Citrus Sinensis ID: 029308

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-----
MLGQDSSPGNGSCKSATCILRWASYVRNPTCPQCKHPFEFLHVHRSLDGSISDYMFEESVCLLLRATWFKPLIVEDHVVVQDDLEDDYSYEDEEDDLDEVYFRSSSSLRIGNRRWGDNGYVRAGRQEARPVCRPNSQDVGASSSREPKKKEVAKVTTGRRAKRALKREAADKAAASKHQQHLARLGRNLEARCSQ
ccccccccccccccHHHHHHHHHHcccccccccccccccEEEEEEcccccccccccccHHHHHHHccccccEEEccccccccccccccccccccccHHHHHHcccccEEEcccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHcc
cccccccccccccccEEEEEEEEEccccccccccccccHHEHEEccccccHccccHHHHHHHHHHHHHccccccHcccccHHHHHHHccccccccccHHHHccccccEEEcccccccccEEEccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHcccc
mlgqdsspgngscksatcILRWasyvrnptcpqckhpfeflhvhrsldgsisdyMFEESVCLLLRAtwfkplivEDHVVvqddleddysyedeeddldevyfrsssslrignrrwgdngyvragrqearpvcrpnsqdvgasssrepkkkeVAKVTTGRRAKRALKREAADKAAASKHQQHLARLGRNLEARCSQ
mlgqdsspgngscKSATCILRWASYVRNPTCPQCKHPFEFLHVHRSLDGSISDYMFEESVCLLLRATWFKPLIVEDHVVVQDDLEDDYSyedeeddldevyfrsssslrignrrwgdnGYVRAgrqearpvcrpnsqdvgasssrepkkkevakvttgrrakRALKREAADKAAASKHQQHLARLGRNLEARCSQ
MLGQDSSPGNGSCKSATCILRWASYVRNPTCPQCKHPFEFLHVHRSLDGSISDYMFEESVCLLLRATWFKPLIVEDHVVVQddleddysyedeeddldeVYFRSSSSLRIGNRRWGDNGYVRAGRQEARPVCRPNSQDVGASSSREPKKKEVAKVTTGrrakralkreaadkaaaskHQQHLARLGRNLEARCSQ
**************SATCILRWASYVRNPTCPQCKHPFEFLHVHRSLDGSISDYMFEESVCLLLRATWFKPLIVEDHVVVQDDLEDDYSY******LDEVYFR****LRIGNRRWGDNGYV**************************************************************************
*********NGSCKSATCILRWASYVRNPTCPQCKHPFEFLHVHRSLDGSISDYMFEESVCLLLRATWFKPLIVEDHVVVQDDLEDDYSYEDEEDDLDEVYFRSSSSLRIGNRRWGDNGYVRAG********************************************************HLARLGRNL******
************CKSATCILRWASYVRNPTCPQCKHPFEFLHVHRSLDGSISDYMFEESVCLLLRATWFKPLIVEDHVVVQDDLEDDYSYEDEEDDLDEVYFRSSSSLRIGNRRWGDNGYVRAGR*********************************************************ARLGRNLEARCSQ
*********NGSCKSATCILRWASYVRNPTCPQCKHPFEFLHVHRSLDGSISDYMFEESVCLLLRATWFKPLIVEDHVVVQDDLEDDYSYEDEEDDLDEVYFRSSSSLRIGNRRWGDNGYVRAGRQE********************************************K*************GRNL******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLGQDSSPGNGSCKSATCILRWASYVRNPTCPQCKHPFEFLHVHRSLDGSISDYMFEESVCLLLRATWFKPLIVEDHVVVQDDLEDDYSYEDEEDDLDEVYFRSSSSLRIGNRRWGDNGYVRAGRQEARPVCRPNSQDVGASSSREPKKKEVAKVTTGRRAKRALKREAADKAAASKHQQHLARLGRNLEARCSQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query195
224059734240 predicted protein [Populus trichocarpa] 0.882 0.716 0.744 9e-67
224103949221 predicted protein [Populus trichocarpa] 0.882 0.778 0.752 4e-59
225436634241 PREDICTED: uncharacterized protein LOC10 0.887 0.717 0.707 3e-58
388503364244 unknown [Medicago truncatula] 0.882 0.704 0.719 6e-58
255580137253 protein binding protein, putative [Ricin 0.882 0.679 0.715 9e-58
363807078251 uncharacterized protein LOC100777135 [Gl 0.887 0.689 0.744 5e-57
449444873244 PREDICTED: uncharacterized protein LOC10 0.876 0.700 0.710 7e-56
449444871276 PREDICTED: uncharacterized protein LOC10 0.876 0.619 0.710 9e-56
356577416247 PREDICTED: uncharacterized protein LOC10 0.882 0.696 0.738 1e-54
255646911247 unknown [Glycine max] 0.882 0.696 0.738 1e-54
>gi|224059734|ref|XP_002299981.1| predicted protein [Populus trichocarpa] gi|222847239|gb|EEE84786.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  258 bits (659), Expect = 9e-67,   Method: Compositional matrix adjust.
 Identities = 131/176 (74%), Positives = 146/176 (82%), Gaps = 4/176 (2%)

Query: 16  ATCILRWASYVRNPTCPQCKHPFEFLHVHRSLDGSISDYMFEESVCLLLRATWFKPLIVE 75
            TCILRW++Y +NPTCPQCKHPFEFL++HRSLDGSI DYMFEESVCLLLRA+WF  L VE
Sbjct: 64  VTCILRWSTYTKNPTCPQCKHPFEFLNIHRSLDGSIQDYMFEESVCLLLRASWFMTLTVE 123

Query: 76  DHVVVQDDLEDDYSYEDEEDDLDE----VYFRSSSSLRIGNRRWGDNGYVRAGRQEARPV 131
           DH  V +D ED Y YE E++D D+    VY  SSS+LRIGNRRWGDNGYVRAG QEARPV
Sbjct: 124 DHEDVYEDPEDYYPYEFEDEDDDDDLDEVYLSSSSNLRIGNRRWGDNGYVRAGHQEARPV 183

Query: 132 CRPNSQDVGASSSREPKKKEVAKVTTGRRAKRALKREAADKAAASKHQQHLARLGR 187
            + + +D GA +SREPKKKE AK  TGRRAKR LKREAADKAAASKHQQHLARLGR
Sbjct: 184 YQADFKDSGACTSREPKKKEAAKDRTGRRAKRTLKREAADKAAASKHQQHLARLGR 239

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224103949|ref|XP_002313256.1| predicted protein [Populus trichocarpa] gi|222849664|gb|EEE87211.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225436634|ref|XP_002280104.1| PREDICTED: uncharacterized protein LOC100260248 [Vitis vinifera] gi|296083851|emb|CBI24239.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|388503364|gb|AFK39748.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|255580137|ref|XP_002530900.1| protein binding protein, putative [Ricinus communis] gi|223529522|gb|EEF31476.1| protein binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|363807078|ref|NP_001242587.1| uncharacterized protein LOC100777135 [Glycine max] gi|255646984|gb|ACU23961.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|449444873|ref|XP_004140198.1| PREDICTED: uncharacterized protein LOC101206609 isoform 2 [Cucumis sativus] gi|449482546|ref|XP_004156316.1| PREDICTED: uncharacterized LOC101206609 isoform 2 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449444871|ref|XP_004140197.1| PREDICTED: uncharacterized protein LOC101206609 isoform 1 [Cucumis sativus] gi|449482544|ref|XP_004156315.1| PREDICTED: uncharacterized LOC101206609 isoform 1 [Cucumis sativus] Back     alignment and taxonomy information
>gi|356577416|ref|XP_003556822.1| PREDICTED: uncharacterized protein LOC100785472 [Glycine max] Back     alignment and taxonomy information
>gi|255646911|gb|ACU23925.1| unknown [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query195
TAIR|locus:2150310255 AT5G19430 [Arabidopsis thalian 0.876 0.670 0.483 4.9e-37
TAIR|locus:505006599254 AT5G12310 [Arabidopsis thalian 0.938 0.720 0.455 7.2e-36
TAIR|locus:2150310 AT5G19430 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 398 (145.2 bits), Expect = 4.9e-37, P = 4.9e-37
 Identities = 89/184 (48%), Positives = 104/184 (56%)

Query:    17 TCILRWASYVRNPTCPQCKHPFEFLHVHRSLDGSISDYMFEESVCLLLRATWFKPL-IVE 75
             TCILRWAS   +PTCPQCKHPF+FL VHR+LDGSI D++FEESVCLLLRA+WF PL +VE
Sbjct:    71 TCILRWASCKESPTCPQCKHPFDFLSVHRALDGSIEDFLFEESVCLLLRASWFVPLDVVE 130

Query:    76 DHVVVQXXXXXXXXXXXXXXXXXXV--YFRSSSSLRIGNRRWGDNGYVRAGRQEARPVCR 133
                                     +  ++   SSLRIGNRRWG NG+VR+GRQEARPV R
Sbjct:   131 QASYSHGYHDDFDIPYDYEDEDDDLDEFYLHGSSLRIGNRRWGGNGFVRSGRQEARPVQR 190

Query:   134 -----PNSQDVGASSSREPKKKEVAKV-TTGXXXXXX----XXXXXXXXXXXXXHQQHLA 183
                   +S     SSS EPK K+V    TTG                       H+ HL 
Sbjct:   191 YSGSGSSSSSSSGSSSSEPKDKQVKTTNTTGRRAKRAMKREAANKAAEVTAAAKHEAHLV 250

Query:   184 RLGR 187
             RLGR
Sbjct:   251 RLGR 254
GO:0005634 "nucleus" evidence=ISM
GO:0008270 "zinc ion binding" evidence=IEA;ISS
GO:0048573 "photoperiodism, flowering" evidence=RCA
TAIR|locus:505006599 AT5G12310 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
grail3.0053015801
hypothetical protein (240 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 195
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 99.15
smart0050463 Ubox Modified RING finger domain. Modified RING fi 98.95
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 98.74
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 98.68
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 98.66
KOG2177 386 consensus Predicted E3 ubiquitin ligase [Posttrans 98.63
PLN03208193 E3 ubiquitin-protein ligase RMA2; Provisional 98.62
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 98.56
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 98.54
cd0016245 RING RING-finger (Really Interesting New Gene) dom 98.46
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 98.43
KOG0287 442 consensus Postreplication repair protein RAD18 [Re 98.4
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 98.4
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 98.37
PF1463444 zf-RING_5: zinc-RING finger domain 98.33
KOG0823230 consensus Predicted E3 ubiquitin ligase [Posttrans 98.15
COG5432 391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 98.09
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 98.0
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 97.96
TIGR00570309 cdk7 CDK-activating kinase assembly factor MAT1. A 97.92
KOG2164 513 consensus Predicted E3 ubiquitin ligase [Posttrans 97.74
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 97.6
KOG1039344 consensus Predicted E3 ubiquitin ligase [Posttrans 97.44
KOG0824 324 consensus Predicted E3 ubiquitin ligase [Posttrans 97.44
KOG0825 1134 consensus PHD Zn-finger protein [General function 97.41
KOG4159 398 consensus Predicted E3 ubiquitin ligase [Posttrans 97.19
KOG0802543 consensus E3 ubiquitin ligase [Posttranslational m 97.07
KOG0827 465 consensus Predicted E3 ubiquitin ligase [Posttrans 96.89
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 96.87
COG5243491 HRD1 HRD ubiquitin ligase complex, ER membrane com 96.76
KOG2660 331 consensus Locus-specific chromosome binding protei 96.62
KOG4739233 consensus Uncharacterized protein involved in syna 96.46
KOG1734328 consensus Predicted RING-containing E3 ubiquitin l 96.26
KOG0311 381 consensus Predicted E3 ubiquitin ligase [Posttrans 96.19
COG519488 APC11 Component of SCF ubiquitin ligase and anapha 95.92
KOG0297 391 consensus TNF receptor-associated factor [Signal t 95.67
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 95.55
KOG2930114 consensus SCF ubiquitin ligase, Rbx1 component [Po 95.42
PF1444755 Prok-RING_4: Prokaryotic RING finger family 4 95.28
KOG149384 consensus Anaphase-promoting complex (APC), subuni 95.25
KOG1785563 consensus Tyrosine kinase negative regulator CBL [ 95.06
smart0074449 RINGv The RING-variant domain is a C4HC3 zinc-fing 94.42
PF04641260 Rtf2: Rtf2 RING-finger 94.33
KOG1002791 consensus Nucleotide excision repair protein RAD16 94.25
KOG1813313 consensus Predicted E3 ubiquitin ligase [Posttrans 93.77
KOG1001674 consensus Helicase-like transcription factor HLTF/ 93.73
KOG0804 493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 93.69
KOG1645 463 consensus RING-finger-containing E3 ubiquitin liga 92.85
PHA03096284 p28-like protein; Provisional 92.81
KOG4185296 consensus Predicted E3 ubiquitin ligase [Posttrans 91.93
PF1457048 zf-RING_4: RING/Ubox like zinc-binding domain; PDB 91.9
KOG417262 consensus Predicted E3 ubiquitin ligase [Posttrans 91.78
COG5222427 Uncharacterized conserved protein, contains RING Z 91.71
KOG2932389 consensus E3 ubiquitin ligase involved in ubiquiti 90.94
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 89.94
PHA02825162 LAP/PHD finger-like protein; Provisional 89.53
KOG1812384 consensus Predicted E3 ubiquitin ligase [Posttrans 89.42
KOG1814445 consensus Predicted E3 ubiquitin ligase [Posttrans 88.43
PHA02862156 5L protein; Provisional 88.31
KOG1941518 consensus Acetylcholine receptor-associated protei 87.64
KOG3161 861 consensus Predicted E3 ubiquitin ligase [Posttrans 87.5
PF05290140 Baculo_IE-1: Baculovirus immediate-early protein ( 85.34
KOG3039303 consensus Uncharacterized conserved protein [Funct 83.51
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information 
Probab=99.15  E-value=1.5e-11  Score=80.87  Aligned_cols=34  Identities=21%  Similarity=0.406  Sum_probs=25.2

Q ss_pred             CCCCCCcCCCCCcccHHhHHhhhccCCC--CCCCCC
Q 029308            1 MLGQDSSPGNGSCKSATCILRWASYVRN--PTCPQC   34 (195)
Q Consensus         1 ~~~QpVtl~CGHsFC~~CI~rW~e~kq~--~sCP~C   34 (195)
                      +|.+||+++|||+||..||.+||+....  ..||+|
T Consensus         7 ~~~~Pv~l~CGH~FC~~Cl~~~~~~~~~~~~~CP~C   42 (42)
T PF15227_consen    7 LFKDPVSLPCGHSFCRSCLERLWKEPSGSGFSCPEC   42 (42)
T ss_dssp             B-SSEEE-SSSSEEEHHHHHHHHCCSSSST---SSS
T ss_pred             hhCCccccCCcCHHHHHHHHHHHHccCCcCCCCcCC
Confidence            4789999999999999999998875444  479998

>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 Back     alignment and domain information
>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] Back     alignment and domain information
>KOG4739 consensus Uncharacterized protein involved in synaptonemal complex formation [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] Back     alignment and domain information
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information
>KOG2930 consensus SCF ubiquitin ligase, Rbx1 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14447 Prok-RING_4: Prokaryotic RING finger family 4 Back     alignment and domain information
>KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] Back     alignment and domain information
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA03096 p28-like protein; Provisional Back     alignment and domain information
>KOG4185 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B Back     alignment and domain information
>KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG2932 consensus E3 ubiquitin ligase involved in ubiquitination of E-cadherin complex [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>PHA02825 LAP/PHD finger-like protein; Provisional Back     alignment and domain information
>KOG1812 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02862 5L protein; Provisional Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG3161 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0 Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query195
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 7e-05
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Length = 68 Back     alignment and structure
 Score = 38.5 bits (90), Expect = 7e-05
 Identities = 15/39 (38%), Positives = 18/39 (46%), Gaps = 2/39 (5%)

Query: 17 TCILRWASYVRNPTCPQCKHPFEFLHVHRSLDGSISDYM 55
           CI RW    +NPTCP CK P E +      D    D +
Sbjct: 31 VCITRWIR--QNPTCPLCKVPVESVVHTIESDSEFGDQL 67

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query195
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 99.39
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 99.38
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 99.33
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 99.31
2ecw_A85 Tripartite motif-containing protein 30; metal bind 99.28
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 99.28
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.27
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 99.27
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 99.26
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 99.24
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 99.2
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 99.19
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 99.19
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 99.18
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 99.15
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 99.15
1z6u_A150 NP95-like ring finger protein isoform B; structura 99.14
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 99.13
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 99.11
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 99.09
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 99.09
2f42_A179 STIP1 homology and U-box containing protein 1; cha 99.08
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 99.06
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 99.06
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 99.05
2ysl_A73 Tripartite motif-containing protein 31; ring-type 99.02
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 99.02
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 98.99
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 98.99
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 98.96
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 98.95
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 98.93
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 98.93
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 98.93
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 98.92
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 98.92
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 98.91
2ysj_A63 Tripartite motif-containing protein 31; ring-type 98.89
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 98.86
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 98.86
2ecm_A55 Ring finger and CHY zinc finger domain- containing 98.86
2ect_A78 Ring finger protein 126; metal binding protein, st 98.85
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 98.82
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 98.82
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 98.79
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.79
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 98.78
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 98.77
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 98.77
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 98.77
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 98.74
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 98.69
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 98.66
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 98.66
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.63
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 98.51
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 98.47
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 98.46
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 98.4
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 98.32
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 98.28
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 98.21
2ea5_A68 Cell growth regulator with ring finger domain prot 98.09
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 98.07
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 98.03
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 97.88
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 97.62
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 97.19
2jun_A101 Midline-1; B-BOX, TRIM, ring finger, alternative s 92.82
2jmo_A80 Parkin; IBR, E3 ligase, zinc binding domain, RBR; 85.32
2ko5_A99 Ring finger protein Z; lassa fever virus-Z, negati 85.18
3i2d_A371 E3 SUMO-protein ligase SIZ1; signal transduction, 83.11
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
Probab=99.39  E-value=7.6e-14  Score=99.02  Aligned_cols=58  Identities=17%  Similarity=0.256  Sum_probs=48.4

Q ss_pred             CCCCCcCC-CCCcccHHhHHhhhccCCCCCCCCCCCCCC---cCccccccccchhhhhhhhh
Q 029308            2 LGQDSSPG-NGSCKSATCILRWASYVRNPTCPQCKHPFE---FLHVHRSLDGSISDYMFEES   59 (195)
Q Consensus         2 ~~QpVtl~-CGHsFC~~CI~rW~e~kq~~sCP~CK~pFs---~l~vNr~LdG~vedy~~EeS   59 (195)
                      +..||+++ |||+||..||.+|+.......||+|++++.   .+.+|..|.+.++.+..+++
T Consensus        23 ~~~p~~~~~CgH~fC~~Ci~~~~~~~~~~~CP~Cr~~~~~~~~~~~n~~l~~~i~~~~~~~~   84 (92)
T 3ztg_A           23 MTDAVVIPCCGNSYCDECIRTALLESDEHTCPTCHQNDVSPDALIANKFLRQAVNNFKNETG   84 (92)
T ss_dssp             CSSCEECTTTCCEECHHHHHHHHHHCTTCCCTTTCCSSCCTTSCEECHHHHHHHHHHHHHHT
T ss_pred             hcCceECCCCCCHHHHHHHHHHHHhcCCCcCcCCCCcCCCccccCcCHHHHHHHHHHHHHHh
Confidence            56799999 999999999999987555578999999984   37889999988888776543
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} Back     alignment and structure
>2jmo_A Parkin; IBR, E3 ligase, zinc binding domain, RBR; NMR {Homo sapiens} Back     alignment and structure
>3i2d_A E3 SUMO-protein ligase SIZ1; signal transduction, replication, ring E3, PIAS, ubiquitin, UBC9, metal-binding, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query195
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 99.34
d2c2la280 STIP1 homology and U box-containing protein 1, STU 99.29
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 99.29
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 99.18
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 99.15
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 99.1
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 98.91
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 98.91
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 98.9
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 98.83
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 98.83
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 98.81
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 98.77
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 98.71
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 98.68
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 98.39
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 97.97
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: brca1 RING domain
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.34  E-value=2.4e-13  Score=98.74  Aligned_cols=53  Identities=15%  Similarity=0.322  Sum_probs=44.4

Q ss_pred             CCCCCcCCCCCcccHHhHHhhhccCC-CCCCCCCCCCCCc--Cccccccccchhhh
Q 029308            2 LGQDSSPGNGSCKSATCILRWASYVR-NPTCPQCKHPFEF--LHVHRSLDGSISDY   54 (195)
Q Consensus         2 ~~QpVtl~CGHsFC~~CI~rW~e~kq-~~sCP~CK~pFs~--l~vNr~LdG~vedy   54 (195)
                      +-+||+++|||+||..||.+|+.... ...||+|++++..  +.+|..|..+++.+
T Consensus        31 ~~~pv~~~CgH~fC~~Ci~~~~~~~~~~~~CP~Cr~~~~~~~l~~n~~l~~~ve~l   86 (103)
T d1jm7a_          31 IKEPVSTKCDHIFCKFCMLKLLNQKKGPSQCPLCKNDITKRSLQESTRFSQLVEEL   86 (103)
T ss_dssp             CSSCCBCTTSCCCCSHHHHHHHHSSSSSCCCTTTSCCCCTTTCBCCCSSSHHHHHH
T ss_pred             hCCeEEcCCCCchhhHHHHHHHHHCCCCCcCcCCCCcCChhhCCcCHHHHHHHHHH
Confidence            56899999999999999999986433 3589999999974  78888888887765
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure