Citrus Sinensis ID: 029556


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-
MASHFVYSSLAITLLSLLFSLVSSGLLLEDGYTVTTVIDGHQLEINPHSVIDRPGSSDLIVLDSSRSAFYTLSFPLSEESVVKRLAGDGVQGYSDGEPGSARFDKPKSFAVDMKGNIYVADKSNHVIRKITNLDHGNQLIRQINLKPEDCSKSSQSGSGMFWVTVFSPYLISCKSFWVHLYLYFCSFKGSI
ccccHHHHHHHHHHHHHHEEcccccEEEEcccEEEEEEEcccccccccEEEEEcccccEEEEEccccEEEEEEcccccccEEEEEEcccccccccccccccccccccEEEEcccccEEEEEccccEEEEEEccccccEEEEEEEEcccccccccccccccEEEEEEcEEEEEEcccHHHHHHHHHHccccc
ccHHHHHHHHHHHHHHHHHHHHHccEEEcccEEEEEEEcccccccccccEEEEcccccEEEEEccccEEEEEEcccccccEEEEEEcccccccccccccHcEcccccEEEEcccccEEEEEccccEEEEEccccccccEEEEEEcccccccccccccHHHHHHHHHHHHHHHcccEEEEEEEEEEEEEccc
MASHFVYSSLAITLLSLLFSLVSsgllledgytvttvidghqleinphsvidrpgssdlivldssrsafytlsfplseESVVKRLagdgvqgysdgepgsarfdkpksfavdmkgniyvadksnHVIRKITNLDHGNQLIRqinlkpedcskssqsgsgmFWVTVFSPYLISCKSFWVHLYLYFCSFKGSI
MASHFVYSSLAITLLSLLFSLVSSGLLLEDGYTVTTVIDGHQleinphsvidrpGSSDLIVLDSSRSAFYTLSFPLSEESVVKRLAGDGVqgysdgepgsarfdKPKSFAVDMKGNIYVADKSNHVIRKITNLDHGNQLIRQINLKPEDCSKSSQSGSGMFWVTVFSPYLISCKSFWVHLYLYFCSFKGSI
MASHFVYsslaitllsllfslvssglllEDGYTVTTVIDGHQLEINPHSVIDRPGSSDLIVLDSSRSAFYTLSFPLSEESVVKRLAGDGVQGYSDGEPGSARFDKPKSFAVDMKGNIYVADKSNHVIRKITNLDHGNQLIRQINLKPEDCSKSSQSGSGMFWVTVFSPYLISCKSFWVHLYLYFCSFKGSI
***HFVYSSLAITLLSLLFSLVSSGLLLEDGYTVTTVIDGHQLEINPHSVIDRPGSSDLIVLDSSRSAFYTLSFPLSEESVVKRL***********************FAVDMKGNIYVADKSNHVIRKITNLDHGNQLIRQINL*************GMFWVTVFSPYLISCKSFWVHLYLYFCSF****
**SHFVYSSLAITLLSLLFSLVSSGLLLEDGYTVTTVIDGHQLEINPHSVIDRPGSSDLIVLDSSRSAFYTLSFPLSEESVVKRLAGDGVQGYSDGEPGSARFDKPKSFAVDMKGNIYVADKSNHVIRKITNLDHGNQLIRQINLKPEDCSKSSQSGSGMFWVTVFSPYLISCKSFWVHLYLYFCSFKGSI
MASHFVYSSLAITLLSLLFSLVSSGLLLEDGYTVTTVIDGHQLEINPHSVIDRPGSSDLIVLDSSRSAFYTLSFPLSEESVVKRLAGDGVQGYSDGEPGSARFDKPKSFAVDMKGNIYVADKSNHVIRKITNLDHGNQLIRQINLKP*********GSGMFWVTVFSPYLISCKSFWVHLYLYFCSFKGSI
*ASHFVYSSLAITLLSLLFSLVSSGLLLEDGYTVTTVIDGHQLEINPHSVIDRPGSSDLIVLDSSRSAFYTLSFPLSEESVVKRLAGDGVQGYSDGEPGSARFDKPKSFAVDMKGNIYVADKSNHVIRKITNLDHGNQLIRQINLKPEDCSKSSQSGSGMFWVTVFSPYLISCKSFWVHLYLYFCSFKGSI
iiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiii
iiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiii
SSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHoooo
SSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASHFVYSSLAITLLSLLFSLVSSGLLLEDGYTVTTVIDGHQLEINPHSVIDRPGSSDLIVLDSSRSAFYTLSFPLSEESVVKRLAGDGVQGYSDGEPGSARFDKPKSFAVDMKGNIYVADKSNHVIRKITNLDHGNQLIRQINLKPEDCSKSSQSGSGMFWVTVFSPYLISCKSFWVHLYLYFCSFKGSI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query191
255560013 408 conserved hypothetical protein [Ricinus 0.785 0.367 0.543 7e-49
224079468241 predicted protein [Populus trichocarpa] 0.706 0.560 0.519 8e-42
297850862 398 NHL repeat-containing protein [Arabidops 0.806 0.386 0.452 1e-39
225424715 438 PREDICTED: uncharacterized protein LOC10 0.837 0.365 0.455 2e-39
296086532 369 unnamed protein product [Vitis vinifera] 0.837 0.433 0.455 2e-39
224065156264 predicted protein [Populus trichocarpa] 0.712 0.515 0.489 8e-39
18395326261 NHL domain-containing protein [Arabidops 0.806 0.590 0.452 9e-39
42571623 400 NHL domain-containing protein [Arabidops 0.806 0.385 0.452 1e-38
9369410 370 T23E23.6 [Arabidopsis thaliana] 0.780 0.402 0.458 3e-38
147798774 459 hypothetical protein VITISV_022545 [Viti 0.837 0.348 0.446 5e-38
>gi|255560013|ref|XP_002521025.1| conserved hypothetical protein [Ricinus communis] gi|223539862|gb|EEF41442.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
 Score =  198 bits (504), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 106/195 (54%), Positives = 126/195 (64%), Gaps = 45/195 (23%)

Query: 14  LLSLLFSLVSSGLLLEDGYTVTTVIDGHQLEINPHSVIDRPGSSDLIVLDSSRSAFYTLS 73
           LL L  + V  GL+LEDGYTVTT+IDGH+LEINPH+V+ RP SSDLI+LDSS S  YT+S
Sbjct: 18  LLHLPSNYVLGGLILEDGYTVTTIIDGHKLEINPHAVLSRPQSSDLILLDSSHSTIYTIS 77

Query: 74  FPLSEESVVKRLAGDGVQGYSDGEPGSARFDKPKSFAVDMKGNIYVADKSNHVIRKITN- 132
           FP+S+ESVVKRL+GDGV G SDGEPGSARF+KP+SFAVD KGNIYVAD+ N  IRKITN 
Sbjct: 78  FPISQESVVKRLSGDGVAGLSDGEPGSARFNKPRSFAVDNKGNIYVADRLNGTIRKITNS 137

Query: 133 ------------------------------------------LDHGNQLIRQINLKPEDC 150
                                                      DHGNQL+R++ LKP+DC
Sbjct: 138 GVSTIAGGYSKGFGREDGPAQNATFSSDFEVAFVAEECALLISDHGNQLVRRLPLKPDDC 197

Query: 151 SKSSQSGSGM--FWV 163
           + +S S  G   FWV
Sbjct: 198 ATASHSALGAVSFWV 212




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224079468|ref|XP_002305875.1| predicted protein [Populus trichocarpa] gi|222848839|gb|EEE86386.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297850862|ref|XP_002893312.1| NHL repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297339154|gb|EFH69571.1| NHL repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|225424715|ref|XP_002265272.1| PREDICTED: uncharacterized protein LOC100243227 [Vitis vinifera] Back     alignment and taxonomy information
>gi|296086532|emb|CBI32121.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224065156|ref|XP_002301692.1| predicted protein [Populus trichocarpa] gi|222843418|gb|EEE80965.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|18395326|ref|NP_564209.1| NHL domain-containing protein [Arabidopsis thaliana] gi|15724248|gb|AAL06517.1|AF412064_1 At1g23890/T23E23_13 [Arabidopsis thaliana] gi|16974539|gb|AAL31179.1| At1g23890/T23E23_13 [Arabidopsis thaliana] gi|110742589|dbj|BAE99208.1| hypothetical protein [Arabidopsis thaliana] gi|332192326|gb|AEE30447.1| NHL domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|42571623|ref|NP_973902.1| NHL domain-containing protein [Arabidopsis thaliana] gi|332192325|gb|AEE30446.1| NHL domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|9369410|gb|AAF87158.1|AC002423_23 T23E23.6 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|147798774|emb|CAN69795.1| hypothetical protein VITISV_022545 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query191
TAIR|locus:2199872 400 AT1G23890 "AT1G23890" [Arabido 0.544 0.26 0.625 3.6e-40
TAIR|locus:2147780 754 AT5G14890 [Arabidopsis thalian 0.544 0.137 0.433 1.3e-16
TAIR|locus:2199862 545 AT1G23880 "AT1G23880" [Arabido 0.534 0.187 0.438 5e-15
TAIR|locus:2016189 509 AT1G70280 "AT1G70280" [Arabido 0.534 0.200 0.428 7.1e-15
TAIR|locus:2099357 493 AT3G14860 "AT3G14860" [Arabido 0.523 0.202 0.380 4.6e-13
TAIR|locus:2199872 AT1G23890 "AT1G23890" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 348 (127.6 bits), Expect = 3.6e-40, Sum P(2) = 3.6e-40
 Identities = 65/104 (62%), Positives = 83/104 (79%)

Query:    29 EDGYTVTTVIDGHQLEINPHSVIDRPGSSDLIVLDSSRSAFYTLSFPLSEESVVKRLAGD 88
             E+GY VTTV+DGH+  +NP+++   PGSS+LIVLDSS S FYT SFPLS +SV+ R AGD
Sbjct:    26 EEGYEVTTVVDGHKSGLNPYTIHALPGSSNLIVLDSSGSTFYTTSFPLSVDSVINRFAGD 85

Query:    89 GVQGYSDGEPGSARFDKPKSFAVDMKGNIYVADKSNHVIRKITN 132
             G  G+ DG+ G++RF KP+ FAVD KGN+YVADKSN  IRKI++
Sbjct:    86 GSSGHVDGKAGNSRFSKPRGFAVDAKGNVYVADKSNKAIRKISS 129


GO:0003674 "molecular_function" evidence=ND
GO:0005576 "extracellular region" evidence=ISM
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2147780 AT5G14890 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2199862 AT1G23880 "AT1G23880" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2016189 AT1G70280 "AT1G70280" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2099357 AT3G14860 "AT3G14860" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
fgenesh4_pm.C_LG_IV000256
hypothetical protein (241 aa)
(Populus trichocarpa)
Predicted Functional Partners:
gw1.XIII.601.1
SubName- Full=Putative uncharacterized protein; (1016 aa)
       0.429

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query191
PLN02919 1057 PLN02919, PLN02919, haloacid dehalogenase-like hyd 2e-05
PLN02919 1057 PLN02919, PLN02919, haloacid dehalogenase-like hyd 2e-04
pfam0143628 pfam01436, NHL, NHL repeat 0.004
>gnl|CDD|215497 PLN02919, PLN02919, haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
 Score = 44.1 bits (104), Expect = 2e-05
 Identities = 21/65 (32%), Positives = 32/65 (49%)

Query: 82  VKRLAGDGVQGYSDGEPGSARFDKPKSFAVDMKGNIYVADKSNHVIRKITNLDHGNQLIR 141
           V  LAG G  G+ DG+   A+  +P   A+   G ++VAD +N +IR +         I 
Sbjct: 837 VTTLAGTGKAGFKDGKALKAQLSEPAGLALGENGRLFVADTNNSLIRYLDLNKGEAAEIL 896

Query: 142 QINLK 146
            + LK
Sbjct: 897 TLELK 901


Length = 1057

>gnl|CDD|215497 PLN02919, PLN02919, haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>gnl|CDD|110440 pfam01436, NHL, NHL repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 191
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 99.45
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 99.36
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 99.3
KOG4659 1899 consensus Uncharacterized conserved protein (Rhs f 99.23
COG3386307 Gluconolactonase [Carbohydrate transport and metab 99.06
PF0143628 NHL: NHL repeat; InterPro: IPR001258 The NHL repea 98.95
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 98.74
KOG4659 1899 consensus Uncharacterized conserved protein (Rhs f 98.63
PF0143628 NHL: NHL repeat; InterPro: IPR001258 The NHL repea 98.57
KOG4499310 consensus Ca2+-binding protein Regucalcin/SMP30 [I 98.4
PF0308889 Str_synth: Strictosidine synthase; InterPro: IPR01 98.29
COG4257 353 Vgb Streptogramin lyase [Defense mechanisms] 97.83
TIGR02604 367 Piru_Ver_Nterm putative membrane-bound dehydrogena 97.74
COG4257353 Vgb Streptogramin lyase [Defense mechanisms] 97.72
PF10282 345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 97.68
COG3386307 Gluconolactonase [Carbohydrate transport and metab 97.59
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 97.53
TIGR02604367 Piru_Ver_Nterm putative membrane-bound dehydrogena 97.47
COG3391 381 Uncharacterized conserved protein [Function unknow 97.4
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 97.36
KOG1520 376 consensus Predicted alkaloid synthase/Surface muci 97.24
KOG12141289 consensus Nidogen and related basement membrane pr 97.22
PF05787524 DUF839: Bacterial protein of unknown function (DUF 97.2
PRK11028330 6-phosphogluconolactonase; Provisional 97.14
COG3391381 Uncharacterized conserved protein [Function unknow 96.95
PF0173186 Arylesterase: Arylesterase; InterPro: IPR002640 Th 96.92
COG3211616 PhoX Predicted phosphatase [General function predi 96.9
PRK11028 330 6-phosphogluconolactonase; Provisional 96.87
TIGR02658 352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 96.78
PF0308889 Str_synth: Strictosidine synthase; InterPro: IPR01 96.66
TIGR03866 300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 96.49
TIGR03606 454 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH 96.44
smart0013543 LY Low-density lipoprotein-receptor YWTD domain. T 96.35
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 96.3
PF13449 326 Phytase-like: Esterase-like activity of phytase 96.22
PF03022287 MRJP: Major royal jelly protein; InterPro: IPR0035 96.14
KOG1520376 consensus Predicted alkaloid synthase/Surface muci 96.11
smart0013543 LY Low-density lipoprotein-receptor YWTD domain. T 96.1
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 95.86
PF02239 369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 95.84
PF07995331 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: 95.49
COG2706 346 3-carboxymuconate cyclase [Carbohydrate transport 95.36
PF02333381 Phytase: Phytase; InterPro: IPR003431 Phytase (3.1 95.32
KOG1214 1289 consensus Nidogen and related basement membrane pr 95.26
PF0005842 Ldl_recept_b: Low-density lipoprotein receptor rep 95.15
PF07995 331 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: 95.01
PF13449326 Phytase-like: Esterase-like activity of phytase 94.64
PF0173186 Arylesterase: Arylesterase; InterPro: IPR002640 Th 94.38
KOG4499310 consensus Ca2+-binding protein Regucalcin/SMP30 [I 94.36
PF03022 287 MRJP: Major royal jelly protein; InterPro: IPR0035 93.84
PF0673938 SBBP: Beta-propeller repeat; InterPro: IPR010620 T 93.53
TIGR0227642 beta_rpt_yvtn 40-residue YVTN family beta-propelle 93.45
TIGR03032335 conserved hypothetical protein TIGR03032. This pro 93.26
COG3204316 Uncharacterized protein conserved in bacteria [Fun 92.95
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 92.93
PF02333381 Phytase: Phytase; InterPro: IPR003431 Phytase (3.1 92.77
COG2133399 Glucose/sorbosone dehydrogenases [Carbohydrate tra 92.06
PF14269299 Arylsulfotran_2: Arylsulfotransferase (ASST) 91.84
TIGR03118336 PEPCTERM_chp_1 conserved hypothetical protein TIGR 90.91
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 89.45
PRK02888 635 nitrous-oxide reductase; Validated 88.66
TIGR03606 454 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH 87.89
PF0673938 SBBP: Beta-propeller repeat; InterPro: IPR010620 T 87.67
PF02239 369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 87.17
TIGR03032335 conserved hypothetical protein TIGR03032. This pro 86.26
PF0005842 Ldl_recept_b: Low-density lipoprotein receptor rep 85.82
PRK02888 635 nitrous-oxide reductase; Validated 85.64
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 85.6
PF05935477 Arylsulfotrans: Arylsulfotransferase (ASST); Inter 85.59
KOG3567501 consensus Peptidylglycine alpha-amidating monooxyg 85.0
smart00284255 OLF Olfactomedin-like domains. 83.09
COG4247364 Phy 3-phytase (myo-inositol-hexaphosphate 3-phosph 82.56
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
Probab=99.45  E-value=8.8e-13  Score=129.66  Aligned_cols=89  Identities=27%  Similarity=0.403  Sum_probs=80.6

Q ss_pred             CCCeeeEEEecCCCeEEEEeCCCCeEEEEecCCCCCceEEEEecCCCccCCCCCCcccccCCCceEEEcCCCCEEEEeCC
Q 029556           44 EINPHSVIDRPGSSDLIVLDSSRSAFYTLSFPLSEESVVKRLAGDGVQGYSDGEPGSARFDKPKSFAVDMKGNIYVADKS  123 (191)
Q Consensus        44 ~~~P~gIav~d~~g~lyVaD~~n~~I~~~d~~~~~~g~v~~~aG~~~~G~~DG~~~~a~f~~P~gIavD~~G~iyVaD~~  123 (191)
                      +.+|.+++++ ++|++||+|..||+|++++.   .++.+.+++|.+..|+.||....++|+.|.||++|++|++||+|+.
T Consensus       803 l~~P~Gvavd-~dG~LYVADs~N~rIrviD~---~tg~v~tiaG~G~~G~~dG~~~~a~l~~P~GIavd~dG~lyVaDt~  878 (1057)
T PLN02919        803 LQHPLGVLCA-KDGQIYVADSYNHKIKKLDP---ATKRVTTLAGTGKAGFKDGKALKAQLSEPAGLALGENGRLFVADTN  878 (1057)
T ss_pred             ccCCceeeEe-CCCcEEEEECCCCEEEEEEC---CCCeEEEEeccCCcCCCCCcccccccCCceEEEEeCCCCEEEEECC
Confidence            5689999995 78899999999999999995   4678899999888888888888999999999999999999999999


Q ss_pred             CCEEEEEeCCCCC
Q 029556          124 NHVIRKITNLDHG  136 (191)
Q Consensus       124 n~rIr~i~~~~~~  136 (191)
                      |++||+++...+.
T Consensus       879 Nn~Irvid~~~~~  891 (1057)
T PLN02919        879 NSLIRYLDLNKGE  891 (1057)
T ss_pred             CCEEEEEECCCCc
Confidence            9999999986643



>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>KOG4659 consensus Uncharacterized conserved protein (Rhs family) [Function unknown] Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF01436 NHL: NHL repeat; InterPro: IPR001258 The NHL repeat, named after NCL-1, HT2A and Lin-41, is found largely in a large number of eukaryotic and prokaryotic proteins Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>KOG4659 consensus Uncharacterized conserved protein (Rhs family) [Function unknown] Back     alignment and domain information
>PF01436 NHL: NHL repeat; InterPro: IPR001258 The NHL repeat, named after NCL-1, HT2A and Lin-41, is found largely in a large number of eukaryotic and prokaryotic proteins Back     alignment and domain information
>KOG4499 consensus Ca2+-binding protein Regucalcin/SMP30 [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PF03088 Str_synth: Strictosidine synthase; InterPro: IPR018119 This entry represents a conserved region found in strictosidine synthase (4 Back     alignment and domain information
>COG4257 Vgb Streptogramin lyase [Defense mechanisms] Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>COG4257 Vgb Streptogramin lyase [Defense mechanisms] Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>KOG1520 consensus Predicted alkaloid synthase/Surface mucin Hemomucin [General function prediction only] Back     alignment and domain information
>KOG1214 consensus Nidogen and related basement membrane protein proteins [Cell wall/membrane/envelope biogenesis; Extracellular structures] Back     alignment and domain information
>PF05787 DUF839: Bacterial protein of unknown function (DUF839); InterPro: IPR008557 This family consists of bacterial proteins of unknown function Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF01731 Arylesterase: Arylesterase; InterPro: IPR002640 The serum paraoxonases/arylesterases are enzymes that catalyse the hydrolysis of the toxic metabolites of a variety of organophosphorus insecticides Back     alignment and domain information
>COG3211 PhoX Predicted phosphatase [General function prediction only] Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>PF03088 Str_synth: Strictosidine synthase; InterPro: IPR018119 This entry represents a conserved region found in strictosidine synthase (4 Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>TIGR03606 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH family Back     alignment and domain information
>smart00135 LY Low-density lipoprotein-receptor YWTD domain Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>PF13449 Phytase-like: Esterase-like activity of phytase Back     alignment and domain information
>PF03022 MRJP: Major royal jelly protein; InterPro: IPR003534 The major royal jelly proteins (MRJPs) comprise 12 Back     alignment and domain information
>KOG1520 consensus Predicted alkaloid synthase/Surface mucin Hemomucin [General function prediction only] Back     alignment and domain information
>smart00135 LY Low-density lipoprotein-receptor YWTD domain Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF02333 Phytase: Phytase; InterPro: IPR003431 Phytase (3 Back     alignment and domain information
>KOG1214 consensus Nidogen and related basement membrane protein proteins [Cell wall/membrane/envelope biogenesis; Extracellular structures] Back     alignment and domain information
>PF00058 Ldl_recept_b: Low-density lipoprotein receptor repeat class B; InterPro: IPR000033 The low-density lipoprotein receptor (LDLR) is the major cholesterol-carrying lipoprotein of plasma, acting to regulate cholesterol homeostasis in mammalian cells Back     alignment and domain information
>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases Back     alignment and domain information
>PF13449 Phytase-like: Esterase-like activity of phytase Back     alignment and domain information
>PF01731 Arylesterase: Arylesterase; InterPro: IPR002640 The serum paraoxonases/arylesterases are enzymes that catalyse the hydrolysis of the toxic metabolites of a variety of organophosphorus insecticides Back     alignment and domain information
>KOG4499 consensus Ca2+-binding protein Regucalcin/SMP30 [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PF03022 MRJP: Major royal jelly protein; InterPro: IPR003534 The major royal jelly proteins (MRJPs) comprise 12 Back     alignment and domain information
>PF06739 SBBP: Beta-propeller repeat; InterPro: IPR010620 This family is related to IPR001680 from INTERPRO and is likely to also form a beta-propeller Back     alignment and domain information
>TIGR02276 beta_rpt_yvtn 40-residue YVTN family beta-propeller repeat Back     alignment and domain information
>TIGR03032 conserved hypothetical protein TIGR03032 Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF02333 Phytase: Phytase; InterPro: IPR003431 Phytase (3 Back     alignment and domain information
>COG2133 Glucose/sorbosone dehydrogenases [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF14269 Arylsulfotran_2: Arylsulfotransferase (ASST) Back     alignment and domain information
>TIGR03118 PEPCTERM_chp_1 conserved hypothetical protein TIGR03118 Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>TIGR03606 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH family Back     alignment and domain information
>PF06739 SBBP: Beta-propeller repeat; InterPro: IPR010620 This family is related to IPR001680 from INTERPRO and is likely to also form a beta-propeller Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>TIGR03032 conserved hypothetical protein TIGR03032 Back     alignment and domain information
>PF00058 Ldl_recept_b: Low-density lipoprotein receptor repeat class B; InterPro: IPR000033 The low-density lipoprotein receptor (LDLR) is the major cholesterol-carrying lipoprotein of plasma, acting to regulate cholesterol homeostasis in mammalian cells Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>PF05935 Arylsulfotrans: Arylsulfotransferase (ASST); InterPro: IPR010262 This family consists of several bacterial arylsulphotransferase proteins Back     alignment and domain information
>KOG3567 consensus Peptidylglycine alpha-amidating monooxygenase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00284 OLF Olfactomedin-like domains Back     alignment and domain information
>COG4247 Phy 3-phytase (myo-inositol-hexaphosphate 3-phosphohydrolase) [Lipid metabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query191
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 2e-13
3hrp_A 409 Uncharacterized protein; NP_812590.1, structural g 6e-13
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 1e-12
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 2e-07
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 3e-11
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 3e-11
3tc9_A 430 Hypothetical hydrolase; 6-bladed beta-propeller, i 3e-05
3kya_A496 Putative phosphatase; structural genomics, joint c 2e-10
3kya_A496 Putative phosphatase; structural genomics, joint c 6e-10
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 9e-08
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 2e-07
1rwi_B 270 Serine/threonine-protein kinase PKND; beta propell 4e-07
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 8e-07
1rwi_B 270 Serine/threonine-protein kinase PKND; beta propell 4e-05
1q7f_A 286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 2e-07
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 1e-06
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 2e-05
3fvz_A 329 Peptidyl-glycine alpha-amidating monooxygenase; be 1e-06
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 6e-06
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 6e-05
3fvz_A 329 Peptidyl-glycine alpha-amidating monooxygenase; be 2e-04
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 3e-04
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 1e-04
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 3e-04
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 3e-04
2qc5_A 300 Streptogramin B lactonase; beta propeller, lyase; 4e-04
2qc5_A 300 Streptogramin B lactonase; beta propeller, lyase; 4e-04
2z2n_A 299 Virginiamycin B lyase; seven-bladed beta-propeller 2e-04
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 3e-04
2z2n_A 299 Virginiamycin B lyase; seven-bladed beta-propeller 3e-04
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 5e-04
2z2n_A 299 Virginiamycin B lyase; seven-bladed beta-propeller 6e-04
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 6e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-04
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Length = 409 Back     alignment and structure
 Score = 66.5 bits (162), Expect = 2e-13
 Identities = 15/52 (28%), Positives = 21/52 (40%), Gaps = 1/52 (1%)

Query: 81  VVKRLAGDGVQ-GYSDGEPGSARFDKPKSFAVDMKGNIYVADKSNHVIRKIT 131
            V  +AG        DG P  A F+ P     D +G  ++A+     IRK  
Sbjct: 356 YVSTVAGQVDVASQIDGTPLEATFNYPYDICYDGEGGYWIAEAWGKAIRKYA 407


>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Length = 409 Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Length = 409 Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Length = 409 Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Length = 430 Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Length = 430 Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Length = 430 Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Length = 496 Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Length = 496 Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Length = 270 Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Length = 270 Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Length = 270 Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Length = 270 Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Length = 270 Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Length = 286 Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Length = 286 Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Length = 286 Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Length = 329 Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Length = 329 Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Length = 329 Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Length = 329 Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Length = 329 Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Length = 300 Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Length = 300 Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Length = 300 Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Length = 300 Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Length = 300 Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Length = 299 Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Length = 299 Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Length = 299 Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Length = 299 Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Length = 299 Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Length = 299 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query191
3kya_A496 Putative phosphatase; structural genomics, joint c 99.66
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 99.62
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 99.59
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 99.55
3kya_A496 Putative phosphatase; structural genomics, joint c 99.54
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 99.53
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 99.44
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 99.31
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.19
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.13
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 99.03
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 99.0
1ijq_A 316 LDL receptor, low-density lipoprotein receptor; be 99.0
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 98.98
3v65_B386 Low-density lipoprotein receptor-related protein; 98.97
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 98.97
3v64_C 349 Agrin; beta propeller, laminin-G, signaling, prote 98.97
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 98.97
3p5b_L400 Low density lipoprotein receptor variant; B-propel 98.95
3v65_B 386 Low-density lipoprotein receptor-related protein; 98.95
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 98.93
3p5b_L 400 Low density lipoprotein receptor variant; B-propel 98.92
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 98.91
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 98.89
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 98.89
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 98.88
2p4o_A306 Hypothetical protein; putative lactonase, structur 98.87
4a0p_A 628 LRP6, LRP-6, low-density lipoprotein receptor-rela 98.83
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 98.83
2fp8_A322 Strictosidine synthase; six bladed beta propeller 98.82
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 98.82
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 98.8
4a0p_A628 LRP6, LRP-6, low-density lipoprotein receptor-rela 98.76
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 98.73
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 98.73
2p4o_A 306 Hypothetical protein; putative lactonase, structur 98.64
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 98.62
2fp8_A322 Strictosidine synthase; six bladed beta propeller 98.61
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 98.6
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 98.56
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 98.55
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 98.5
2qe8_A343 Uncharacterized protein; structural genomics, join 98.49
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 98.49
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 98.43
2ism_A 352 Putative oxidoreductase; BL41XU spring-8, bladed b 98.41
3a9g_A 354 Putative uncharacterized protein; PQQ dependent de 98.37
3e5z_A 296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 98.35
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 98.34
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 98.33
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 98.26
3dsm_A 328 Uncharacterized protein bacuni_02894; seven_blated 98.25
3dr2_A 305 Exported gluconolactonase; gluconolactonase SMP-30 98.22
2qe8_A 343 Uncharacterized protein; structural genomics, join 98.22
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 98.19
2p9w_A 334 MAL S 1 allergenic protein; beta propeller; 1.35A 98.11
2ism_A 352 Putative oxidoreductase; BL41XU spring-8, bladed b 98.08
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 98.07
2g8s_A 353 Glucose/sorbosone dehydrogenases; bladed beta-prop 98.06
1cru_A 454 Protein (soluble quinoprotein glucose dehydrogena; 98.05
2dg1_A 333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 97.99
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 97.99
3a9g_A 354 Putative uncharacterized protein; PQQ dependent de 97.93
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 97.91
3hfq_A 347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 97.85
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 97.83
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 97.82
3g4e_A 297 Regucalcin; six bladed beta-propeller, gluconolcat 97.81
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 97.8
3vgz_A 353 Uncharacterized protein YNCE; beta-propeller, prot 97.77
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 97.74
3das_A 347 Putative oxidoreductase; aldose sugar dehydrogenas 97.72
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 97.7
4a9v_A592 PHOX; hydrolase, beta-propeller; 1.10A {Pseudomona 97.68
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 97.67
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 97.49
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 97.47
2g8s_A353 Glucose/sorbosone dehydrogenases; bladed beta-prop 97.47
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 97.46
2iwa_A 266 Glutamine cyclotransferase; pyroglutamate, acyltra 97.44
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 97.41
1cru_A 454 Protein (soluble quinoprotein glucose dehydrogena; 97.37
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 97.31
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 97.28
3zwu_A592 Alkaline phosphatase PHOX; hydrolase, beta-propell 97.22
3das_A 347 Putative oxidoreductase; aldose sugar dehydrogenas 97.16
3amr_A355 3-phytase; beta-propeller, phytate, MYO-inositol h 97.15
1pby_B 337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 97.14
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 97.1
3c75_H 426 MADH, methylamine dehydrogenase heavy chain; coppe 97.09
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 97.09
2ghs_A 326 AGR_C_1268P; regucalcin, structural genomics, join 97.08
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 96.89
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 96.89
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 96.87
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 96.87
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 96.85
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 96.83
1jmx_B 349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 96.75
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 96.73
1mda_H 368 Methylamine dehydrogenase (heavy subunit); electro 96.64
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 96.59
3sjl_D 386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 96.59
2oiz_A 361 Aromatic amine dehydrogenase, large subunit; oxido 96.58
2mad_H 373 Methylamine dehydrogenase (heavy subunit); oxidore 96.5
1jmx_B 349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 96.45
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 96.44
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 96.39
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 96.32
1ri6_A 343 Putative isomerase YBHE; 7-bladed propeller, enzym 96.31
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 96.14
1nir_A 543 Nitrite reductase; hemoprotein, denitrification, d 96.13
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 96.08
4a9v_A592 PHOX; hydrolase, beta-propeller; 1.10A {Pseudomona 95.97
1fwx_A 595 Nitrous oxide reductase; beta-propeller domain, cu 95.94
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 95.92
1qks_A 567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 95.9
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 95.85
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 95.82
2ece_A462 462AA long hypothetical selenium-binding protein; 95.58
3q6k_A381 43.2 kDa salivary protein; beta propeller, binding 95.41
3q6k_A 381 43.2 kDa salivary protein; beta propeller, binding 95.31
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 95.29
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 95.28
1nir_A 543 Nitrite reductase; hemoprotein, denitrification, d 95.0
1tl2_A236 L10, protein (tachylectin-2); animal lectin, horse 94.59
2wg3_C 463 Hedgehog-interacting protein; lipoprotein, develop 94.4
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 94.27
3amr_A355 3-phytase; beta-propeller, phytate, MYO-inositol h 94.06
2ece_A462 462AA long hypothetical selenium-binding protein; 92.65
1qks_A 567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 92.24
2wg3_C463 Hedgehog-interacting protein; lipoprotein, develop 91.07
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 90.74
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 90.2
1fwx_A 595 Nitrous oxide reductase; beta-propeller domain, cu 89.43
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 89.21
4e54_B 435 DNA damage-binding protein 2; beta barrel, double 84.43
3v9f_A 781 Two-component system sensor histidine kinase/RESP 83.79
3v9f_A 781 Two-component system sensor histidine kinase/RESP 83.71
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 83.5
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 82.41
4a2l_A 795 BT_4663, two-component system sensor histidine kin 81.67
3ott_A 758 Two-component system sensor histidine kinase; beta 81.26
1tl2_A236 L10, protein (tachylectin-2); animal lectin, horse 80.93
3zwu_A592 Alkaline phosphatase PHOX; hydrolase, beta-propell 80.74
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
Probab=99.66  E-value=2.6e-16  Score=142.28  Aligned_cols=89  Identities=27%  Similarity=0.359  Sum_probs=78.2

Q ss_pred             CCCCee-eEEEec------CCCeEEEEeCCCCeEEEEecCCCCCceEEEEecCCCc---------cCCCC-CCcccccCC
Q 029556           43 LEINPH-SVIDRP------GSSDLIVLDSSRSAFYTLSFPLSEESVVKRLAGDGVQ---------GYSDG-EPGSARFDK  105 (191)
Q Consensus        43 ~~~~P~-gIav~d------~~g~lyVaD~~n~~I~~~d~~~~~~g~v~~~aG~~~~---------G~~DG-~~~~a~f~~  105 (191)
                      .++.|. ++++++      .+++|||||+.||||++++    ++|.+++++|.+..         |+.|| .+.+++|+.
T Consensus       370 ~f~~P~~gv~vd~~~~~~~~~g~lyVaD~~N~rIr~i~----~~G~v~TiaG~g~~~~~~~~~~~G~~dG~~~~~a~f~~  445 (496)
T 3kya_A          370 RMNNPCQGVFVKNPDYTGEEEYDFYFVDRLNFCVRKVT----PEGIVSTYAGRGASTSLADGNQWGTDDGDLREVARFRD  445 (496)
T ss_dssp             BCSSEEEEEEEECTTCCSSCCEEEEEEEGGGTEEEEEC----TTCBEEEEEESCTTHHHHHSCSCCCCCEETTTTCCCSS
T ss_pred             ccCCCeEEEEEccccccccCCCeEEEEECCCCEEEEEe----CCCCEEEEecccccccccCccccccCCCCchhhhhcCC
Confidence            468999 788842      5789999999999999997    58999999998653         67788 568999999


Q ss_pred             CceEEEcCC-CCEEEEeCCCCEEEEEeCCCC
Q 029556          106 PKSFAVDMK-GNIYVADKSNHVIRKITNLDH  135 (191)
Q Consensus       106 P~gIavD~~-G~iyVaD~~n~rIr~i~~~~~  135 (191)
                      |.||++|++ |+|||||+.|||||+|++++.
T Consensus       446 P~gIavd~~~g~lyVaD~~N~rIrki~~~~~  476 (496)
T 3kya_A          446 VSGLVYDDVKEMFYVHDQVGHTIRTISMEQE  476 (496)
T ss_dssp             EEEEEEETTTTEEEEEETTTTEEEEEEECCC
T ss_pred             CcEEEEECCCCEEEEEeCCCCEEEEEECCCC
Confidence            999999996 999999999999999999664



>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>4a9v_A PHOX; hydrolase, beta-propeller; 1.10A {Pseudomonas fluorescens} PDB: 3zwu_A 4a9x_A* Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>3zwu_A Alkaline phosphatase PHOX; hydrolase, beta-propeller, iron; 1.39A {Pseudomonas fluorescens} Back     alignment and structure
>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>4a9v_A PHOX; hydrolase, beta-propeller; 1.10A {Pseudomonas fluorescens} PDB: 3zwu_A 4a9x_A* Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>3q6k_A 43.2 kDa salivary protein; beta propeller, binding protein, serotonin, salivary gland, binding, ligand binging protein; HET: CIT SRO; 2.52A {Lutzomyia longipalpis} PDB: 3q6p_A* 3q6t_A* Back     alignment and structure
>3q6k_A 43.2 kDa salivary protein; beta propeller, binding protein, serotonin, salivary gland, binding, ligand binging protein; HET: CIT SRO; 2.52A {Lutzomyia longipalpis} PDB: 3q6p_A* 3q6t_A* Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* Back     alignment and structure
>3zwu_A Alkaline phosphatase PHOX; hydrolase, beta-propeller, iron; 1.39A {Pseudomonas fluorescens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 191
d1q7fa_ 279 b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (D 7e-07
d1rwia_260 b.68.9.1 (A:) Serine/threonine-protein kinase PknD 1e-06
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 279 Back     information, alignment and structure

class: All beta proteins
fold: 6-bladed beta-propeller
superfamily: NHL repeat
family: NHL repeat
domain: Brain tumor cg10719-pa
species: Fruit fly (Drosophila melanogaster) [TaxId: 7227]
 Score = 45.8 bits (107), Expect = 7e-07
 Identities = 14/38 (36%), Positives = 21/38 (55%), Gaps = 2/38 (5%)

Query: 96  GEPGSA--RFDKPKSFAVDMKGNIYVADKSNHVIRKIT 131
           GE G    +F +P   AV+ + +I VAD +NH I+   
Sbjct: 13  GEFGVMEGQFTEPSGVAVNAQNDIIVADTNNHRIQIFD 50


>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Length = 260 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query191
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 99.33
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 99.28
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 99.21
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 99.19
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 99.1
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 99.05
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 99.04
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 98.7
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 98.65
d1ijqa1 266 Low density lipoprotein (LDL) receptor {Human (Hom 98.62
d2p4oa1 302 Hypothetical protein All0351 homologue {Nostoc pun 98.55
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 98.49
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 98.47
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 98.4
d2p4oa1 302 Hypothetical protein All0351 homologue {Nostoc pun 98.39
d1v04a_340 Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory 97.9
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 97.77
d1l0qa2 301 Surface layer protein {Archaeon Methanosarcina maz 97.67
d1ri6a_ 333 Putative isomerase YbhE {Escherichia coli [TaxId: 97.56
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 97.54
d1v04a_340 Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory 97.43
d2ghsa1 295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 97.28
d1jmxb_ 346 Quinohemoprotein amine dehydrogenase B chain {Pseu 97.01
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 96.87
d1pbyb_ 337 Quinohemoprotein amine dehydrogenase B chain {Para 96.82
d1crua_ 450 Soluble quinoprotein glucose dehydrogenase {Acinet 96.79
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 96.77
d1jmxb_ 346 Quinohemoprotein amine dehydrogenase B chain {Pseu 96.56
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 95.53
d1pbyb_ 337 Quinohemoprotein amine dehydrogenase B chain {Para 95.39
d1h6la_353 Thermostable phytase (3-phytase) {Bacillus amyloli 95.27
d1qnia2 441 Nitrous oxide reductase, N-terminal domain {Pseudo 95.21
d1hzua2 426 C-terminal (heme d1) domain of cytochrome cd1-nitr 94.98
d1qksa2 432 C-terminal (heme d1) domain of cytochrome cd1-nitr 94.7
d1mdah_ 368 Methylamine dehydrogenase, H-chain {Paracoccus den 94.35
d1crua_ 450 Soluble quinoprotein glucose dehydrogenase {Acinet 94.1
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 92.7
d1hzua2 426 C-terminal (heme d1) domain of cytochrome cd1-nitr 92.58
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 91.42
d1h6la_353 Thermostable phytase (3-phytase) {Bacillus amyloli 91.01
d1qksa2 432 C-terminal (heme d1) domain of cytochrome cd1-nitr 90.49
d2bbkh_ 355 Methylamine dehydrogenase, H-chain {Paracoccus den 89.36
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 87.38
d1k32a3 360 Tricorn protease domain 2 {Archaeon Thermoplasma a 84.52
d1fwxa2 459 Nitrous oxide reductase, N-terminal domain {Paraco 84.31
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
class: All beta proteins
fold: 6-bladed beta-propeller
superfamily: Calcium-dependent phosphotriesterase
family: SGL-like
domain: Lactonase Drp35
species: Staphylococcus aureus [TaxId: 1280]
Probab=99.33  E-value=2.1e-12  Score=107.15  Aligned_cols=104  Identities=19%  Similarity=0.218  Sum_probs=72.6

Q ss_pred             CCcEEEEEEcCccCCCCeeeEEEecCCCeEEEEeCCCCeEEEEecCCCCCceEEEEecCCCccCCCCCCcccccCCCceE
Q 029556           30 DGYTVTTVIDGHQLEINPHSVIDRPGSSDLIVLDSSRSAFYTLSFPLSEESVVKRLAGDGVQGYSDGEPGSARFDKPKSF  109 (191)
Q Consensus        30 dGy~~~~~~~G~~~~~~P~gIav~d~~g~lyVaD~~n~~I~~~d~~~~~~g~v~~~aG~~~~G~~DG~~~~a~f~~P~gI  109 (191)
                      ||..++.+.++.   ..|+||+++++++.|||+|+.+++|++++++  .++......+.... .     ....+..|+||
T Consensus       165 dg~~~~~~~~~~---~~pnGia~s~dg~~lyvad~~~~~I~~~d~~--~~g~~~~~~~~~~~-~-----~~~~~~~PdGl  233 (319)
T d2dg1a1         165 DFRTVTPIIQNI---SVANGIALSTDEKVLWVTETTANRLHRIALE--DDGVTIQPFGATIP-Y-----YFTGHEGPDSC  233 (319)
T ss_dssp             TSCCEEEEEEEE---SSEEEEEECTTSSEEEEEEGGGTEEEEEEEC--TTSSSEEEEEEEEE-E-----ECCSSSEEEEE
T ss_pred             ccceeEEEeecc---ceeeeeeeccccceEEEecccCCceEEEEEc--CCCceeccccceee-e-----ccCCccceeee
Confidence            444445544443   4899999976666799999999999999874  33321111110000 0     01123359999


Q ss_pred             EEcCCCCEEEEeCCCCEEEEEeCCCCCceEEEEeccCC
Q 029556          110 AVDMKGNIYVADKSNHVIRKITNLDHGNQLIRQINLKP  147 (191)
Q Consensus       110 avD~~G~iyVaD~~n~rIr~i~~~~~~~~~i~~i~~~~  147 (191)
                      ++|++|+||||++++++|+++++++   +.++.|.+|.
T Consensus       234 ~vD~~G~l~Va~~~~g~V~~~~p~G---~~l~~i~~P~  268 (319)
T d2dg1a1         234 CIDSDDNLYVAMYGQGRVLVFNKRG---YPIGQILIPG  268 (319)
T ss_dssp             EEBTTCCEEEEEETTTEEEEECTTS---CEEEEEECTT
T ss_pred             eEcCCCCEEEEEcCCCEEEEECCCC---cEEEEEeCCC
Confidence            9999999999999999999999976   5778888774



>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1h6la_ b.68.3.1 (A:) Thermostable phytase (3-phytase) {Bacillus amyloliquefaciens [TaxId: 1390]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1h6la_ b.68.3.1 (A:) Thermostable phytase (3-phytase) {Bacillus amyloliquefaciens [TaxId: 1390]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure