Citrus Sinensis ID: 029556
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 191 | ||||||
| 255560013 | 408 | conserved hypothetical protein [Ricinus | 0.785 | 0.367 | 0.543 | 7e-49 | |
| 224079468 | 241 | predicted protein [Populus trichocarpa] | 0.706 | 0.560 | 0.519 | 8e-42 | |
| 297850862 | 398 | NHL repeat-containing protein [Arabidops | 0.806 | 0.386 | 0.452 | 1e-39 | |
| 225424715 | 438 | PREDICTED: uncharacterized protein LOC10 | 0.837 | 0.365 | 0.455 | 2e-39 | |
| 296086532 | 369 | unnamed protein product [Vitis vinifera] | 0.837 | 0.433 | 0.455 | 2e-39 | |
| 224065156 | 264 | predicted protein [Populus trichocarpa] | 0.712 | 0.515 | 0.489 | 8e-39 | |
| 18395326 | 261 | NHL domain-containing protein [Arabidops | 0.806 | 0.590 | 0.452 | 9e-39 | |
| 42571623 | 400 | NHL domain-containing protein [Arabidops | 0.806 | 0.385 | 0.452 | 1e-38 | |
| 9369410 | 370 | T23E23.6 [Arabidopsis thaliana] | 0.780 | 0.402 | 0.458 | 3e-38 | |
| 147798774 | 459 | hypothetical protein VITISV_022545 [Viti | 0.837 | 0.348 | 0.446 | 5e-38 |
| >gi|255560013|ref|XP_002521025.1| conserved hypothetical protein [Ricinus communis] gi|223539862|gb|EEF41442.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 198 bits (504), Expect = 7e-49, Method: Compositional matrix adjust.
Identities = 106/195 (54%), Positives = 126/195 (64%), Gaps = 45/195 (23%)
Query: 14 LLSLLFSLVSSGLLLEDGYTVTTVIDGHQLEINPHSVIDRPGSSDLIVLDSSRSAFYTLS 73
LL L + V GL+LEDGYTVTT+IDGH+LEINPH+V+ RP SSDLI+LDSS S YT+S
Sbjct: 18 LLHLPSNYVLGGLILEDGYTVTTIIDGHKLEINPHAVLSRPQSSDLILLDSSHSTIYTIS 77
Query: 74 FPLSEESVVKRLAGDGVQGYSDGEPGSARFDKPKSFAVDMKGNIYVADKSNHVIRKITN- 132
FP+S+ESVVKRL+GDGV G SDGEPGSARF+KP+SFAVD KGNIYVAD+ N IRKITN
Sbjct: 78 FPISQESVVKRLSGDGVAGLSDGEPGSARFNKPRSFAVDNKGNIYVADRLNGTIRKITNS 137
Query: 133 ------------------------------------------LDHGNQLIRQINLKPEDC 150
DHGNQL+R++ LKP+DC
Sbjct: 138 GVSTIAGGYSKGFGREDGPAQNATFSSDFEVAFVAEECALLISDHGNQLVRRLPLKPDDC 197
Query: 151 SKSSQSGSGM--FWV 163
+ +S S G FWV
Sbjct: 198 ATASHSALGAVSFWV 212
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224079468|ref|XP_002305875.1| predicted protein [Populus trichocarpa] gi|222848839|gb|EEE86386.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|297850862|ref|XP_002893312.1| NHL repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297339154|gb|EFH69571.1| NHL repeat-containing protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|225424715|ref|XP_002265272.1| PREDICTED: uncharacterized protein LOC100243227 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|296086532|emb|CBI32121.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224065156|ref|XP_002301692.1| predicted protein [Populus trichocarpa] gi|222843418|gb|EEE80965.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|18395326|ref|NP_564209.1| NHL domain-containing protein [Arabidopsis thaliana] gi|15724248|gb|AAL06517.1|AF412064_1 At1g23890/T23E23_13 [Arabidopsis thaliana] gi|16974539|gb|AAL31179.1| At1g23890/T23E23_13 [Arabidopsis thaliana] gi|110742589|dbj|BAE99208.1| hypothetical protein [Arabidopsis thaliana] gi|332192326|gb|AEE30447.1| NHL domain-containing protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|42571623|ref|NP_973902.1| NHL domain-containing protein [Arabidopsis thaliana] gi|332192325|gb|AEE30446.1| NHL domain-containing protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|9369410|gb|AAF87158.1|AC002423_23 T23E23.6 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|147798774|emb|CAN69795.1| hypothetical protein VITISV_022545 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 191 | ||||||
| TAIR|locus:2199872 | 400 | AT1G23890 "AT1G23890" [Arabido | 0.544 | 0.26 | 0.625 | 3.6e-40 | |
| TAIR|locus:2147780 | 754 | AT5G14890 [Arabidopsis thalian | 0.544 | 0.137 | 0.433 | 1.3e-16 | |
| TAIR|locus:2199862 | 545 | AT1G23880 "AT1G23880" [Arabido | 0.534 | 0.187 | 0.438 | 5e-15 | |
| TAIR|locus:2016189 | 509 | AT1G70280 "AT1G70280" [Arabido | 0.534 | 0.200 | 0.428 | 7.1e-15 | |
| TAIR|locus:2099357 | 493 | AT3G14860 "AT3G14860" [Arabido | 0.523 | 0.202 | 0.380 | 4.6e-13 |
| TAIR|locus:2199872 AT1G23890 "AT1G23890" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 348 (127.6 bits), Expect = 3.6e-40, Sum P(2) = 3.6e-40
Identities = 65/104 (62%), Positives = 83/104 (79%)
Query: 29 EDGYTVTTVIDGHQLEINPHSVIDRPGSSDLIVLDSSRSAFYTLSFPLSEESVVKRLAGD 88
E+GY VTTV+DGH+ +NP+++ PGSS+LIVLDSS S FYT SFPLS +SV+ R AGD
Sbjct: 26 EEGYEVTTVVDGHKSGLNPYTIHALPGSSNLIVLDSSGSTFYTTSFPLSVDSVINRFAGD 85
Query: 89 GVQGYSDGEPGSARFDKPKSFAVDMKGNIYVADKSNHVIRKITN 132
G G+ DG+ G++RF KP+ FAVD KGN+YVADKSN IRKI++
Sbjct: 86 GSSGHVDGKAGNSRFSKPRGFAVDAKGNVYVADKSNKAIRKISS 129
|
|
| TAIR|locus:2147780 AT5G14890 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2199862 AT1G23880 "AT1G23880" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2016189 AT1G70280 "AT1G70280" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2099357 AT3G14860 "AT3G14860" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| fgenesh4_pm.C_LG_IV000256 | hypothetical protein (241 aa) | ||||||||||
(Populus trichocarpa) | |||||||||||
| gw1.XIII.601.1 | • | 0.429 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 191 | |||
| PLN02919 | 1057 | PLN02919, PLN02919, haloacid dehalogenase-like hyd | 2e-05 | |
| PLN02919 | 1057 | PLN02919, PLN02919, haloacid dehalogenase-like hyd | 2e-04 | |
| pfam01436 | 28 | pfam01436, NHL, NHL repeat | 0.004 |
| >gnl|CDD|215497 PLN02919, PLN02919, haloacid dehalogenase-like hydrolase family protein | Back alignment and domain information |
|---|
Score = 44.1 bits (104), Expect = 2e-05
Identities = 21/65 (32%), Positives = 32/65 (49%)
Query: 82 VKRLAGDGVQGYSDGEPGSARFDKPKSFAVDMKGNIYVADKSNHVIRKITNLDHGNQLIR 141
V LAG G G+ DG+ A+ +P A+ G ++VAD +N +IR + I
Sbjct: 837 VTTLAGTGKAGFKDGKALKAQLSEPAGLALGENGRLFVADTNNSLIRYLDLNKGEAAEIL 896
Query: 142 QINLK 146
+ LK
Sbjct: 897 TLELK 901
|
Length = 1057 |
| >gnl|CDD|215497 PLN02919, PLN02919, haloacid dehalogenase-like hydrolase family protein | Back alignment and domain information |
|---|
| >gnl|CDD|110440 pfam01436, NHL, NHL repeat | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 191 | |||
| PLN02919 | 1057 | haloacid dehalogenase-like hydrolase family protei | 99.45 | |
| PLN02919 | 1057 | haloacid dehalogenase-like hydrolase family protei | 99.36 | |
| PF08450 | 246 | SGL: SMP-30/Gluconolaconase/LRE-like region; Inter | 99.3 | |
| KOG4659 | 1899 | consensus Uncharacterized conserved protein (Rhs f | 99.23 | |
| COG3386 | 307 | Gluconolactonase [Carbohydrate transport and metab | 99.06 | |
| PF01436 | 28 | NHL: NHL repeat; InterPro: IPR001258 The NHL repea | 98.95 | |
| PF08450 | 246 | SGL: SMP-30/Gluconolaconase/LRE-like region; Inter | 98.74 | |
| KOG4659 | 1899 | consensus Uncharacterized conserved protein (Rhs f | 98.63 | |
| PF01436 | 28 | NHL: NHL repeat; InterPro: IPR001258 The NHL repea | 98.57 | |
| KOG4499 | 310 | consensus Ca2+-binding protein Regucalcin/SMP30 [I | 98.4 | |
| PF03088 | 89 | Str_synth: Strictosidine synthase; InterPro: IPR01 | 98.29 | |
| COG4257 | 353 | Vgb Streptogramin lyase [Defense mechanisms] | 97.83 | |
| TIGR02604 | 367 | Piru_Ver_Nterm putative membrane-bound dehydrogena | 97.74 | |
| COG4257 | 353 | Vgb Streptogramin lyase [Defense mechanisms] | 97.72 | |
| PF10282 | 345 | Lactonase: Lactonase, 7-bladed beta-propeller; Int | 97.68 | |
| COG3386 | 307 | Gluconolactonase [Carbohydrate transport and metab | 97.59 | |
| PF10282 | 345 | Lactonase: Lactonase, 7-bladed beta-propeller; Int | 97.53 | |
| TIGR02604 | 367 | Piru_Ver_Nterm putative membrane-bound dehydrogena | 97.47 | |
| COG3391 | 381 | Uncharacterized conserved protein [Function unknow | 97.4 | |
| PF06977 | 248 | SdiA-regulated: SdiA-regulated; InterPro: IPR00972 | 97.36 | |
| KOG1520 | 376 | consensus Predicted alkaloid synthase/Surface muci | 97.24 | |
| KOG1214 | 1289 | consensus Nidogen and related basement membrane pr | 97.22 | |
| PF05787 | 524 | DUF839: Bacterial protein of unknown function (DUF | 97.2 | |
| PRK11028 | 330 | 6-phosphogluconolactonase; Provisional | 97.14 | |
| COG3391 | 381 | Uncharacterized conserved protein [Function unknow | 96.95 | |
| PF01731 | 86 | Arylesterase: Arylesterase; InterPro: IPR002640 Th | 96.92 | |
| COG3211 | 616 | PhoX Predicted phosphatase [General function predi | 96.9 | |
| PRK11028 | 330 | 6-phosphogluconolactonase; Provisional | 96.87 | |
| TIGR02658 | 352 | TTQ_MADH_Hv methylamine dehydrogenase heavy chain. | 96.78 | |
| PF03088 | 89 | Str_synth: Strictosidine synthase; InterPro: IPR01 | 96.66 | |
| TIGR03866 | 300 | PQQ_ABC_repeats PQQ-dependent catabolism-associate | 96.49 | |
| TIGR03606 | 454 | non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH | 96.44 | |
| smart00135 | 43 | LY Low-density lipoprotein-receptor YWTD domain. T | 96.35 | |
| TIGR03866 | 300 | PQQ_ABC_repeats PQQ-dependent catabolism-associate | 96.3 | |
| PF13449 | 326 | Phytase-like: Esterase-like activity of phytase | 96.22 | |
| PF03022 | 287 | MRJP: Major royal jelly protein; InterPro: IPR0035 | 96.14 | |
| KOG1520 | 376 | consensus Predicted alkaloid synthase/Surface muci | 96.11 | |
| smart00135 | 43 | LY Low-density lipoprotein-receptor YWTD domain. T | 96.1 | |
| TIGR02658 | 352 | TTQ_MADH_Hv methylamine dehydrogenase heavy chain. | 95.86 | |
| PF02239 | 369 | Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO | 95.84 | |
| PF07995 | 331 | GSDH: Glucose / Sorbosone dehydrogenase; InterPro: | 95.49 | |
| COG2706 | 346 | 3-carboxymuconate cyclase [Carbohydrate transport | 95.36 | |
| PF02333 | 381 | Phytase: Phytase; InterPro: IPR003431 Phytase (3.1 | 95.32 | |
| KOG1214 | 1289 | consensus Nidogen and related basement membrane pr | 95.26 | |
| PF00058 | 42 | Ldl_recept_b: Low-density lipoprotein receptor rep | 95.15 | |
| PF07995 | 331 | GSDH: Glucose / Sorbosone dehydrogenase; InterPro: | 95.01 | |
| PF13449 | 326 | Phytase-like: Esterase-like activity of phytase | 94.64 | |
| PF01731 | 86 | Arylesterase: Arylesterase; InterPro: IPR002640 Th | 94.38 | |
| KOG4499 | 310 | consensus Ca2+-binding protein Regucalcin/SMP30 [I | 94.36 | |
| PF03022 | 287 | MRJP: Major royal jelly protein; InterPro: IPR0035 | 93.84 | |
| PF06739 | 38 | SBBP: Beta-propeller repeat; InterPro: IPR010620 T | 93.53 | |
| TIGR02276 | 42 | beta_rpt_yvtn 40-residue YVTN family beta-propelle | 93.45 | |
| TIGR03032 | 335 | conserved hypothetical protein TIGR03032. This pro | 93.26 | |
| COG3204 | 316 | Uncharacterized protein conserved in bacteria [Fun | 92.95 | |
| COG2706 | 346 | 3-carboxymuconate cyclase [Carbohydrate transport | 92.93 | |
| PF02333 | 381 | Phytase: Phytase; InterPro: IPR003431 Phytase (3.1 | 92.77 | |
| COG2133 | 399 | Glucose/sorbosone dehydrogenases [Carbohydrate tra | 92.06 | |
| PF14269 | 299 | Arylsulfotran_2: Arylsulfotransferase (ASST) | 91.84 | |
| TIGR03118 | 336 | PEPCTERM_chp_1 conserved hypothetical protein TIGR | 90.91 | |
| PF06977 | 248 | SdiA-regulated: SdiA-regulated; InterPro: IPR00972 | 89.45 | |
| PRK02888 | 635 | nitrous-oxide reductase; Validated | 88.66 | |
| TIGR03606 | 454 | non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH | 87.89 | |
| PF06739 | 38 | SBBP: Beta-propeller repeat; InterPro: IPR010620 T | 87.67 | |
| PF02239 | 369 | Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO | 87.17 | |
| TIGR03032 | 335 | conserved hypothetical protein TIGR03032. This pro | 86.26 | |
| PF00058 | 42 | Ldl_recept_b: Low-density lipoprotein receptor rep | 85.82 | |
| PRK02888 | 635 | nitrous-oxide reductase; Validated | 85.64 | |
| PF05096 | 264 | Glu_cyclase_2: Glutamine cyclotransferase; InterPr | 85.6 | |
| PF05935 | 477 | Arylsulfotrans: Arylsulfotransferase (ASST); Inter | 85.59 | |
| KOG3567 | 501 | consensus Peptidylglycine alpha-amidating monooxyg | 85.0 | |
| smart00284 | 255 | OLF Olfactomedin-like domains. | 83.09 | |
| COG4247 | 364 | Phy 3-phytase (myo-inositol-hexaphosphate 3-phosph | 82.56 |
| >PLN02919 haloacid dehalogenase-like hydrolase family protein | Back alignment and domain information |
|---|
Probab=99.45 E-value=8.8e-13 Score=129.66 Aligned_cols=89 Identities=27% Similarity=0.403 Sum_probs=80.6
Q ss_pred CCCeeeEEEecCCCeEEEEeCCCCeEEEEecCCCCCceEEEEecCCCccCCCCCCcccccCCCceEEEcCCCCEEEEeCC
Q 029556 44 EINPHSVIDRPGSSDLIVLDSSRSAFYTLSFPLSEESVVKRLAGDGVQGYSDGEPGSARFDKPKSFAVDMKGNIYVADKS 123 (191)
Q Consensus 44 ~~~P~gIav~d~~g~lyVaD~~n~~I~~~d~~~~~~g~v~~~aG~~~~G~~DG~~~~a~f~~P~gIavD~~G~iyVaD~~ 123 (191)
+.+|.+++++ ++|++||+|..||+|++++. .++.+.+++|.+..|+.||....++|+.|.||++|++|++||+|+.
T Consensus 803 l~~P~Gvavd-~dG~LYVADs~N~rIrviD~---~tg~v~tiaG~G~~G~~dG~~~~a~l~~P~GIavd~dG~lyVaDt~ 878 (1057)
T PLN02919 803 LQHPLGVLCA-KDGQIYVADSYNHKIKKLDP---ATKRVTTLAGTGKAGFKDGKALKAQLSEPAGLALGENGRLFVADTN 878 (1057)
T ss_pred ccCCceeeEe-CCCcEEEEECCCCEEEEEEC---CCCeEEEEeccCCcCCCCCcccccccCCceEEEEeCCCCEEEEECC
Confidence 5689999995 78899999999999999995 4678899999888888888888999999999999999999999999
Q ss_pred CCEEEEEeCCCCC
Q 029556 124 NHVIRKITNLDHG 136 (191)
Q Consensus 124 n~rIr~i~~~~~~ 136 (191)
|++||+++...+.
T Consensus 879 Nn~Irvid~~~~~ 891 (1057)
T PLN02919 879 NSLIRYLDLNKGE 891 (1057)
T ss_pred CCEEEEEECCCCc
Confidence 9999999986643
|
|
| >PLN02919 haloacid dehalogenase-like hydrolase family protein | Back alignment and domain information |
|---|
| >PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species | Back alignment and domain information |
|---|
| >KOG4659 consensus Uncharacterized conserved protein (Rhs family) [Function unknown] | Back alignment and domain information |
|---|
| >COG3386 Gluconolactonase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PF01436 NHL: NHL repeat; InterPro: IPR001258 The NHL repeat, named after NCL-1, HT2A and Lin-41, is found largely in a large number of eukaryotic and prokaryotic proteins | Back alignment and domain information |
|---|
| >PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species | Back alignment and domain information |
|---|
| >KOG4659 consensus Uncharacterized conserved protein (Rhs family) [Function unknown] | Back alignment and domain information |
|---|
| >PF01436 NHL: NHL repeat; InterPro: IPR001258 The NHL repeat, named after NCL-1, HT2A and Lin-41, is found largely in a large number of eukaryotic and prokaryotic proteins | Back alignment and domain information |
|---|
| >KOG4499 consensus Ca2+-binding protein Regucalcin/SMP30 [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF03088 Str_synth: Strictosidine synthase; InterPro: IPR018119 This entry represents a conserved region found in strictosidine synthase (4 | Back alignment and domain information |
|---|
| >COG4257 Vgb Streptogramin lyase [Defense mechanisms] | Back alignment and domain information |
|---|
| >TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain | Back alignment and domain information |
|---|
| >COG4257 Vgb Streptogramin lyase [Defense mechanisms] | Back alignment and domain information |
|---|
| >PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 | Back alignment and domain information |
|---|
| >COG3386 Gluconolactonase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 | Back alignment and domain information |
|---|
| >TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain | Back alignment and domain information |
|---|
| >COG3391 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] | Back alignment and domain information |
|---|
| >KOG1520 consensus Predicted alkaloid synthase/Surface mucin Hemomucin [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1214 consensus Nidogen and related basement membrane protein proteins [Cell wall/membrane/envelope biogenesis; Extracellular structures] | Back alignment and domain information |
|---|
| >PF05787 DUF839: Bacterial protein of unknown function (DUF839); InterPro: IPR008557 This family consists of bacterial proteins of unknown function | Back alignment and domain information |
|---|
| >PRK11028 6-phosphogluconolactonase; Provisional | Back alignment and domain information |
|---|
| >COG3391 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF01731 Arylesterase: Arylesterase; InterPro: IPR002640 The serum paraoxonases/arylesterases are enzymes that catalyse the hydrolysis of the toxic metabolites of a variety of organophosphorus insecticides | Back alignment and domain information |
|---|
| >COG3211 PhoX Predicted phosphatase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11028 6-phosphogluconolactonase; Provisional | Back alignment and domain information |
|---|
| >TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain | Back alignment and domain information |
|---|
| >PF03088 Str_synth: Strictosidine synthase; InterPro: IPR018119 This entry represents a conserved region found in strictosidine synthase (4 | Back alignment and domain information |
|---|
| >TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein | Back alignment and domain information |
|---|
| >TIGR03606 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH family | Back alignment and domain information |
|---|
| >smart00135 LY Low-density lipoprotein-receptor YWTD domain | Back alignment and domain information |
|---|
| >TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein | Back alignment and domain information |
|---|
| >PF13449 Phytase-like: Esterase-like activity of phytase | Back alignment and domain information |
|---|
| >PF03022 MRJP: Major royal jelly protein; InterPro: IPR003534 The major royal jelly proteins (MRJPs) comprise 12 | Back alignment and domain information |
|---|
| >KOG1520 consensus Predicted alkaloid synthase/Surface mucin Hemomucin [General function prediction only] | Back alignment and domain information |
|---|
| >smart00135 LY Low-density lipoprotein-receptor YWTD domain | Back alignment and domain information |
|---|
| >TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain | Back alignment and domain information |
|---|
| >PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A | Back alignment and domain information |
|---|
| >PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases | Back alignment and domain information |
|---|
| >COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PF02333 Phytase: Phytase; InterPro: IPR003431 Phytase (3 | Back alignment and domain information |
|---|
| >KOG1214 consensus Nidogen and related basement membrane protein proteins [Cell wall/membrane/envelope biogenesis; Extracellular structures] | Back alignment and domain information |
|---|
| >PF00058 Ldl_recept_b: Low-density lipoprotein receptor repeat class B; InterPro: IPR000033 The low-density lipoprotein receptor (LDLR) is the major cholesterol-carrying lipoprotein of plasma, acting to regulate cholesterol homeostasis in mammalian cells | Back alignment and domain information |
|---|
| >PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases | Back alignment and domain information |
|---|
| >PF13449 Phytase-like: Esterase-like activity of phytase | Back alignment and domain information |
|---|
| >PF01731 Arylesterase: Arylesterase; InterPro: IPR002640 The serum paraoxonases/arylesterases are enzymes that catalyse the hydrolysis of the toxic metabolites of a variety of organophosphorus insecticides | Back alignment and domain information |
|---|
| >KOG4499 consensus Ca2+-binding protein Regucalcin/SMP30 [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF03022 MRJP: Major royal jelly protein; InterPro: IPR003534 The major royal jelly proteins (MRJPs) comprise 12 | Back alignment and domain information |
|---|
| >PF06739 SBBP: Beta-propeller repeat; InterPro: IPR010620 This family is related to IPR001680 from INTERPRO and is likely to also form a beta-propeller | Back alignment and domain information |
|---|
| >TIGR02276 beta_rpt_yvtn 40-residue YVTN family beta-propeller repeat | Back alignment and domain information |
|---|
| >TIGR03032 conserved hypothetical protein TIGR03032 | Back alignment and domain information |
|---|
| >COG3204 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PF02333 Phytase: Phytase; InterPro: IPR003431 Phytase (3 | Back alignment and domain information |
|---|
| >COG2133 Glucose/sorbosone dehydrogenases [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PF14269 Arylsulfotran_2: Arylsulfotransferase (ASST) | Back alignment and domain information |
|---|
| >TIGR03118 PEPCTERM_chp_1 conserved hypothetical protein TIGR03118 | Back alignment and domain information |
|---|
| >PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] | Back alignment and domain information |
|---|
| >PRK02888 nitrous-oxide reductase; Validated | Back alignment and domain information |
|---|
| >TIGR03606 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH family | Back alignment and domain information |
|---|
| >PF06739 SBBP: Beta-propeller repeat; InterPro: IPR010620 This family is related to IPR001680 from INTERPRO and is likely to also form a beta-propeller | Back alignment and domain information |
|---|
| >PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A | Back alignment and domain information |
|---|
| >TIGR03032 conserved hypothetical protein TIGR03032 | Back alignment and domain information |
|---|
| >PF00058 Ldl_recept_b: Low-density lipoprotein receptor repeat class B; InterPro: IPR000033 The low-density lipoprotein receptor (LDLR) is the major cholesterol-carrying lipoprotein of plasma, acting to regulate cholesterol homeostasis in mammalian cells | Back alignment and domain information |
|---|
| >PRK02888 nitrous-oxide reductase; Validated | Back alignment and domain information |
|---|
| >PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 | Back alignment and domain information |
|---|
| >PF05935 Arylsulfotrans: Arylsulfotransferase (ASST); InterPro: IPR010262 This family consists of several bacterial arylsulphotransferase proteins | Back alignment and domain information |
|---|
| >KOG3567 consensus Peptidylglycine alpha-amidating monooxygenase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >smart00284 OLF Olfactomedin-like domains | Back alignment and domain information |
|---|
| >COG4247 Phy 3-phytase (myo-inositol-hexaphosphate 3-phosphohydrolase) [Lipid metabolism] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 191 | |||
| 3hrp_A | 409 | Uncharacterized protein; NP_812590.1, structural g | 2e-13 | |
| 3hrp_A | 409 | Uncharacterized protein; NP_812590.1, structural g | 6e-13 | |
| 3hrp_A | 409 | Uncharacterized protein; NP_812590.1, structural g | 1e-12 | |
| 3hrp_A | 409 | Uncharacterized protein; NP_812590.1, structural g | 2e-07 | |
| 3tc9_A | 430 | Hypothetical hydrolase; 6-bladed beta-propeller, i | 3e-11 | |
| 3tc9_A | 430 | Hypothetical hydrolase; 6-bladed beta-propeller, i | 3e-11 | |
| 3tc9_A | 430 | Hypothetical hydrolase; 6-bladed beta-propeller, i | 3e-05 | |
| 3kya_A | 496 | Putative phosphatase; structural genomics, joint c | 2e-10 | |
| 3kya_A | 496 | Putative phosphatase; structural genomics, joint c | 6e-10 | |
| 1rwi_B | 270 | Serine/threonine-protein kinase PKND; beta propell | 9e-08 | |
| 1rwi_B | 270 | Serine/threonine-protein kinase PKND; beta propell | 2e-07 | |
| 1rwi_B | 270 | Serine/threonine-protein kinase PKND; beta propell | 4e-07 | |
| 1rwi_B | 270 | Serine/threonine-protein kinase PKND; beta propell | 8e-07 | |
| 1rwi_B | 270 | Serine/threonine-protein kinase PKND; beta propell | 4e-05 | |
| 1q7f_A | 286 | NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL | 2e-07 | |
| 1q7f_A | 286 | NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL | 1e-06 | |
| 1q7f_A | 286 | NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL | 2e-05 | |
| 3fvz_A | 329 | Peptidyl-glycine alpha-amidating monooxygenase; be | 1e-06 | |
| 3fvz_A | 329 | Peptidyl-glycine alpha-amidating monooxygenase; be | 6e-06 | |
| 3fvz_A | 329 | Peptidyl-glycine alpha-amidating monooxygenase; be | 6e-05 | |
| 3fvz_A | 329 | Peptidyl-glycine alpha-amidating monooxygenase; be | 2e-04 | |
| 3fvz_A | 329 | Peptidyl-glycine alpha-amidating monooxygenase; be | 3e-04 | |
| 2qc5_A | 300 | Streptogramin B lactonase; beta propeller, lyase; | 1e-04 | |
| 2qc5_A | 300 | Streptogramin B lactonase; beta propeller, lyase; | 3e-04 | |
| 2qc5_A | 300 | Streptogramin B lactonase; beta propeller, lyase; | 3e-04 | |
| 2qc5_A | 300 | Streptogramin B lactonase; beta propeller, lyase; | 4e-04 | |
| 2qc5_A | 300 | Streptogramin B lactonase; beta propeller, lyase; | 4e-04 | |
| 2z2n_A | 299 | Virginiamycin B lyase; seven-bladed beta-propeller | 2e-04 | |
| 2z2n_A | 299 | Virginiamycin B lyase; seven-bladed beta-propeller | 3e-04 | |
| 2z2n_A | 299 | Virginiamycin B lyase; seven-bladed beta-propeller | 3e-04 | |
| 2z2n_A | 299 | Virginiamycin B lyase; seven-bladed beta-propeller | 5e-04 | |
| 2z2n_A | 299 | Virginiamycin B lyase; seven-bladed beta-propeller | 6e-04 | |
| 2z2n_A | 299 | Virginiamycin B lyase; seven-bladed beta-propeller | 6e-04 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 3e-04 |
| >3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Length = 409 | Back alignment and structure |
|---|
Score = 66.5 bits (162), Expect = 2e-13
Identities = 15/52 (28%), Positives = 21/52 (40%), Gaps = 1/52 (1%)
Query: 81 VVKRLAGDGVQ-GYSDGEPGSARFDKPKSFAVDMKGNIYVADKSNHVIRKIT 131
V +AG DG P A F+ P D +G ++A+ IRK
Sbjct: 356 YVSTVAGQVDVASQIDGTPLEATFNYPYDICYDGEGGYWIAEAWGKAIRKYA 407
|
| >3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Length = 409 | Back alignment and structure |
|---|
| >3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Length = 409 | Back alignment and structure |
|---|
| >3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Length = 409 | Back alignment and structure |
|---|
| >3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Length = 430 | Back alignment and structure |
|---|
| >3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Length = 430 | Back alignment and structure |
|---|
| >3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Length = 430 | Back alignment and structure |
|---|
| >3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Length = 496 | Back alignment and structure |
|---|
| >3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Length = 496 | Back alignment and structure |
|---|
| >1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Length = 270 | Back alignment and structure |
|---|
| >1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Length = 270 | Back alignment and structure |
|---|
| >1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Length = 270 | Back alignment and structure |
|---|
| >1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Length = 270 | Back alignment and structure |
|---|
| >1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Length = 270 | Back alignment and structure |
|---|
| >1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Length = 286 | Back alignment and structure |
|---|
| >1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Length = 286 | Back alignment and structure |
|---|
| >1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Length = 286 | Back alignment and structure |
|---|
| >3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Length = 329 | Back alignment and structure |
|---|
| >3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Length = 329 | Back alignment and structure |
|---|
| >3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Length = 329 | Back alignment and structure |
|---|
| >3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Length = 329 | Back alignment and structure |
|---|
| >3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Length = 329 | Back alignment and structure |
|---|
| >2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Length = 300 | Back alignment and structure |
|---|
| >2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Length = 300 | Back alignment and structure |
|---|
| >2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Length = 300 | Back alignment and structure |
|---|
| >2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Length = 300 | Back alignment and structure |
|---|
| >2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Length = 300 | Back alignment and structure |
|---|
| >2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Length = 299 | Back alignment and structure |
|---|
| >2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Length = 299 | Back alignment and structure |
|---|
| >2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Length = 299 | Back alignment and structure |
|---|
| >2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Length = 299 | Back alignment and structure |
|---|
| >2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Length = 299 | Back alignment and structure |
|---|
| >2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Length = 299 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 191 | |||
| 3kya_A | 496 | Putative phosphatase; structural genomics, joint c | 99.66 | |
| 4hw6_A | 433 | Hypothetical protein, IPT/TIG domain protein; puta | 99.62 | |
| 3hrp_A | 409 | Uncharacterized protein; NP_812590.1, structural g | 99.59 | |
| 3hrp_A | 409 | Uncharacterized protein; NP_812590.1, structural g | 99.55 | |
| 3kya_A | 496 | Putative phosphatase; structural genomics, joint c | 99.54 | |
| 3tc9_A | 430 | Hypothetical hydrolase; 6-bladed beta-propeller, i | 99.53 | |
| 4hw6_A | 433 | Hypothetical protein, IPT/TIG domain protein; puta | 99.44 | |
| 3tc9_A | 430 | Hypothetical hydrolase; 6-bladed beta-propeller, i | 99.31 | |
| 3fvz_A | 329 | Peptidyl-glycine alpha-amidating monooxygenase; be | 99.19 | |
| 3fvz_A | 329 | Peptidyl-glycine alpha-amidating monooxygenase; be | 99.13 | |
| 3v64_C | 349 | Agrin; beta propeller, laminin-G, signaling, prote | 99.03 | |
| 1ijq_A | 316 | LDL receptor, low-density lipoprotein receptor; be | 99.0 | |
| 1ijq_A | 316 | LDL receptor, low-density lipoprotein receptor; be | 99.0 | |
| 3m0c_C | 791 | LDL receptor, low-density lipoprotein receptor; pr | 98.98 | |
| 3v65_B | 386 | Low-density lipoprotein receptor-related protein; | 98.97 | |
| 3sov_A | 318 | LRP-6, low-density lipoprotein receptor-related pr | 98.97 | |
| 3v64_C | 349 | Agrin; beta propeller, laminin-G, signaling, prote | 98.97 | |
| 3sov_A | 318 | LRP-6, low-density lipoprotein receptor-related pr | 98.97 | |
| 3p5b_L | 400 | Low density lipoprotein receptor variant; B-propel | 98.95 | |
| 3v65_B | 386 | Low-density lipoprotein receptor-related protein; | 98.95 | |
| 1q7f_A | 286 | NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL | 98.93 | |
| 3p5b_L | 400 | Low density lipoprotein receptor variant; B-propel | 98.92 | |
| 1npe_A | 267 | Nidogen, entactin; glycoprotein, basement membrane | 98.91 | |
| 3g4e_A | 297 | Regucalcin; six bladed beta-propeller, gluconolcat | 98.89 | |
| 1npe_A | 267 | Nidogen, entactin; glycoprotein, basement membrane | 98.89 | |
| 3s94_A | 619 | LRP-6, low-density lipoprotein receptor-related pr | 98.88 | |
| 2p4o_A | 306 | Hypothetical protein; putative lactonase, structur | 98.87 | |
| 4a0p_A | 628 | LRP6, LRP-6, low-density lipoprotein receptor-rela | 98.83 | |
| 1q7f_A | 286 | NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL | 98.83 | |
| 2fp8_A | 322 | Strictosidine synthase; six bladed beta propeller | 98.82 | |
| 3m0c_C | 791 | LDL receptor, low-density lipoprotein receptor; pr | 98.82 | |
| 3s94_A | 619 | LRP-6, low-density lipoprotein receptor-related pr | 98.8 | |
| 4a0p_A | 628 | LRP6, LRP-6, low-density lipoprotein receptor-rela | 98.76 | |
| 3sre_A | 355 | PON1, serum paraoxonase; directed evolution, 6-bla | 98.73 | |
| 1rwi_B | 270 | Serine/threonine-protein kinase PKND; beta propell | 98.73 | |
| 2p4o_A | 306 | Hypothetical protein; putative lactonase, structur | 98.64 | |
| 1n7d_A | 699 | LDL receptor, low-density lipoprotein receptor; fa | 98.62 | |
| 2fp8_A | 322 | Strictosidine synthase; six bladed beta propeller | 98.61 | |
| 1rwi_B | 270 | Serine/threonine-protein kinase PKND; beta propell | 98.6 | |
| 3e5z_A | 296 | Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco | 98.56 | |
| 1n7d_A | 699 | LDL receptor, low-density lipoprotein receptor; fa | 98.55 | |
| 2qc5_A | 300 | Streptogramin B lactonase; beta propeller, lyase; | 98.5 | |
| 2qe8_A | 343 | Uncharacterized protein; structural genomics, join | 98.49 | |
| 2qc5_A | 300 | Streptogramin B lactonase; beta propeller, lyase; | 98.49 | |
| 3dr2_A | 305 | Exported gluconolactonase; gluconolactonase SMP-30 | 98.43 | |
| 2ism_A | 352 | Putative oxidoreductase; BL41XU spring-8, bladed b | 98.41 | |
| 3a9g_A | 354 | Putative uncharacterized protein; PQQ dependent de | 98.37 | |
| 3e5z_A | 296 | Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco | 98.35 | |
| 2z2n_A | 299 | Virginiamycin B lyase; seven-bladed beta-propeller | 98.34 | |
| 2z2n_A | 299 | Virginiamycin B lyase; seven-bladed beta-propeller | 98.33 | |
| 2ghs_A | 326 | AGR_C_1268P; regucalcin, structural genomics, join | 98.26 | |
| 3dsm_A | 328 | Uncharacterized protein bacuni_02894; seven_blated | 98.25 | |
| 3dr2_A | 305 | Exported gluconolactonase; gluconolactonase SMP-30 | 98.22 | |
| 2qe8_A | 343 | Uncharacterized protein; structural genomics, join | 98.22 | |
| 1pjx_A | 314 | Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries | 98.19 | |
| 2p9w_A | 334 | MAL S 1 allergenic protein; beta propeller; 1.35A | 98.11 | |
| 2ism_A | 352 | Putative oxidoreductase; BL41XU spring-8, bladed b | 98.08 | |
| 2dg1_A | 333 | DRP35, lactonase; beta propeller, hydrolase; 1.72A | 98.07 | |
| 2g8s_A | 353 | Glucose/sorbosone dehydrogenases; bladed beta-prop | 98.06 | |
| 1cru_A | 454 | Protein (soluble quinoprotein glucose dehydrogena; | 98.05 | |
| 2dg1_A | 333 | DRP35, lactonase; beta propeller, hydrolase; 1.72A | 97.99 | |
| 3dsm_A | 328 | Uncharacterized protein bacuni_02894; seven_blated | 97.99 | |
| 3a9g_A | 354 | Putative uncharacterized protein; PQQ dependent de | 97.93 | |
| 3qqz_A | 255 | Putative uncharacterized protein YJIK; MCSG, PSI-2 | 97.91 | |
| 3hfq_A | 347 | Uncharacterized protein LP_2219; Q88V64_lacpl, NES | 97.85 | |
| 1pjx_A | 314 | Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries | 97.83 | |
| 3vgz_A | 353 | Uncharacterized protein YNCE; beta-propeller, prot | 97.82 | |
| 3g4e_A | 297 | Regucalcin; six bladed beta-propeller, gluconolcat | 97.81 | |
| 3hfq_A | 347 | Uncharacterized protein LP_2219; Q88V64_lacpl, NES | 97.8 | |
| 3vgz_A | 353 | Uncharacterized protein YNCE; beta-propeller, prot | 97.77 | |
| 3no2_A | 276 | Uncharacterized protein; six-bladed beta-propeller | 97.74 | |
| 3das_A | 347 | Putative oxidoreductase; aldose sugar dehydrogenas | 97.72 | |
| 3sre_A | 355 | PON1, serum paraoxonase; directed evolution, 6-bla | 97.7 | |
| 4a9v_A | 592 | PHOX; hydrolase, beta-propeller; 1.10A {Pseudomona | 97.68 | |
| 2p9w_A | 334 | MAL S 1 allergenic protein; beta propeller; 1.35A | 97.67 | |
| 3no2_A | 276 | Uncharacterized protein; six-bladed beta-propeller | 97.49 | |
| 3scy_A | 361 | Hypothetical bacterial 6-phosphogluconolactonase; | 97.47 | |
| 2g8s_A | 353 | Glucose/sorbosone dehydrogenases; bladed beta-prop | 97.47 | |
| 3qqz_A | 255 | Putative uncharacterized protein YJIK; MCSG, PSI-2 | 97.46 | |
| 2iwa_A | 266 | Glutamine cyclotransferase; pyroglutamate, acyltra | 97.44 | |
| 3u4y_A | 331 | Uncharacterized protein; structural genomics, PSI- | 97.41 | |
| 1cru_A | 454 | Protein (soluble quinoprotein glucose dehydrogena; | 97.37 | |
| 3scy_A | 361 | Hypothetical bacterial 6-phosphogluconolactonase; | 97.31 | |
| 3u4y_A | 331 | Uncharacterized protein; structural genomics, PSI- | 97.28 | |
| 3zwu_A | 592 | Alkaline phosphatase PHOX; hydrolase, beta-propell | 97.22 | |
| 3das_A | 347 | Putative oxidoreductase; aldose sugar dehydrogenas | 97.16 | |
| 3amr_A | 355 | 3-phytase; beta-propeller, phytate, MYO-inositol h | 97.15 | |
| 1pby_B | 337 | Quinohemoprotein amine dehydrogenase 40 kDa subuni | 97.14 | |
| 1ri6_A | 343 | Putative isomerase YBHE; 7-bladed propeller, enzym | 97.1 | |
| 3c75_H | 426 | MADH, methylamine dehydrogenase heavy chain; coppe | 97.09 | |
| 1l0q_A | 391 | Surface layer protein; SLP, S-layer, 7-bladed beta | 97.09 | |
| 2ghs_A | 326 | AGR_C_1268P; regucalcin, structural genomics, join | 97.08 | |
| 1jof_A | 365 | Carboxy-CIS,CIS-muconate cyclase; beta-propeller, | 96.89 | |
| 3nok_A | 268 | Glutaminyl cyclase; beta-propeller, cyclotransfera | 96.89 | |
| 2iwa_A | 266 | Glutamine cyclotransferase; pyroglutamate, acyltra | 96.87 | |
| 3nol_A | 262 | Glutamine cyclotransferase; beta-propeller, glutam | 96.87 | |
| 3mbr_X | 243 | Glutamine cyclotransferase; beta-propeller; 1.44A | 96.85 | |
| 1l0q_A | 391 | Surface layer protein; SLP, S-layer, 7-bladed beta | 96.83 | |
| 1jmx_B | 349 | Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; | 96.75 | |
| 1jof_A | 365 | Carboxy-CIS,CIS-muconate cyclase; beta-propeller, | 96.73 | |
| 1mda_H | 368 | Methylamine dehydrogenase (heavy subunit); electro | 96.64 | |
| 3nok_A | 268 | Glutaminyl cyclase; beta-propeller, cyclotransfera | 96.59 | |
| 3sjl_D | 386 | Methylamine dehydrogenase heavy chain; MAUG, C-hem | 96.59 | |
| 2oiz_A | 361 | Aromatic amine dehydrogenase, large subunit; oxido | 96.58 | |
| 2mad_H | 373 | Methylamine dehydrogenase (heavy subunit); oxidore | 96.5 | |
| 1jmx_B | 349 | Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; | 96.45 | |
| 3mbr_X | 243 | Glutamine cyclotransferase; beta-propeller; 1.44A | 96.44 | |
| 1pby_B | 337 | Quinohemoprotein amine dehydrogenase 40 kDa subuni | 96.39 | |
| 2mad_H | 373 | Methylamine dehydrogenase (heavy subunit); oxidore | 96.32 | |
| 1ri6_A | 343 | Putative isomerase YBHE; 7-bladed propeller, enzym | 96.31 | |
| 3nol_A | 262 | Glutamine cyclotransferase; beta-propeller, glutam | 96.14 | |
| 1nir_A | 543 | Nitrite reductase; hemoprotein, denitrification, d | 96.13 | |
| 3bws_A | 433 | Protein LP49; two-domain, immunoglobulin-like, 7-b | 96.08 | |
| 4a9v_A | 592 | PHOX; hydrolase, beta-propeller; 1.10A {Pseudomona | 95.97 | |
| 1fwx_A | 595 | Nitrous oxide reductase; beta-propeller domain, cu | 95.94 | |
| 3c75_H | 426 | MADH, methylamine dehydrogenase heavy chain; coppe | 95.92 | |
| 1qks_A | 567 | Cytochrome CD1 nitrite reductase; enzyme, oxidored | 95.9 | |
| 2oiz_A | 361 | Aromatic amine dehydrogenase, large subunit; oxido | 95.85 | |
| 3bws_A | 433 | Protein LP49; two-domain, immunoglobulin-like, 7-b | 95.82 | |
| 2ece_A | 462 | 462AA long hypothetical selenium-binding protein; | 95.58 | |
| 3q6k_A | 381 | 43.2 kDa salivary protein; beta propeller, binding | 95.41 | |
| 3q6k_A | 381 | 43.2 kDa salivary protein; beta propeller, binding | 95.31 | |
| 3sjl_D | 386 | Methylamine dehydrogenase heavy chain; MAUG, C-hem | 95.29 | |
| 1mda_H | 368 | Methylamine dehydrogenase (heavy subunit); electro | 95.28 | |
| 1nir_A | 543 | Nitrite reductase; hemoprotein, denitrification, d | 95.0 | |
| 1tl2_A | 236 | L10, protein (tachylectin-2); animal lectin, horse | 94.59 | |
| 2wg3_C | 463 | Hedgehog-interacting protein; lipoprotein, develop | 94.4 | |
| 3s25_A | 302 | Hypothetical 7-bladed beta-propeller-like protein; | 94.27 | |
| 3amr_A | 355 | 3-phytase; beta-propeller, phytate, MYO-inositol h | 94.06 | |
| 2ece_A | 462 | 462AA long hypothetical selenium-binding protein; | 92.65 | |
| 1qks_A | 567 | Cytochrome CD1 nitrite reductase; enzyme, oxidored | 92.24 | |
| 2wg3_C | 463 | Hedgehog-interacting protein; lipoprotein, develop | 91.07 | |
| 3hxj_A | 330 | Pyrrolo-quinoline quinone; all beta protein. incom | 90.74 | |
| 3hxj_A | 330 | Pyrrolo-quinoline quinone; all beta protein. incom | 90.2 | |
| 1fwx_A | 595 | Nitrous oxide reductase; beta-propeller domain, cu | 89.43 | |
| 3s25_A | 302 | Hypothetical 7-bladed beta-propeller-like protein; | 89.21 | |
| 4e54_B | 435 | DNA damage-binding protein 2; beta barrel, double | 84.43 | |
| 3v9f_A | 781 | Two-component system sensor histidine kinase/RESP | 83.79 | |
| 3v9f_A | 781 | Two-component system sensor histidine kinase/RESP | 83.71 | |
| 1gxr_A | 337 | ESG1, transducin-like enhancer protein 1; transcri | 83.5 | |
| 2hqs_A | 415 | Protein TOLB; TOLB, PAL, TOL, transport protein-li | 82.41 | |
| 4a2l_A | 795 | BT_4663, two-component system sensor histidine kin | 81.67 | |
| 3ott_A | 758 | Two-component system sensor histidine kinase; beta | 81.26 | |
| 1tl2_A | 236 | L10, protein (tachylectin-2); animal lectin, horse | 80.93 | |
| 3zwu_A | 592 | Alkaline phosphatase PHOX; hydrolase, beta-propell | 80.74 |
| >3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
Probab=99.66 E-value=2.6e-16 Score=142.28 Aligned_cols=89 Identities=27% Similarity=0.359 Sum_probs=78.2
Q ss_pred CCCCee-eEEEec------CCCeEEEEeCCCCeEEEEecCCCCCceEEEEecCCCc---------cCCCC-CCcccccCC
Q 029556 43 LEINPH-SVIDRP------GSSDLIVLDSSRSAFYTLSFPLSEESVVKRLAGDGVQ---------GYSDG-EPGSARFDK 105 (191)
Q Consensus 43 ~~~~P~-gIav~d------~~g~lyVaD~~n~~I~~~d~~~~~~g~v~~~aG~~~~---------G~~DG-~~~~a~f~~ 105 (191)
.++.|. ++++++ .+++|||||+.||||++++ ++|.+++++|.+.. |+.|| .+.+++|+.
T Consensus 370 ~f~~P~~gv~vd~~~~~~~~~g~lyVaD~~N~rIr~i~----~~G~v~TiaG~g~~~~~~~~~~~G~~dG~~~~~a~f~~ 445 (496)
T 3kya_A 370 RMNNPCQGVFVKNPDYTGEEEYDFYFVDRLNFCVRKVT----PEGIVSTYAGRGASTSLADGNQWGTDDGDLREVARFRD 445 (496)
T ss_dssp BCSSEEEEEEEECTTCCSSCCEEEEEEEGGGTEEEEEC----TTCBEEEEEESCTTHHHHHSCSCCCCCEETTTTCCCSS
T ss_pred ccCCCeEEEEEccccccccCCCeEEEEECCCCEEEEEe----CCCCEEEEecccccccccCccccccCCCCchhhhhcCC
Confidence 468999 788842 5789999999999999997 58999999998653 67788 568999999
Q ss_pred CceEEEcCC-CCEEEEeCCCCEEEEEeCCCC
Q 029556 106 PKSFAVDMK-GNIYVADKSNHVIRKITNLDH 135 (191)
Q Consensus 106 P~gIavD~~-G~iyVaD~~n~rIr~i~~~~~ 135 (191)
|.||++|++ |+|||||+.|||||+|++++.
T Consensus 446 P~gIavd~~~g~lyVaD~~N~rIrki~~~~~ 476 (496)
T 3kya_A 446 VSGLVYDDVKEMFYVHDQVGHTIRTISMEQE 476 (496)
T ss_dssp EEEEEEETTTTEEEEEETTTTEEEEEEECCC
T ss_pred CcEEEEECCCCEEEEEeCCCCEEEEEECCCC
Confidence 999999996 999999999999999999664
|
| >4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} | Back alignment and structure |
|---|
| >3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} | Back alignment and structure |
|---|
| >3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* | Back alignment and structure |
|---|
| >3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* | Back alignment and structure |
|---|
| >3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 | Back alignment and structure |
|---|
| >1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 | Back alignment and structure |
|---|
| >3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} | Back alignment and structure |
|---|
| >3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B | Back alignment and structure |
|---|
| >3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B | Back alignment and structure |
|---|
| >3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L | Back alignment and structure |
|---|
| >3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 | Back alignment and structure |
|---|
| >3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L | Back alignment and structure |
|---|
| >1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 | Back alignment and structure |
|---|
| >3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B | Back alignment and structure |
|---|
| >1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 | Back alignment and structure |
|---|
| >3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* | Back alignment and structure |
|---|
| >2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 | Back alignment and structure |
|---|
| >4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* | Back alignment and structure |
|---|
| >1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 | Back alignment and structure |
|---|
| >2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* | Back alignment and structure |
|---|
| >3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} | Back alignment and structure |
|---|
| >3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* | Back alignment and structure |
|---|
| >4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* | Back alignment and structure |
|---|
| >3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* | Back alignment and structure |
|---|
| >1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A | Back alignment and structure |
|---|
| >2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 | Back alignment and structure |
|---|
| >1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A | Back alignment and structure |
|---|
| >2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* | Back alignment and structure |
|---|
| >1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A | Back alignment and structure |
|---|
| >3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A | Back alignment and structure |
|---|
| >2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} | Back alignment and structure |
|---|
| >2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} | Back alignment and structure |
|---|
| >2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} | Back alignment and structure |
|---|
| >3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* | Back alignment and structure |
|---|
| >3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* | Back alignment and structure |
|---|
| >2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* | Back alignment and structure |
|---|
| >2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 | Back alignment and structure |
|---|
| >3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} | Back alignment and structure |
|---|
| >3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} | Back alignment and structure |
|---|
| >1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... | Back alignment and structure |
|---|
| >2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} | Back alignment and structure |
|---|
| >2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A | Back alignment and structure |
|---|
| >2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} | Back alignment and structure |
|---|
| >1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A | Back alignment and structure |
|---|
| >2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A | Back alignment and structure |
|---|
| >3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} | Back alignment and structure |
|---|
| >3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* | Back alignment and structure |
|---|
| >3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} | Back alignment and structure |
|---|
| >3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} | Back alignment and structure |
|---|
| >1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... | Back alignment and structure |
|---|
| >3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* | Back alignment and structure |
|---|
| >3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B | Back alignment and structure |
|---|
| >3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} | Back alignment and structure |
|---|
| >3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* | Back alignment and structure |
|---|
| >3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} | Back alignment and structure |
|---|
| >3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} | Back alignment and structure |
|---|
| >3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* | Back alignment and structure |
|---|
| >4a9v_A PHOX; hydrolase, beta-propeller; 1.10A {Pseudomonas fluorescens} PDB: 3zwu_A 4a9x_A* | Back alignment and structure |
|---|
| >2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} | Back alignment and structure |
|---|
| >3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} | Back alignment and structure |
|---|
| >3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A | Back alignment and structure |
|---|
| >2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} | Back alignment and structure |
|---|
| >3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} | Back alignment and structure |
|---|
| >2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* | Back alignment and structure |
|---|
| >3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} | Back alignment and structure |
|---|
| >1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A | Back alignment and structure |
|---|
| >3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A | Back alignment and structure |
|---|
| >3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} | Back alignment and structure |
|---|
| >3zwu_A Alkaline phosphatase PHOX; hydrolase, beta-propeller, iron; 1.39A {Pseudomonas fluorescens} | Back alignment and structure |
|---|
| >3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} | Back alignment and structure |
|---|
| >3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A | Back alignment and structure |
|---|
| >1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* | Back alignment and structure |
|---|
| >1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 | Back alignment and structure |
|---|
| >3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} | Back alignment and structure |
|---|
| >1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 | Back alignment and structure |
|---|
| >2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 | Back alignment and structure |
|---|
| >1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 | Back alignment and structure |
|---|
| >3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} | Back alignment and structure |
|---|
| >2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* | Back alignment and structure |
|---|
| >3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A | Back alignment and structure |
|---|
| >3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} | Back alignment and structure |
|---|
| >1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 | Back alignment and structure |
|---|
| >1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* | Back alignment and structure |
|---|
| >1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 | Back alignment and structure |
|---|
| >1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 | Back alignment and structure |
|---|
| >3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} | Back alignment and structure |
|---|
| >3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... | Back alignment and structure |
|---|
| >2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... | Back alignment and structure |
|---|
| >2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* | Back alignment and structure |
|---|
| >1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* | Back alignment and structure |
|---|
| >3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} | Back alignment and structure |
|---|
| >1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* | Back alignment and structure |
|---|
| >2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* | Back alignment and structure |
|---|
| >1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 | Back alignment and structure |
|---|
| >3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A | Back alignment and structure |
|---|
| >1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* | Back alignment and structure |
|---|
| >3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} | Back alignment and structure |
|---|
| >4a9v_A PHOX; hydrolase, beta-propeller; 1.10A {Pseudomonas fluorescens} PDB: 3zwu_A 4a9x_A* | Back alignment and structure |
|---|
| >1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A | Back alignment and structure |
|---|
| >3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} | Back alignment and structure |
|---|
| >1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* | Back alignment and structure |
|---|
| >2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... | Back alignment and structure |
|---|
| >3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} | Back alignment and structure |
|---|
| >2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >3q6k_A 43.2 kDa salivary protein; beta propeller, binding protein, serotonin, salivary gland, binding, ligand binging protein; HET: CIT SRO; 2.52A {Lutzomyia longipalpis} PDB: 3q6p_A* 3q6t_A* | Back alignment and structure |
|---|
| >3q6k_A 43.2 kDa salivary protein; beta propeller, binding protein, serotonin, salivary gland, binding, ligand binging protein; HET: CIT SRO; 2.52A {Lutzomyia longipalpis} PDB: 3q6p_A* 3q6t_A* | Back alignment and structure |
|---|
| >3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... | Back alignment and structure |
|---|
| >1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 | Back alignment and structure |
|---|
| >1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* | Back alignment and structure |
|---|
| >1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* | Back alignment and structure |
|---|
| >2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A | Back alignment and structure |
|---|
| >3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} | Back alignment and structure |
|---|
| >3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A | Back alignment and structure |
|---|
| >2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* | Back alignment and structure |
|---|
| >2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A | Back alignment and structure |
|---|
| >3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A | Back alignment and structure |
|---|
| >3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} | Back alignment and structure |
|---|
| >4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* | Back alignment and structure |
|---|
| >3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A | Back alignment and structure |
|---|
| >2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A | Back alignment and structure |
|---|
| >4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* | Back alignment and structure |
|---|
| >3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A | Back alignment and structure |
|---|
| >1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* | Back alignment and structure |
|---|
| >3zwu_A Alkaline phosphatase PHOX; hydrolase, beta-propeller, iron; 1.39A {Pseudomonas fluorescens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 191 | ||||
| d1q7fa_ | 279 | b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (D | 7e-07 | |
| d1rwia_ | 260 | b.68.9.1 (A:) Serine/threonine-protein kinase PknD | 1e-06 |
| >d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 279 | Back information, alignment and structure |
|---|
class: All beta proteins fold: 6-bladed beta-propeller superfamily: NHL repeat family: NHL repeat domain: Brain tumor cg10719-pa species: Fruit fly (Drosophila melanogaster) [TaxId: 7227]
Score = 45.8 bits (107), Expect = 7e-07
Identities = 14/38 (36%), Positives = 21/38 (55%), Gaps = 2/38 (5%)
Query: 96 GEPGSA--RFDKPKSFAVDMKGNIYVADKSNHVIRKIT 131
GE G +F +P AV+ + +I VAD +NH I+
Sbjct: 13 GEFGVMEGQFTEPSGVAVNAQNDIIVADTNNHRIQIFD 50
|
| >d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Length = 260 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 191 | |||
| d2dg1a1 | 319 | Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 | 99.33 | |
| d1rwia_ | 260 | Serine/threonine-protein kinase PknD {Mycobacteriu | 99.28 | |
| d2ghsa1 | 295 | Regucalcin {Agrobacterium tumefaciens [TaxId: 358] | 99.21 | |
| d1q7fa_ | 279 | Brain tumor cg10719-pa {Fruit fly (Drosophila mela | 99.19 | |
| d1q7fa_ | 279 | Brain tumor cg10719-pa {Fruit fly (Drosophila mela | 99.1 | |
| d1pjxa_ | 314 | Diisopropylfluorophosphatase (phosphotriesterase, | 99.05 | |
| d1rwia_ | 260 | Serine/threonine-protein kinase PknD {Mycobacteriu | 99.04 | |
| d1ijqa1 | 266 | Low density lipoprotein (LDL) receptor {Human (Hom | 98.7 | |
| d1npea_ | 263 | Nidogen {Mouse (Mus musculus) [TaxId: 10090]} | 98.65 | |
| d1ijqa1 | 266 | Low density lipoprotein (LDL) receptor {Human (Hom | 98.62 | |
| d2p4oa1 | 302 | Hypothetical protein All0351 homologue {Nostoc pun | 98.55 | |
| d2dg1a1 | 319 | Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 | 98.49 | |
| d1pjxa_ | 314 | Diisopropylfluorophosphatase (phosphotriesterase, | 98.47 | |
| d1npea_ | 263 | Nidogen {Mouse (Mus musculus) [TaxId: 10090]} | 98.4 | |
| d2p4oa1 | 302 | Hypothetical protein All0351 homologue {Nostoc pun | 98.39 | |
| d1v04a_ | 340 | Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory | 97.9 | |
| d1l0qa2 | 301 | Surface layer protein {Archaeon Methanosarcina maz | 97.77 | |
| d1l0qa2 | 301 | Surface layer protein {Archaeon Methanosarcina maz | 97.67 | |
| d1ri6a_ | 333 | Putative isomerase YbhE {Escherichia coli [TaxId: | 97.56 | |
| d1jofa_ | 365 | 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu | 97.54 | |
| d1v04a_ | 340 | Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory | 97.43 | |
| d2ghsa1 | 295 | Regucalcin {Agrobacterium tumefaciens [TaxId: 358] | 97.28 | |
| d1jmxb_ | 346 | Quinohemoprotein amine dehydrogenase B chain {Pseu | 97.01 | |
| d1ri6a_ | 333 | Putative isomerase YbhE {Escherichia coli [TaxId: | 96.87 | |
| d1pbyb_ | 337 | Quinohemoprotein amine dehydrogenase B chain {Para | 96.82 | |
| d1crua_ | 450 | Soluble quinoprotein glucose dehydrogenase {Acinet | 96.79 | |
| d1jofa_ | 365 | 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu | 96.77 | |
| d1jmxb_ | 346 | Quinohemoprotein amine dehydrogenase B chain {Pseu | 96.56 | |
| d1mdah_ | 368 | Methylamine dehydrogenase, H-chain {Paracoccus den | 95.53 | |
| d1pbyb_ | 337 | Quinohemoprotein amine dehydrogenase B chain {Para | 95.39 | |
| d1h6la_ | 353 | Thermostable phytase (3-phytase) {Bacillus amyloli | 95.27 | |
| d1qnia2 | 441 | Nitrous oxide reductase, N-terminal domain {Pseudo | 95.21 | |
| d1hzua2 | 426 | C-terminal (heme d1) domain of cytochrome cd1-nitr | 94.98 | |
| d1qksa2 | 432 | C-terminal (heme d1) domain of cytochrome cd1-nitr | 94.7 | |
| d1mdah_ | 368 | Methylamine dehydrogenase, H-chain {Paracoccus den | 94.35 | |
| d1crua_ | 450 | Soluble quinoprotein glucose dehydrogenase {Acinet | 94.1 | |
| d2madh_ | 373 | Methylamine dehydrogenase, H-chain {Gram negative | 92.7 | |
| d1hzua2 | 426 | C-terminal (heme d1) domain of cytochrome cd1-nitr | 92.58 | |
| d2bbkh_ | 355 | Methylamine dehydrogenase, H-chain {Paracoccus den | 91.42 | |
| d1h6la_ | 353 | Thermostable phytase (3-phytase) {Bacillus amyloli | 91.01 | |
| d1qksa2 | 432 | C-terminal (heme d1) domain of cytochrome cd1-nitr | 90.49 | |
| d2bbkh_ | 355 | Methylamine dehydrogenase, H-chain {Paracoccus den | 89.36 | |
| d1qnia2 | 441 | Nitrous oxide reductase, N-terminal domain {Pseudo | 87.38 | |
| d1k32a3 | 360 | Tricorn protease domain 2 {Archaeon Thermoplasma a | 84.52 | |
| d1fwxa2 | 459 | Nitrous oxide reductase, N-terminal domain {Paraco | 84.31 |
| >d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: 6-bladed beta-propeller superfamily: Calcium-dependent phosphotriesterase family: SGL-like domain: Lactonase Drp35 species: Staphylococcus aureus [TaxId: 1280]
Probab=99.33 E-value=2.1e-12 Score=107.15 Aligned_cols=104 Identities=19% Similarity=0.218 Sum_probs=72.6
Q ss_pred CCcEEEEEEcCccCCCCeeeEEEecCCCeEEEEeCCCCeEEEEecCCCCCceEEEEecCCCccCCCCCCcccccCCCceE
Q 029556 30 DGYTVTTVIDGHQLEINPHSVIDRPGSSDLIVLDSSRSAFYTLSFPLSEESVVKRLAGDGVQGYSDGEPGSARFDKPKSF 109 (191)
Q Consensus 30 dGy~~~~~~~G~~~~~~P~gIav~d~~g~lyVaD~~n~~I~~~d~~~~~~g~v~~~aG~~~~G~~DG~~~~a~f~~P~gI 109 (191)
||..++.+.++. ..|+||+++++++.|||+|+.+++|++++++ .++......+.... . ....+..|+||
T Consensus 165 dg~~~~~~~~~~---~~pnGia~s~dg~~lyvad~~~~~I~~~d~~--~~g~~~~~~~~~~~-~-----~~~~~~~PdGl 233 (319)
T d2dg1a1 165 DFRTVTPIIQNI---SVANGIALSTDEKVLWVTETTANRLHRIALE--DDGVTIQPFGATIP-Y-----YFTGHEGPDSC 233 (319)
T ss_dssp TSCCEEEEEEEE---SSEEEEEECTTSSEEEEEEGGGTEEEEEEEC--TTSSSEEEEEEEEE-E-----ECCSSSEEEEE
T ss_pred ccceeEEEeecc---ceeeeeeeccccceEEEecccCCceEEEEEc--CCCceeccccceee-e-----ccCCccceeee
Confidence 444445544443 4899999976666799999999999999874 33321111110000 0 01123359999
Q ss_pred EEcCCCCEEEEeCCCCEEEEEeCCCCCceEEEEeccCC
Q 029556 110 AVDMKGNIYVADKSNHVIRKITNLDHGNQLIRQINLKP 147 (191)
Q Consensus 110 avD~~G~iyVaD~~n~rIr~i~~~~~~~~~i~~i~~~~ 147 (191)
++|++|+||||++++++|+++++++ +.++.|.+|.
T Consensus 234 ~vD~~G~l~Va~~~~g~V~~~~p~G---~~l~~i~~P~ 268 (319)
T d2dg1a1 234 CIDSDDNLYVAMYGQGRVLVFNKRG---YPIGQILIPG 268 (319)
T ss_dssp EEBTTCCEEEEEETTTEEEEECTTS---CEEEEEECTT
T ss_pred eEcCCCCEEEEEcCCCEEEEECCCC---cEEEEEeCCC
Confidence 9999999999999999999999976 5778888774
|
| >d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} | Back information, alignment and structure |
|---|
| >d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} | Back information, alignment and structure |
|---|
| >d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} | Back information, alignment and structure |
|---|
| >d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} | Back information, alignment and structure |
|---|
| >d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} | Back information, alignment and structure |
|---|
| >d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} | Back information, alignment and structure |
|---|
| >d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} | Back information, alignment and structure |
|---|
| >d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} | Back information, alignment and structure |
|---|
| >d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} | Back information, alignment and structure |
|---|
| >d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} | Back information, alignment and structure |
|---|
| >d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} | Back information, alignment and structure |
|---|
| >d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d1h6la_ b.68.3.1 (A:) Thermostable phytase (3-phytase) {Bacillus amyloliquefaciens [TaxId: 1390]} | Back information, alignment and structure |
|---|
| >d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} | Back information, alignment and structure |
|---|
| >d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} | Back information, alignment and structure |
|---|
| >d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} | Back information, alignment and structure |
|---|
| >d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d1h6la_ b.68.3.1 (A:) Thermostable phytase (3-phytase) {Bacillus amyloliquefaciens [TaxId: 1390]} | Back information, alignment and structure |
|---|
| >d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} | Back information, alignment and structure |
|---|
| >d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|