP} Length = 257 | Back alignment and structure |
|---|
| >3du1_X ALL3740 protein, HETL; right-handed beta helix, repeated five residue fold, pentape repeat protein, structural protein; 2.00A {Nostoc SP} Length = 257 | Back alignment and structure |
|---|
| >3du1_X ALL3740 protein, HETL; right-handed beta helix, repeated five residue fold, pentape repeat protein, structural protein; 2.00A {Nostoc SP} Length = 257 | Back alignment and structure |
|---|
| >3du1_X ALL3740 protein, HETL; right-handed beta helix, repeated five residue fold, pentape repeat protein, structural protein; 2.00A {Nostoc SP} Length = 257 | Back alignment and structure |
|---|
| >3nb2_A Secreted effector protein; pentapeptide, HECT domain, HECT E ubiquitin ligase, ligase; HET: MES; 2.10A {Escherichia coli} PDB: 3naw_A* 3sqv_A Length = 613 | Back alignment and structure |
|---|
| >3nb2_A Secreted effector protein; pentapeptide, HECT domain, HECT E ubiquitin ligase, ligase; HET: MES; 2.10A {Escherichia coli} PDB: 3naw_A* 3sqv_A Length = 613 | Back alignment and structure |
|---|
| >3nb2_A Secreted effector protein; pentapeptide, HECT domain, HECT E ubiquitin ligase, ligase; HET: MES; 2.10A {Escherichia coli} PDB: 3naw_A* 3sqv_A Length = 613 | Back alignment and structure |
|---|
| >3nb2_A Secreted effector protein; pentapeptide, HECT domain, HECT E ubiquitin ligase, ligase; HET: MES; 2.10A {Escherichia coli} PDB: 3naw_A* 3sqv_A Length = 613 | Back alignment and structure |
|---|
| >3nb2_A Secreted effector protein; pentapeptide, HECT domain, HECT E ubiquitin ligase, ligase; HET: MES; 2.10A {Escherichia coli} PDB: 3naw_A* 3sqv_A Length = 613 | Back alignment and structure |
|---|
| >3nb2_A Secreted effector protein; pentapeptide, HECT domain, HECT E ubiquitin ligase, ligase; HET: MES; 2.10A {Escherichia coli} PDB: 3naw_A* 3sqv_A Length = 613 | Back alignment and structure |
|---|
| >2qyu_A Secreted effector protein; ubiquitin E3 ligase, ligase; HET: B3P; 2.10A {Salmonella typhimurium} PDB: 3sy2_A 2qza_A Length = 627 | Back alignment and structure |
|---|
| >2qyu_A Secreted effector protein; ubiquitin E3 ligase, ligase; HET: B3P; 2.10A {Salmonella typhimurium} PDB: 3sy2_A 2qza_A Length = 627 | Back alignment and structure |
|---|
| >2qyu_A Secreted effector protein; ubiquitin E3 ligase, ligase; HET: B3P; 2.10A {Salmonella typhimurium} PDB: 3sy2_A 2qza_A Length = 627 | Back alignment and structure |
|---|
| >2qyu_A Secreted effector protein; ubiquitin E3 ligase, ligase; HET: B3P; 2.10A {Salmonella typhimurium} PDB: 3sy2_A 2qza_A Length = 627 | Back alignment and structure |
|---|
| >2qyu_A Secreted effector protein; ubiquitin E3 ligase, ligase; HET: B3P; 2.10A {Salmonella typhimurium} PDB: 3sy2_A 2qza_A Length = 627 | Back alignment and structure |
|---|
| >2j8k_A NP275-NP276; pentapeptide repeat protein, PRP, right handed quadrilateral beta helix, RHQBH, toxin; HET: MES; 1.5A {Nostoc punctiforme} SCOP: b.80.8.1 PDB: 2j8i_A Length = 201 | Back alignment and structure |
|---|
| >2j8k_A NP275-NP276; pentapeptide repeat protein, PRP, right handed quadrilateral beta helix, RHQBH, toxin; HET: MES; 1.5A {Nostoc punctiforme} SCOP: b.80.8.1 PDB: 2j8i_A Length = 201 | Back alignment and structure |
|---|
| >2j8k_A NP275-NP276; pentapeptide repeat protein, PRP, right handed quadrilateral beta helix, RHQBH, toxin; HET: MES; 1.5A {Nostoc punctiforme} SCOP: b.80.8.1 PDB: 2j8i_A Length = 201 | Back alignment and structure |
|---|
| >2j8k_A NP275-NP276; pentapeptide repeat protein, PRP, right handed quadrilateral beta helix, RHQBH, toxin; HET: MES; 1.5A {Nostoc punctiforme} SCOP: b.80.8.1 PDB: 2j8i_A Length = 201 | Back alignment and structure |
|---|
| >2j8k_A NP275-NP276; pentapeptide repeat protein, PRP, right handed quadrilateral beta helix, RHQBH, toxin; HET: MES; 1.5A {Nostoc punctiforme} SCOP: b.80.8.1 PDB: 2j8i_A Length = 201 | Back alignment and structure |
|---|
| >2j8k_A NP275-NP276; pentapeptide repeat protein, PRP, right handed quadrilateral beta helix, RHQBH, toxin; HET: MES; 1.5A {Nostoc punctiforme} SCOP: b.80.8.1 PDB: 2j8i_A Length = 201 | Back alignment and structure |
|---|
| >2j8k_A NP275-NP276; pentapeptide repeat protein, PRP, right handed quadrilateral beta helix, RHQBH, toxin; HET: MES; 1.5A {Nostoc punctiforme} SCOP: b.80.8.1 PDB: 2j8i_A Length = 201 | Back alignment and structure |
|---|
| >2j8k_A NP275-NP276; pentapeptide repeat protein, PRP, right handed quadrilateral beta helix, RHQBH, toxin; HET: MES; 1.5A {Nostoc punctiforme} SCOP: b.80.8.1 PDB: 2j8i_A Length = 201 | Back alignment and structure |
|---|
| >2j8k_A NP275-NP276; pentapeptide repeat protein, PRP, right handed quadrilateral beta helix, RHQBH, toxin; HET: MES; 1.5A {Nostoc punctiforme} SCOP: b.80.8.1 PDB: 2j8i_A Length = 201 | Back alignment and structure |
|---|
| >2j8k_A NP275-NP276; pentapeptide repeat protein, PRP, right handed quadrilateral beta helix, RHQBH, toxin; HET: MES; 1.5A {Nostoc punctiforme} SCOP: b.80.8.1 PDB: 2j8i_A Length = 201 | Back alignment and structure |
|---|
| >2j8k_A NP275-NP276; pentapeptide repeat protein, PRP, right handed quadrilateral beta helix, RHQBH, toxin; HET: MES; 1.5A {Nostoc punctiforme} SCOP: b.80.8.1 PDB: 2j8i_A Length = 201 | Back alignment and structure |
|---|
| >2j8k_A NP275-NP276; pentapeptide repeat protein, PRP, right handed quadrilateral beta helix, RHQBH, toxin; HET: MES; 1.5A {Nostoc punctiforme} SCOP: b.80.8.1 PDB: 2j8i_A Length = 201 | Back alignment and structure |
|---|
| >2j8k_A NP275-NP276; pentapeptide repeat protein, PRP, right handed quadrilateral beta helix, RHQBH, toxin; HET: MES; 1.5A {Nostoc punctiforme} SCOP: b.80.8.1 PDB: 2j8i_A Length = 201 | Back alignment and structure |
|---|
| >2j8k_A NP275-NP276; pentapeptide repeat protein, PRP, right handed quadrilateral beta helix, RHQBH, toxin; HET: MES; 1.5A {Nostoc punctiforme} SCOP: b.80.8.1 PDB: 2j8i_A Length = 201 | Back alignment and structure |
|---|
| >2o6w_A Repeat five residue (RFR) protein or pentapeptide repeat protein; beta helix, unknown function; 2.40A {Cyanothece} Length = 150 | Back alignment and structure |
|---|
| >2o6w_A Repeat five residue (RFR) protein or pentapeptide repeat protein; beta helix, unknown function; 2.40A {Cyanothece} Length = 150 | Back alignment and structure |
|---|
| >2o6w_A Repeat five residue (RFR) protein or pentapeptide repeat protein; beta helix, unknown function; 2.40A {Cyanothece} Length = 150 | Back alignment and structure |
|---|
| >2o6w_A Repeat five residue (RFR) protein or pentapeptide repeat protein; beta helix, unknown function; 2.40A {Cyanothece} Length = 150 | Back alignment and structure |
|---|
| >2o6w_A Repeat five residue (RFR) protein or pentapeptide repeat protein; beta helix, unknown function; 2.40A {Cyanothece} Length = 150 | Back alignment and structure |
|---|
| >2o6w_A Repeat five residue (RFR) protein or pentapeptide repeat protein; beta helix, unknown function; 2.40A {Cyanothece} Length = 150 | Back alignment and structure |
|---|
| >2o6w_A Repeat five residue (RFR) protein or pentapeptide repeat protein; beta helix, unknown function; 2.40A {Cyanothece} Length = 150 | Back alignment and structure |
|---|
| >2w7z_A EFSQNR, pentapeptide repeat family protein; glutaraldehyde, gyrase inhibitor, cyclic pentylation, chemic modification; HET: LP6; 1.60A {Enterococcus faecalis} Length = 214 | Back alignment and structure |
|---|
| >2w7z_A EFSQNR, pentapeptide repeat family protein; glutaraldehyde, gyrase inhibitor, cyclic pentylation, chemic modification; HET: LP6; 1.60A {Enterococcus faecalis} Length = 214 | Back alignment and structure |
|---|
| >2w7z_A EFSQNR, pentapeptide repeat family protein; glutaraldehyde, gyrase inhibitor, cyclic pentylation, chemic modification; HET: LP6; 1.60A {Enterococcus faecalis} Length = 214 | Back alignment and structure |
|---|
| >2w7z_A EFSQNR, pentapeptide repeat family protein; glutaraldehyde, gyrase inhibitor, cyclic pentylation, chemic modification; HET: LP6; 1.60A {Enterococcus faecalis} Length = 214 | Back alignment and structure |
|---|
| >2w7z_A EFSQNR, pentapeptide repeat family protein; glutaraldehyde, gyrase inhibitor, cyclic pentylation, chemic modification; HET: LP6; 1.60A {Enterococcus faecalis} Length = 214 | Back alignment and structure |
|---|
| >2w7z_A EFSQNR, pentapeptide repeat family protein; glutaraldehyde, gyrase inhibitor, cyclic pentylation, chemic modification; HET: LP6; 1.60A {Enterococcus faecalis} Length = 214 | Back alignment and structure |
|---|
| >2w7z_A EFSQNR, pentapeptide repeat family protein; glutaraldehyde, gyrase inhibitor, cyclic pentylation, chemic modification; HET: LP6; 1.60A {Enterococcus faecalis} Length = 214 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 198 | |||
| 2j8k_A | 201 | NP275-NP276; pentapeptide repeat protein, PRP, rig | 99.5 | |
| 3n90_A | 152 | P15, thylakoid lumenal 15 kDa protein 1, chloropla | 99.49 | |
| 3n90_A | 152 | P15, thylakoid lumenal 15 kDa protein 1, chloropla | 99.46 | |
| 2f3l_A | 184 | RFR-domain; beta helix, unknown function; 2.11A {C | 99.45 | |
| 3du1_X | 257 | ALL3740 protein, HETL; right-handed beta helix, re | 99.45 | |
| 3du1_X | 257 | ALL3740 protein, HETL; right-handed beta helix, re | 99.45 | |
| 2f3l_A | 184 | RFR-domain; beta helix, unknown function; 2.11A {C | 99.42 | |
| 2bm5_A | 186 | MFPA, RV3361C, pentapeptide repeat family protein; | 99.41 | |
| 2w7z_A | 214 | EFSQNR, pentapeptide repeat family protein; glutar | 99.39 | |
| 2xt2_A | 200 | ALBG, MCBG-like protein; cell cycle, right handed | 99.37 | |
| 2qyu_A | 627 | Secreted effector protein; ubiquitin E3 ligase, li | 99.21 | |
| 2qyu_A | 627 | Secreted effector protein; ubiquitin E3 ligase, li | 99.17 |
| >2j8k_A NP275-NP276; pentapeptide repeat protein, PRP, right handed quadrilateral beta helix, RHQBH, toxin; HET: MES; 1.5A {Nostoc punctiforme} SCOP: b.80.8.1 PDB: 2j8i_A | Back alignment and structure |
|---|
Probab=99.50 E-value=1.8e-14 Score=119.06 Aligned_cols=46 Identities=20% Similarity=0.196 Sum_probs=20.2
Q ss_pred cccCCcccCceecCccccCceecCcccCCCccCCccCCCCcCCCCc
Q 029172 142 DFSGSKFNGAYLEKAVAYKANFTVDEICLPLLVSLPMATPVFPAGF 187 (198)
Q Consensus 142 ~F~gAdL~gA~f~~A~L~~A~f~~AdLs~A~f~~a~L~~~vf~~~~ 187 (198)
+|++|+|++++|.+++|.+++|++++|++++|+++.|.+++++++.
T Consensus 151 ~L~~a~l~~a~l~~a~l~~a~l~~a~l~~a~l~~a~l~ga~l~~~~ 196 (201)
T 2j8k_A 151 DLSGADLAIADLHQANLHQAALERANLTGANLEDANLEGTILEGGN 196 (201)
T ss_dssp BCTTCBCTTCBCTTCBCTTCBCTTCBCTTCBCTTCBCTTSTTTTC-
T ss_pred CCCCCCcCCCEeCCCCcCCCCCCCCCCCCCCcCCCEECcCCCCCCc
Confidence 3333333333444444444444444444444445555555555544
|
| >3n90_A P15, thylakoid lumenal 15 kDa protein 1, chloroplastic; right-handed quadrilateral beta helix; 1.70A {Arabidopsis thaliana} SCOP: b.80.8.0 | Back alignment and structure |
|---|
| >3n90_A P15, thylakoid lumenal 15 kDa protein 1, chloroplastic; right-handed quadrilateral beta helix; 1.70A {Arabidopsis thaliana} SCOP: b.80.8.0 | Back alignment and structure |
|---|
| >2f3l_A RFR-domain; beta helix, unknown function; 2.11A {Cyanothece SP} SCOP: b.80.8.1 PDB: 2g0y_A | Back alignment and structure |
|---|
| >3du1_X ALL3740 protein, HETL; right-handed beta helix, repeated five residue fold, pentape repeat protein, structural protein; 2.00A {Nostoc SP} | Back alignment and structure |
|---|
| >3du1_X ALL3740 protein, HETL; right-handed beta helix, repeated five residue fold, pentape repeat protein, structural protein; 2.00A {Nostoc SP} | Back alignment and structure |
|---|
| >2f3l_A RFR-domain; beta helix, unknown function; 2.11A {Cyanothece SP} SCOP: b.80.8.1 PDB: 2g0y_A | Back alignment and structure |
|---|
| >2bm5_A MFPA, RV3361C, pentapeptide repeat family protein; pentapeptide repeat protein, fluroquinolone resistance, DNA gyrase, DNA mimicry; 2.0A {Mycobacterium tuberculosis} SCOP: b.80.8.1 PDB: 2bm4_A 2bm6_A 2bm7_A | Back alignment and structure |
|---|
| >2w7z_A EFSQNR, pentapeptide repeat family protein; glutaraldehyde, gyrase inhibitor, cyclic pentylation, chemic modification; HET: LP6; 1.60A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >2xt2_A ALBG, MCBG-like protein; cell cycle, right handed quadrilateral beta helix; 2.00A {Xanthomonas albilineans} PDB: 2xt4_A | Back alignment and structure |
|---|
| >2qyu_A Secreted effector protein; ubiquitin E3 ligase, ligase; HET: B3P; 2.10A {Salmonella typhimurium} PDB: 3sy2_A 2qza_A | Back alignment and structure |
|---|
| >2qyu_A Secreted effector protein; ubiquitin E3 ligase, ligase; HET: B3P; 2.10A {Salmonella typhimurium} PDB: 3sy2_A 2qza_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 198 | ||||
| d2j8ka1 | 175 | b.80.8.1 (A:1-175) NP275-NP276 {Nostoc punctiforme | 3e-05 | |
| d2j8ka1 | 175 | b.80.8.1 (A:1-175) NP275-NP276 {Nostoc punctiforme | 1e-04 | |
| d2j8ka1 | 175 | b.80.8.1 (A:1-175) NP275-NP276 {Nostoc punctiforme | 4e-04 | |
| d2j8ka1 | 175 | b.80.8.1 (A:1-175) NP275-NP276 {Nostoc punctiforme | 9e-04 | |
| d2bm5a1 | 181 | b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (M | 0.001 | |
| d2bm5a1 | 181 | b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (M | 0.002 | |
| d2f3la1 | 132 | b.80.8.1 (A:7-138) Lumenal RFR-domain protein {Cya | 0.003 |
| >d2j8ka1 b.80.8.1 (A:1-175) NP275-NP276 {Nostoc punctiforme [TaxId: 272131]} Length = 175 | Back information, alignment and structure |
|---|
class: All beta proteins fold: Single-stranded right-handed beta-helix superfamily: Pentapeptide repeat-like family: Pentapeptide repeats domain: NP275-NP276 species: Nostoc punctiforme [TaxId: 272131]
Score = 40.6 bits (94), Expect = 3e-05
Identities = 13/49 (26%), Positives = 22/49 (44%)
Query: 109 SAAQFGSADLRKAVHVKENFRRANFTSADMRESDFSGSKFNGAYLEKAV 157
S A +ADL A + +AN A + ++ +G+ A LE +
Sbjct: 123 SEANLEAADLSGADLAIADLHQANLHQAALERANLTGANLEDANLEGTI 171
|
| >d2j8ka1 b.80.8.1 (A:1-175) NP275-NP276 {Nostoc punctiforme [TaxId: 272131]} Length = 175 | Back information, alignment and structure |
|---|
| >d2j8ka1 b.80.8.1 (A:1-175) NP275-NP276 {Nostoc punctiforme [TaxId: 272131]} Length = 175 | Back information, alignment and structure |
|---|
| >d2j8ka1 b.80.8.1 (A:1-175) NP275-NP276 {Nostoc punctiforme [TaxId: 272131]} Length = 175 | Back information, alignment and structure |
|---|
| >d2bm5a1 b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (MT3469) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 181 | Back information, alignment and structure |
|---|
| >d2bm5a1 b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (MT3469) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 181 | Back information, alignment and structure |
|---|
| >d2f3la1 b.80.8.1 (A:7-138) Lumenal RFR-domain protein {Cyanothece sp. atcc 51142 [TaxId: 43989]} Length = 132 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 198 | |||
| d2f3la1 | 132 | Lumenal RFR-domain protein {Cyanothece sp. atcc 51 | 99.49 | |
| d2f3la1 | 132 | Lumenal RFR-domain protein {Cyanothece sp. atcc 51 | 99.47 | |
| d2j8ka1 | 175 | NP275-NP276 {Nostoc punctiforme [TaxId: 272131]} | 99.3 | |
| d2j8ka1 | 175 | NP275-NP276 {Nostoc punctiforme [TaxId: 272131]} | 99.29 |
| >d2f3la1 b.80.8.1 (A:7-138) Lumenal RFR-domain protein {Cyanothece sp. atcc 51142 [TaxId: 43989]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: Single-stranded right-handed beta-helix superfamily: Pentapeptide repeat-like family: Pentapeptide repeats domain: Lumenal RFR-domain protein species: Cyanothece sp. atcc 51142 [TaxId: 43989]
Probab=99.49 E-value=9.5e-15 Score=110.50 Aligned_cols=54 Identities=24% Similarity=0.341 Sum_probs=20.4
Q ss_pred ceecccccccccccccccccceecccccccccccCCcccCceecCccccCceec
Q 029172 111 AQFGSADLRKAVHVKENFRRANFTSADMRESDFSGSKFNGAYLEKAVAYKANFT 164 (198)
Q Consensus 111 a~f~~adL~~a~Fs~anL~~AnFs~AdLr~a~F~gAdL~gA~f~~A~L~~A~f~ 164 (198)
++|.+++|++++|.+++|++++|.+++|++++|.+++|++++|.++++.+++|+
T Consensus 21 a~f~~~~L~~~~f~~a~l~ga~f~~~~l~~~~~~~a~l~~a~~~~~~~~~~~~~ 74 (132)
T d2f3la1 21 AQFTNADLTDSNFSEADLRGAVFNGSALIGADLHGADLTNGLAYLTSFKGADLT 74 (132)
T ss_dssp CEEESCBCTTCBCTTCBCTTCEEESCBCTTCBCTTCBCTTCEEEEEECTTCBCT
T ss_pred CcccCCCCccccccccccceeeecccccccccccccccccccccccccchhhhc
Confidence 333333333333333333333333333333333333333333333333333333
|
| >d2f3la1 b.80.8.1 (A:7-138) Lumenal RFR-domain protein {Cyanothece sp. atcc 51142 [TaxId: 43989]} | Back information, alignment and structure |
|---|
| >d2j8ka1 b.80.8.1 (A:1-175) NP275-NP276 {Nostoc punctiforme [TaxId: 272131]} | Back information, alignment and structure |
|---|
| >d2j8ka1 b.80.8.1 (A:1-175) NP275-NP276 {Nostoc punctiforme [TaxId: 272131]} | Back information, alignment and structure |
|---|