Citrus Sinensis ID: 029297


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-----
MADGYWNRQQASLLPSGGMLKRPRSDYDLPPSEVLSRHDMHNYLSQDDDLGELQPLKDTSTIGSAYDRYLQSAQYSSFTSGEASAFSGDRLRRAVPGGVTRLPVSDPSVTGRHGATGPDLVQNLRSSSIDDQLPFDAAARPGHETLPLPPDASSTLYVEGLPADSTKREVAHIFRPFVGYKEVRLVIKESKLLNL
cccHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccccHHHHHHHHHcccccccEEEEEEcccccccc
cccHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHcccccccccccccccccccccccccccccccccccHHHcccccccccccccccccccccccccccccccccccccccccccccEEEEccccccccHHHHHHHHccccccEEEEEEccccccccc
madgywnrqqasllpsggmlkrprsdydlppsevlsrhdmhnylsqdddlgelqplkdtstigsAYDRYLQsaqyssftsgeasafsgdrlrravpggvtrlpvsdpsvtgrhgatgpdlvqnlrsssiddqlpfdaaarpghetlplppdasstlyveglpadstkrevahifrpfvgyKEVRLVIKESKLLNL
madgywnrqqasllpsggmlkrpRSDYDLPPSEVLSRHDMHNYLSQDDDLGELQPLKDTSTIGSAYDRYLQSAQYSSftsgeasafsgdRLRRAVPggvtrlpvsdpsvtgrhgatgpdLVQNLRSSSIDDQLPFDAAARPGHETLPLPPDASSTLYVEGLPADSTKREVAHifrpfvgykevrlvikeskllnl
MADGYWNRQQASLLPSGGMLKRPRSDYDLPPSEVLSRHDMHNYLSQDDDLGELQPLKDTSTIGSAYDRYLQSAQYSSFTSGEASAFSGDRLRRAVPGGVTRLPVSDPSVTGRHGATGPDLVQNLRSSSIDDQLPFDAAARPGHETLPLPPDASSTLYVEGLPADSTKREVAHIFRPFVGYKEVRLVIKESKLLNL
************************************************************************************************************************************************************YVE******TKREVAHIFRPFVGYKEVRLVIK*******
*ADGYWN********************************************************SAYDRYL************************************************************************************TLYVEGLPADSTKREVAHIFRPFVGYKEVRLV*********
********QQASLLPSGGMLKRPRSDYDLPPSEVLSRHDMHNYLSQDDDLGELQPLKDTSTIGSAYDRYLQSAQYSSFTSGEASAFSGDRLRRAVPGGVTRLPVSDPSVTGRHGATGPDLVQNLRSSSIDDQLPFDAAARPGHETLPLPPDASSTLYVEGLPADSTKREVAHIFRPFVGYKEVRLVIKESKLLNL
************L*PSGGMLKRPRSDYDLPPSEVLSRHDMHNYLSQDDDLGELQPLKDTSTIGSAYDRYLQSAQYSSFTSGEASAFSGDRLRRAVPGGVTRLPVSDPSVTGRHGATGPDLVQNLRSSSIDDQLPFDAAARPGHETLPLPPDASSTLYVEGLPADSTKREVAHIFRPFVGYKEVRLVIK*******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MADGYWNRQQASLLPSGGMLKRPRSDYDLPPSEVLSRHDMHNYLSQDDDLGELQPLKDTSTIGSAYDRYLQSAQYSSFTSGEASAFSGDRLRRAVPGGVTRLPVSDPSVTGRHGATGPDLVQNLRSSSIDDQLPFDAAARPGHETLPLPPDASSTLYVEGLPADSTKREVAHIFRPFVGYKEVRLVIKESKLLNL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query195
356576041252 PREDICTED: uncharacterized protein LOC10 0.969 0.75 0.614 9e-56
388500704252 unknown [Medicago truncatula] 0.943 0.730 0.596 2e-54
357443729252 RNA-binding protein with multiple splici 0.943 0.730 0.596 4e-54
449462154257 PREDICTED: uncharacterized protein LOC10 0.953 0.723 0.595 3e-53
388513795239 unknown [Lotus japonicus] 0.907 0.740 0.612 4e-53
255645608242 unknown [Glycine max] 0.923 0.743 0.633 6e-53
449506960257 PREDICTED: uncharacterized LOC101222348 0.953 0.723 0.59 8e-53
356576043244 PREDICTED: uncharacterized protein LOC10 0.928 0.741 0.598 2e-52
356535808251 PREDICTED: uncharacterized protein LOC10 0.964 0.749 0.625 4e-51
255637493251 unknown [Glycine max] 0.964 0.749 0.614 1e-49
>gi|356576041|ref|XP_003556143.1| PREDICTED: uncharacterized protein LOC100812551 isoform 1 [Glycine max] Back     alignment and taxonomy information
 Score =  221 bits (564), Expect = 9e-56,   Method: Compositional matrix adjust.
 Identities = 118/192 (61%), Positives = 143/192 (74%), Gaps = 3/192 (1%)

Query: 1   MADGYWNRQQASLLPSGGMLKRPRSDYDLPPSEVLSR-HDMHNYLSQDDDLGELQPLKDT 59
           M DG WNRQQ   LPS  MLKRPR++YD+ PS + S  ++MHNY+ ++DD    + LKDT
Sbjct: 1   MTDGSWNRQQQPFLPSSAMLKRPRTEYDISPSGLTSGGNEMHNYIGRNDDHTGHRILKDT 60

Query: 60  STIGSAYDRYLQSAQYSSFTSGEASAFSGDRLRRAVPGGVTRLPVSDPSVTGRHGATGPD 119
            T+GSA+DRYLQSA  +SF SGEASA     L R V GG+ R  ++DP+V G H   G D
Sbjct: 61  KTLGSAFDRYLQSAGLTSFNSGEASAIGSVGLERGV-GGLPRHSLTDPAVMG-HPGGGHD 118

Query: 120 LVQNLRSSSIDDQLPFDAAARPGHETLPLPPDASSTLYVEGLPADSTKREVAHIFRPFVG 179
           L +  R+ +  DQLP DAA+ PG ET+PLPPDASSTLYVEGLP+DST+REVAHIFRPFVG
Sbjct: 119 LARGGRNVNYGDQLPVDAASMPGPETVPLPPDASSTLYVEGLPSDSTRREVAHIFRPFVG 178

Query: 180 YKEVRLVIKESK 191
           Y+EVRLV KESK
Sbjct: 179 YREVRLVSKESK 190




Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|388500704|gb|AFK38418.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|357443729|ref|XP_003592142.1| RNA-binding protein with multiple splicing [Medicago truncatula] gi|355481190|gb|AES62393.1| RNA-binding protein with multiple splicing [Medicago truncatula] Back     alignment and taxonomy information
>gi|449462154|ref|XP_004148806.1| PREDICTED: uncharacterized protein LOC101222348 isoform 1 [Cucumis sativus] gi|449462156|ref|XP_004148807.1| PREDICTED: uncharacterized protein LOC101222348 isoform 2 [Cucumis sativus] Back     alignment and taxonomy information
>gi|388513795|gb|AFK44959.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|255645608|gb|ACU23298.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|449506960|ref|XP_004162895.1| PREDICTED: uncharacterized LOC101222348 isoform 1 [Cucumis sativus] gi|449506964|ref|XP_004162896.1| PREDICTED: uncharacterized LOC101222348 isoform 2 [Cucumis sativus] Back     alignment and taxonomy information
>gi|356576043|ref|XP_003556144.1| PREDICTED: uncharacterized protein LOC100812551 isoform 2 [Glycine max] Back     alignment and taxonomy information
>gi|356535808|ref|XP_003536435.1| PREDICTED: uncharacterized protein LOC100816230 isoform 1 [Glycine max] Back     alignment and taxonomy information
>gi|255637493|gb|ACU19073.1| unknown [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query195
TAIR|locus:2014937421 AT1G21320 [Arabidopsis thalian 0.764 0.353 0.506 6e-32
TAIR|locus:2025232233 AT1G76940 [Arabidopsis thalian 0.635 0.532 0.474 1.7e-20
TAIR|locus:2014937 AT1G21320 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 350 (128.3 bits), Expect = 6.0e-32, P = 6.0e-32
 Identities = 78/154 (50%), Positives = 98/154 (63%)

Query:    39 DMHNYLSQDDDLGELQPLKDTSTIGSAYDRYLQSAQYSSFTSGEASAFSGDRLRRAVPGG 98
             DMH+YLSQD+D G    +KDT +IGSAYDRYLQS Q     S EA  F+G  + R   GG
Sbjct:   211 DMHSYLSQDEDRGIPHSVKDTRSIGSAYDRYLQSMQTFFVPSEEAGPFNGVGMVRQ--GG 268

Query:    99 VTRLPVSDPSVTGRHGATGPDLVQNLRSSSIDDQL-PFDAAARPGHETLPLPPDASSTLY 157
                +P   PS+       G  L  + R +  D      D+  RPG E  PLPPD S+TLY
Sbjct:   269 SNMMP--GPSMGELMAGCGGSLPSDFRPNGRDMGFGQLDSVGRPGREPHPLPPDVSNTLY 326

Query:   158 VEGLPADSTKREVAHIFRPFVGYKEVRLVIKESK 191
             VEGLP++ ++REV+HIFRPFVGY+EVRLV ++SK
Sbjct:   327 VEGLPSNCSRREVSHIFRPFVGYREVRLVTQDSK 360




GO:0000166 "nucleotide binding" evidence=IEA
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2025232 AT1G76940 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
gw1.II.3487.1
hypothetical protein (243 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query195
cd1242079 cd12420, RRM_RBPMS_like, RNA recognition motif in 1e-14
cd1224772 cd12247, RRM2_U1A_like, RNA recognition motif 2 in 1e-05
cd0059072 cd00590, RRM_SF, RNA recognition motif (RRM) super 0.002
smart0036073 smart00360, RRM, RNA recognition motif 0.004
cd1268376 cd12683, RRM_RBPMS2, RNA recognition motif in vert 0.004
>gnl|CDD|240866 cd12420, RRM_RBPMS_like, RNA recognition motif in RNA-binding protein with multiple splicing (RBP-MS)-like proteins Back     alignment and domain information
 Score = 65.8 bits (161), Expect = 1e-14
 Identities = 23/38 (60%), Positives = 29/38 (76%)

Query: 154 STLYVEGLPADSTKREVAHIFRPFVGYKEVRLVIKESK 191
            TL+V GLP+D  +RE+AH+FRPF GY+  RLV KE K
Sbjct: 1   RTLFVSGLPSDVKERELAHLFRPFPGYEASRLVFKEKK 38


This subfamily corresponds to the RRM of RNA-binding proteins with multiple splicing (RBP-MS)-like proteins, including protein products of RBPMS genes (RBP-MS and its paralogue RBP-MS2), the Drosophila couch potato (cpo), and Caenorhabditis elegans Mec-8 genes. RBP-MS may be involved in regulation of mRNA translation and localization during Xenopus laevis development. It has also been shown to physically interact with Smad2, Smad3 and Smad4, and stimulates Smad-mediated transactivation. Cpo may play an important role in regulating normal function of the nervous system, whereas mutations in Mec-8 affect mechanosensory and chemosensory neuronal function. All members contain a well conserved RNA recognition motif (RRM), also termed RBD (RNA binding domain) or RNP (ribonucleoprotein domain). Some uncharacterized family members contain two RRMs; this subfamily includes their RRM1. Their RRM2 shows high sequence homology to the RRM of yeast proteins scw1, Whi3, and Whi4. Length = 79

>gnl|CDD|240693 cd12247, RRM2_U1A_like, RNA recognition motif 2 in the U1A/U2B"/SNF protein family Back     alignment and domain information
>gnl|CDD|240668 cd00590, RRM_SF, RNA recognition motif (RRM) superfamily Back     alignment and domain information
>gnl|CDD|214636 smart00360, RRM, RNA recognition motif Back     alignment and domain information
>gnl|CDD|241127 cd12683, RRM_RBPMS2, RNA recognition motif in vertebrate RNA-binding protein with multiple splicing 2 (RBP-MS2) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 195
KOG4206221 consensus Spliceosomal protein snRNP-U1A/U2B [RNA 98.78
KOG0114124 consensus Predicted RNA-binding protein (RRM super 97.94
PF0007670 RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or 97.56
KOG1457284 consensus RNA binding protein (contains RRM repeat 97.42
TIGR01661352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 97.16
PLN03134144 glycine-rich RNA-binding protein 4; Provisional 96.99
TIGR01649481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 96.93
smart0036272 RRM_2 RNA recognition motif. 96.9
KOG1457 284 consensus RNA binding protein (contains RRM repeat 96.86
COG0724 306 RNA-binding proteins (RRM domain) [General functio 96.53
TIGR01659 346 sex-lethal sex-lethal family splicing factor. This 96.37
PF1425970 RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or 96.32
TIGR01642 509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 96.21
TIGR01659 346 sex-lethal sex-lethal family splicing factor. This 96.05
TIGR01622 457 SF-CC1 splicing factor, CC1-like family. A homolog 95.92
cd0059074 RRM RRM (RNA recognition motif), also known as RBD 95.75
TIGR01622 457 SF-CC1 splicing factor, CC1-like family. A homolog 95.72
TIGR01649 481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 95.53
TIGR01648 578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 95.43
TIGR01648 578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 94.49
TIGR01645 612 half-pint poly-U binding splicing factor, half-pin 94.37
KOG0127 678 consensus Nucleolar protein fibrillarin NOP77 (RRM 94.36
TIGR01661 352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 94.16
KOG0117 506 consensus Heterogeneous nuclear ribonucleoprotein 94.13
smart0036071 RRM RNA recognition motif. 93.92
TIGR01628 562 PABP-1234 polyadenylate binding protein, human typ 93.39
TIGR01628 562 PABP-1234 polyadenylate binding protein, human typ 92.51
TIGR01645 612 half-pint poly-U binding splicing factor, half-pin 91.71
TIGR01642 509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 91.31
KOG0113 335 consensus U1 small nuclear ribonucleoprotein (RRM 90.36
KOG0145 360 consensus RNA-binding protein ELAV/HU (RRM superfa 89.61
KOG0122270 consensus Translation initiation factor 3, subunit 88.64
KOG0116419 consensus RasGAP SH3 binding protein rasputin, con 85.27
KOG0144 510 consensus RNA-binding protein CUGBP1/BRUNO (RRM su 83.79
KOG0415 479 consensus Predicted peptidyl prolyl cis-trans isom 83.5
PF08777105 RRM_3: RNA binding motif; InterPro: IPR014886 This 81.55
KOG4660 549 consensus Protein Mei2, essential for commitment t 81.4
>KOG4206 consensus Spliceosomal protein snRNP-U1A/U2B [RNA processing and modification] Back     alignment and domain information
Probab=98.78  E-value=7.1e-09  Score=90.12  Aligned_cols=44  Identities=30%  Similarity=0.675  Sum_probs=40.5

Q ss_pred             CCCCCCCCCceEEecCCCCcccHHHHHhhccCCCCceEEEeeecCc
Q 029297          145 TLPLPPDASSTLYVEGLPADSTKREVAHIFRPFVGYKEVRLVIKES  190 (195)
Q Consensus       145 ~~~lPPd~N~ILFVQNLP~d~T~~eL~~LF~qFpGFkEVRLVp~r~  190 (195)
                      ....||  |+|||++|||++++.++|+.||.||+||||||||+.++
T Consensus       140 ~~~~pp--n~ilf~~niP~es~~e~l~~lf~qf~g~keir~i~~~~  183 (221)
T KOG4206|consen  140 AQMAPP--NNILFLTNIPSESESEMLSDLFEQFPGFKEIRLIPPRS  183 (221)
T ss_pred             ccCCCC--ceEEEEecCCcchhHHHHHHHHhhCcccceeEeccCCC
Confidence            445788  99999999999999999999999999999999999765



>KOG0114 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>PF00076 RRM_1: RNA recognition motif Back     alignment and domain information
>KOG1457 consensus RNA binding protein (contains RRM repeats) [General function prediction only] Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>PLN03134 glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>smart00362 RRM_2 RNA recognition motif Back     alignment and domain information
>KOG1457 consensus RNA binding protein (contains RRM repeats) [General function prediction only] Back     alignment and domain information
>COG0724 RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>PF14259 RRM_6: RNA recognition motif (a Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>KOG0127 consensus Nucleolar protein fibrillarin NOP77 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>KOG0117 consensus Heterogeneous nuclear ribonucleoprotein R (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>smart00360 RRM RNA recognition motif Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>KOG0113 consensus U1 small nuclear ribonucleoprotein (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0145 consensus RNA-binding protein ELAV/HU (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0122 consensus Translation initiation factor 3, subunit g (eIF-3g) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0116 consensus RasGAP SH3 binding protein rasputin, contains NTF2 and RRM domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG0144 consensus RNA-binding protein CUGBP1/BRUNO (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0415 consensus Predicted peptidyl prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF08777 RRM_3: RNA binding motif; InterPro: IPR014886 This domain is found in protein La which functions as an RNA chaperone during RNA polymerase III transcription, and can also stimulate translation initiation Back     alignment and domain information
>KOG4660 consensus Protein Mei2, essential for commitment to meiosis, and related proteins [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query195
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 3e-04
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 6e-04
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} PDB: 2f9d_A 2f9j_A 2fho_B Length = 115 Back     alignment and structure
 Score = 37.7 bits (88), Expect = 3e-04
 Identities = 12/39 (30%), Positives = 21/39 (53%)

Query: 148 LPPDASSTLYVEGLPADSTKREVAHIFRPFVGYKEVRLV 186
           LPP+ +  LY+  LP   T  E+  IF  +   +++R+ 
Sbjct: 3   LPPEVNRILYIRNLPYKITAEEMYDIFGKYGPIRQIRVG 41


>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Length = 100 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query195
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 98.32
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 98.21
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 98.21
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 98.13
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 98.08
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 98.05
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 98.0
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 98.0
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 98.0
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 97.98
2la6_A99 RNA-binding protein FUS; structural genomics, nort 97.98
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 97.96
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 97.96
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 97.95
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 97.94
1x4e_A85 RNA binding motif, single-stranded interacting pro 97.94
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 97.93
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 97.93
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 97.91
2cpj_A99 Non-POU domain-containing octamer-binding protein; 97.91
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 97.9
2cph_A107 RNA binding motif protein 19; RNA recognition moti 97.88
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 97.88
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 97.88
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 97.87
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 97.87
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 97.86
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 97.86
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 97.86
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 97.85
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 97.84
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 97.84
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 97.83
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 97.83
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 97.83
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 97.83
2lxi_A91 RNA-binding protein 10; NMR {Homo sapiens} 97.82
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 97.81
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 97.79
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 97.78
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 97.77
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 97.77
2m2b_A131 RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio 97.76
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 97.76
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 97.75
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 97.75
2krb_A81 Eukaryotic translation initiation factor 3 subunit 97.75
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 97.74
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 97.74
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 97.73
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 97.73
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 97.72
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 97.71
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 97.71
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 97.71
2div_A99 TRNA selenocysteine associated protein; structural 97.71
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 97.71
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 97.7
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 97.7
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 97.7
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 97.69
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 97.69
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 97.69
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 97.69
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 97.69
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 97.68
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 97.68
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 97.68
4fxv_A99 ELAV-like protein 1; RNA recognition motif, putati 97.67
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} 97.67
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 97.66
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 97.65
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 97.65
2cqd_A116 RNA-binding region containing protein 1; RNA recog 97.64
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 97.64
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 97.63
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 97.63
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 97.62
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 97.62
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 97.61
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 97.61
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 97.61
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 97.61
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 97.61
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 97.6
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 97.6
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 97.6
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 97.6
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 97.59
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 97.59
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 97.59
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 97.59
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 97.58
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 97.57
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 97.57
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 97.56
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 97.56
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 97.56
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 97.53
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 97.53
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 97.53
1x5o_A114 RNA binding motif, single-stranded interacting pro 97.53
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 97.52
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 97.51
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 97.51
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 97.51
2kt5_A124 RNA and export factor-binding protein 2; chaperone 97.51
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 97.49
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 97.48
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 97.48
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 97.48
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 97.47
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 97.46
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 97.46
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 97.43
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 97.43
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 97.43
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 97.42
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 97.41
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 97.4
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 97.37
2dis_A109 Unnamed protein product; structural genomics, RRM 97.37
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 97.37
3p5t_L90 Cleavage and polyadenylation specificity factor S; 97.36
2adc_A 229 Polypyrimidine tract-binding protein 1; RBD, RRM, 97.36
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 97.35
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 97.35
2dnl_A114 Cytoplasmic polyadenylation element binding protei 97.33
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 97.32
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 97.32
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 97.29
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 97.28
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 97.28
2i2y_A150 Fusion protein consists of immunoglobin G- binding 97.27
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 97.24
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 97.23
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 97.23
2f3j_A177 RNA and export factor binding protein 2; RRM domai 97.23
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 97.2
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 97.2
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 97.18
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 97.18
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 97.15
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 97.15
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 97.15
3sde_A 261 Paraspeckle component 1; RRM, anti parallel right 97.13
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 97.12
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 97.09
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 97.08
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 97.06
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 97.05
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 97.05
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 97.04
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 97.03
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 97.01
3pgw_S 437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 96.99
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 96.98
3n9u_C156 Cleavage and polyadenylation specificity factor S; 96.98
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 96.97
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 96.97
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 96.95
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 95.99
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 96.93
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 96.92
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 96.87
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 96.86
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 96.82
1x5p_A97 Negative elongation factor E; structure genomics, 96.79
2qfj_A 216 FBP-interacting repressor; protein-DNA complex; HE 96.77
3q2s_C 229 Cleavage and polyadenylation specificity factor S; 96.77
2ghp_A 292 U4/U6 snRNA-associated splicing factor PRP24; RNA 96.75
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 96.74
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 96.62
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 96.42
3smz_A 284 Protein raver-1, ribonucleoprotein PTB-binding 1; 96.42
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 96.33
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 96.31
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 96.27
2diu_A96 KIAA0430 protein; structural genomics, RRM domain, 96.19
1owx_A121 Lupus LA protein, SS-B, LA; RRM, transcription; NM 96.08
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 96.0
3sde_A 261 Paraspeckle component 1; RRM, anti parallel right 95.92
2wbr_A89 GW182, gawky, LD47780P; DNA-binding protein, RRM, 95.16
3tht_A 345 Alkylated DNA repair protein ALKB homolog 8; struc 94.98
1whv_A100 Poly(A)-specific ribonuclease; RNA recognition mot 93.32
2dit_A112 HIV TAT specific factor 1 variant; structural geno 92.6
2d9o_A100 DNAJ (HSP40) homolog, subfamily C, member 17; RRM 91.48
3ctr_A101 Poly(A)-specific ribonuclease PARN; protein-RNA-co 90.25
2pe8_A105 Splicing factor 45; RRM, protein binding; 2.00A {H 88.16
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Back     alignment and structure
Probab=98.32  E-value=4.7e-07  Score=67.77  Aligned_cols=40  Identities=18%  Similarity=0.256  Sum_probs=36.9

Q ss_pred             CCCCCCCceEEecCCCCcccHHHHHhhccCCCCceEEEeeec
Q 029297          147 PLPPDASSTLYVEGLPADSTKREVAHIFRPFVGYKEVRLVIK  188 (195)
Q Consensus       147 ~lPPd~N~ILFVQNLP~d~T~~eL~~LF~qFpGFkEVRLVp~  188 (195)
                      ..||  +++|||.|||.++|+++|..||.+|-..++|++++.
T Consensus        17 ~~~p--s~~l~V~NLp~~~te~~L~~lF~~fG~V~~v~i~~~   56 (100)
T 3r27_A           17 KTPA--SPVVHIRGLIDGVVEADLVEALQEFGPISYVVVMPK   56 (100)
T ss_dssp             CCCC--CSEEEEESCCTTCCHHHHHHHHGGGSCEEEEEEETT
T ss_pred             cCCC--CcEEEEeCCCCCCCHHHHHHHHhccCCEEEEEEEcC
Confidence            4567  999999999999999999999999999999999864



>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2lxi_A RNA-binding protein 10; NMR {Homo sapiens} Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Back     alignment and structure
>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Back     alignment and structure
>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1owx_A Lupus LA protein, SS-B, LA; RRM, transcription; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} Back     alignment and structure
>3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A* Back     alignment and structure
>1whv_A Poly(A)-specific ribonuclease; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, PARN, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2rok_A* Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ctr_A Poly(A)-specific ribonuclease PARN; protein-RNA-complex, M7G-CAP, M7GTP, RNA recognition motif, RRM, cytoplasm, exonuclease, hydrolase, magnesium; HET: MGP; 2.10A {Homo sapiens} Back     alignment and structure
>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 195
d2f9da1114 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p 5e-04
d2cqca183 d.58.7.1 (A:109-191) Arginine/serine-rich splicing 6e-04
d1x4ga196 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo s 0.001
d2cpha194 d.58.7.1 (A:454-547) Probable RNA-binding protein 0.002
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: Pre-mRNA branch site protein p14
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 36.1 bits (83), Expect = 5e-04
 Identities = 11/35 (31%), Positives = 18/35 (51%)

Query: 148 LPPDASSTLYVEGLPADSTKREVAHIFRPFVGYKE 182
           LPP+ +  LY+  LP   T  E+  IF  +   ++
Sbjct: 2   LPPEVNRILYIRNLPYKITAEEMYDIFGKYGPIRQ 36


>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query195
d2b0ga183 Splicesomal U1A protein {Drosophila melanogaster [ 98.72
d2adca288 Polypyrimidine tract-binding protein {Human (Homo 98.4
d2f9da1114 Pre-mRNA branch site protein p14 {Human (Homo sapi 98.23
d1wexa_104 Heterogeneous nuclear ribonucleoprotein L-like {Mo 98.18
d2cq1a188 Polypyrimidine tract-binding protein 2, PTBP2 {Hum 98.18
d1wi8a_104 Eukaryotic translation initiation factor 4B {Human 98.16
d1whya_97 Putative RNA-binding protein 15B, Rbm15b {Mouse (M 98.13
d2cqca183 Arginine/serine-rich splicing factor 10 {Human (Ho 98.09
d1b7fa182 Sex-lethal protein {Drosophila melanogaster [TaxId 97.98
d2cqia190 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 97.97
d1cvja289 Poly(A)-binding protein {Human (Homo sapiens) [Tax 97.95
d2cpza1102 CUG triplet repeat RNA-binding protein 1 {Human (H 97.9
d2cqba189 Peptidyl-prolyl cis-trans isomerase E, N-terminal 97.88
d1h2vz_93 CBP20, 20KDa nuclear cap-binding protein {Human (H 97.84
d2cq3a193 RNA-binding protein 9 {Human (Homo sapiens) [TaxId 97.8
d1whxa_111 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 97.77
d1x4ga196 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 97.77
d1x4ha198 RNA-binding protein 28 {Mouse (Mus musculus) [TaxI 97.77
d1b7fa285 Sex-lethal protein {Drosophila melanogaster [TaxId 97.77
d2cpha194 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 97.76
d1fxla182 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 97.76
d1wf0a_88 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 97.75
d2cpfa185 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 97.74
d1rk8a_88 RNA-binding protein 8 {Fruit fly (Drosophila melan 97.74
d1cvja180 Poly(A)-binding protein {Human (Homo sapiens) [Tax 97.72
d1fxla285 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 97.72
d1x5ua193 Splicing factor 3B subunit 4 {Human (Homo sapiens) 97.71
d2u2fa_85 Splicing factor U2AF 65 KDa subunit {Human (Homo s 97.7
d2cpda186 APOBEC1 stimulating protein {Human (Homo sapiens) 97.7
d2cq0a190 Eukaryotic translation initiation factor 3 subunit 97.68
d2adca1109 Polypyrimidine tract-binding protein {Human (Homo 97.65
d1x4aa195 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 97.64
d2cpja186 Non-POU domain-containing octamer-binding protein, 97.64
d1u6fa1139 RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId 97.63
d1zh5a285 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 97.62
d1x4ea172 RNA-binding motif, single-stranded-interacting pro 97.6
d1wi6a175 Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M 97.57
d1whwa_99 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 97.57
d2cpxa1102 RNA-binding protein 41, RBM41 {Human (Homo sapiens 97.56
d2ghpa275 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 97.56
d1wg5a_104 Heterogeneous nuclear ribonucleoprotein H' {Human 97.55
d1wg4a_98 Splicing factor, arginine/serine-rich 9 (SFRS9) {M 97.54
d1x4fa199 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 97.54
d1wg1a_88 Probable RNA-binding protein KIAA1579 {Human (Homo 97.53
d1l3ka279 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 97.52
d2cqda1103 RNA-binding region containing protein 1 {Human (Ho 97.52
d1no8a_78 Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 97.51
d1l3ka184 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 97.5
d1x5oa1101 RNA-binding motif, single-stranded-interacting pro 97.49
d1x4da189 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 97.49
d1uawa_77 Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} 97.49
d2adba1108 Polypyrimidine tract-binding protein {Human (Homo 97.48
d1hd0a_75 Heterogeneous nuclear ribonucleoprotein d0 {Human 97.48
d1p1ta_104 Cleavage stimulation factor, 64 kda subunit {Human 97.47
d2cq4a1101 RNA binding protein 23 {Human (Homo sapiens) [TaxI 97.45
d3begb187 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 97.45
d1weza_102 Heterogeneous nuclear ribonucleoprotein H' {Human 97.4
d2cqha180 IGF-II mRNA-binding protein 2 isoform A {Human (Ho 97.38
d2cqga190 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 97.38
d2cq2a1101 Alkylation repair AlkB homolog 8, ALKBH8 {Human (H 97.37
d2cpea1101 RNA-binding protein EWS {Human (Homo sapiens) [Tax 97.37
d2disa196 Hypothetical protein FLJ20273 {Human (Homo sapiens 97.32
d2ghpa181 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 97.31
d2msta_75 Neural RNA-binding protein Musashi-1 {Mouse (Mus m 97.3
d1x4ba1103 Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu 97.25
d2cqpa186 RNA-binding protein 12 {Mouse (Mus musculus) [TaxI 97.23
d1fjca_96 Nucleolin {Golden hamster (Mesocricetus auratus) [ 97.23
d1nu4a_91 Splicesomal U1A protein {Human (Homo sapiens) [Tax 97.22
d1x0fa175 Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s 97.1
d2ghpa386 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 97.09
d1x5sa190 Cold-inducible RNA-binding protein {Human (Homo sa 97.03
d1x5ta183 Splicing factor 3B subunit 4 {Human (Homo sapiens) 97.02
d1wf2a_98 Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu 96.93
d1wela1112 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 96.85
d1fjeb191 Nucleolin {Golden hamster (Mesocricetus auratus) [ 96.82
d2bz2a179 Negative elongation factor E, NELF-E {Human (Homo 96.82
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 96.81
d2cpia189 E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc 96.79
d2cpya1103 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 96.66
d1owxa_113 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 96.45
d1u2fa_90 Splicing factor U2AF 65 KDa subunit {Human (Homo s 96.23
d1weya_104 Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 96.05
d2dita199 HIV Tat-specific factor 1 {Human (Homo sapiens) [T 83.6
d1wwha181 Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090 82.86
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: Splicesomal U1A protein
species: Drosophila melanogaster [TaxId: 7227]
Probab=98.72  E-value=6e-09  Score=71.51  Aligned_cols=42  Identities=33%  Similarity=0.687  Sum_probs=38.6

Q ss_pred             CCCCCCCCceEEecCCCCcccHHHHHhhccCCCCceEEEeeecC
Q 029297          146 LPLPPDASSTLYVEGLPADSTKREVAHIFRPFVGYKEVRLVIKE  189 (195)
Q Consensus       146 ~~lPPd~N~ILFVQNLP~d~T~~eL~~LF~qFpGFkEVRLVp~r  189 (195)
                      ...||  |+||||.|||.++|+++|..+|++|...++||+++.+
T Consensus         3 ~~~pP--~~tl~V~nLp~~~t~~~l~~~f~~~G~i~~v~~~~~~   44 (83)
T d2b0ga1           3 TEQPP--NQILFLTNLPEETNEMMLSMLFNQFPGFKEVRLVPNR   44 (83)
T ss_dssp             CCCSC--CSEEEEESCCTTCCHHHHHHHHTTSTTEEEEEECTTT
T ss_pred             CCCCC--CCEEEEECCCCCCCHHHHHhhhccCccEEEeeeeccc
Confidence            45688  9999999999999999999999999999999998754



>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure