Citrus Sinensis ID: 029559

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-
MNNDNDFTFCKVEKNQSSDADGSVENQSSGFLWKQDELPSKTNKTVGFLSYNVIDASSSSAAGTSVKVASRKPASRAKVPFEKGYSQVDWLRLTQTHPDLAGLKGQSNKRLITMDEVKQHQSEGSMWTVLKGRVYNLSPYMKFHPGGVDMLMKAVGKDCTALFNKYHAWVNAEFLLEKCLVGTLDDSRPRQ
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHcccccccccccccccccccHHHHHHHccccccEEEEccEEEEcccccccccccHHHHHHHHcccHHHHHHHccccHHHHHHHHHccEEEcccccccc
cccccccEEEEEccccccccccccccccccEEEccccccccccccccccccccccccccccccccccccccccccEEEEccccccccccHHHHcccccccccccccccccEEcHHHHHHHcccccEEEEEEcEEEEccHHHccccccHHHHHHHHcccHHHHHHHHcccHcHHHHHHHcEEEEcccccccc
mnndndftfckveknqssdadgsvenqssgflwkqdelpsktnktvgFLSYNvidassssaagtsvkvasrkpasrakvpfekgysqvdwlrltqthpdlaglkgqsnkrLITMDEVKqhqsegsmWTVLKGrvynlspymkfhpggVDMLMKAVGKDCTALFNKYHAWVNAEFLLEKCLvgtlddsrprq
MNNDNDFTFCKVeknqssdadgsvENQSSgflwkqdelpsktNKTVGFLSYNVIdassssaagtsvkvasrkpasrakvpfekgysqvDWLRLTQTHPDLAGLKGQSNKRLITMDEVkqhqsegsmwTVLKGRVYNLSPYMKFHPGGVDMLMKAVGKDCTALFNKYHAWVNAEFLLEKCLvgtlddsrprq
MNNDNDFTFCKVEKNQSSDADGSVENQSSGFLWKQDELPSKTNKTVGFLSYNVIDASSSSAAGTSVKVASRKPASRAKVPFEKGYSQVDWLRLTQTHPDLAGLKGQSNKRLITMDEVKQHQSEGSMWTVLKGRVYNLSPYMKFHPGGVDMLMKAVGKDCTALFNKYHAWVNAEFLLEKCLVGTLDDSRPRQ
********************************************TVGFLSYNVI****************************KGYSQVDWLRLTQTHPDL************************SMWTVLKGRVYNLSPYMKFHPGGVDMLMKAVGKDCTALFNKYHAWVNAEFLLEKCLVGTL*******
***DNDF*****************************************************************************YSQV***********************ITMDEVKQHQSEGSMWTVLKGRVYNLSPYMKFHPGGVDMLMKAVGKDCTALFNKYHAWVNAEFLLEKCLVG**DD*****
MNNDNDFTFCKVEK**************SGFLWKQDELPSKTNKTVGFLSYNVIDAS*******************AKVPFEKGYSQVDWLRLTQTHPDLAGLKGQSNKRLITMDEVKQHQSEGSMWTVLKGRVYNLSPYMKFHPGGVDMLMKAVGKDCTALFNKYHAWVNAEFLLEKCLVGTLDDSRPRQ
****NDFTFCKVEKN**********************************************************ASRAKVPFEKGYSQVDWLRLTQTHPDLAGLKG*SNKRLITMDEVKQHQSEGSMWTVLKGRVYNLSPYMKFHPGGVDMLMKAVGKDCTALFNKYHAWVNAEFLLEKCLVGTLDD*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNNDNDFTFCKVEKNQSSDADGSVENQSSGFLWKQDELPSKTNKTVGFLSYNVIDASSSSAAGTSVKVASRKPASRAKVPFEKGYSQVDWLRLTQTHPDLAGLKGQSNKRLITMDEVKQHQSEGSMWTVLKGRVYNLSPYMKFHPGGVDMLMKAVGKDCTALFNKYHAWVNAEFLLEKCLVGTLDDSRPRQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query191 2.2.26 [Sep-21-2011]
Q3TDX8 528 Cytochrome b5 reductase 4 yes no 0.659 0.238 0.442 3e-27
Q7L1T6 521 Cytochrome b5 reductase 4 yes no 0.659 0.241 0.442 4e-27
Q68EJ0 520 Cytochrome b5 reductase 4 yes no 0.659 0.242 0.442 4e-27
Q502I6 527 Cytochrome b5 reductase 4 yes no 0.659 0.239 0.458 8e-27
Q32LH7 520 Cytochrome b5 reductase 4 yes no 0.654 0.240 0.463 9e-27
Q28CZ9 523 Cytochrome b5 reductase 4 yes no 0.649 0.237 0.436 3e-26
Q10352147 Uncharacterized protein C yes no 0.638 0.829 0.330 3e-17
Q04772201 Increased recombination c yes no 0.696 0.661 0.321 2e-15
O74875145 Uncharacterized heme-bind no no 0.513 0.675 0.346 1e-12
O74212 446 Delta(5) fatty acid desat N/A no 0.418 0.179 0.362 1e-11
>sp|Q3TDX8|NB5R4_MOUSE Cytochrome b5 reductase 4 OS=Mus musculus GN=Cyb5r4 PE=2 SV=3 Back     alignment and function desciption
 Score =  121 bits (304), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 58/131 (44%), Positives = 89/131 (67%), Gaps = 5/131 (3%)

Query: 54  IDASSSSAAGTSVKVASRKPASRAKVPFEKGYSQVDWLRLTQTHPDLAGLKGQSNKRLIT 113
           + + +  A G+  +V+S+    R+KVP ++G S +DW+RLT++  DL GLKG   +  +T
Sbjct: 4   VPSQAFPAPGSQQRVSSQ---GRSKVPLKQGRSLMDWIRLTKSGKDLTGLKGGLIE--VT 58

Query: 114 MDEVKQHQSEGSMWTVLKGRVYNLSPYMKFHPGGVDMLMKAVGKDCTALFNKYHAWVNAE 173
            +E+K+H  +   W  ++G VYN+SPYM++HPGG D LM+A G D T LFN+ H WVN E
Sbjct: 59  EEELKKHNKKEDCWICIRGFVYNVSPYMEYHPGGEDELMRAAGADGTDLFNEVHRWVNYE 118

Query: 174 FLLEKCLVGTL 184
            +L++CLVG +
Sbjct: 119 SMLKECLVGRM 129
NADH-cytochrome b5 reductase involved in endoplasmic reticulum stress response pathway. Plays a critical role in protecting pancreatic beta-cells against oxidant stress, possibly by protecting the cell from excess buildup of reactive oxygen species (ROS).
Mus musculus (taxid: 10090)
EC: 1EC: .EC: 6EC: .EC: 2EC: .EC: 2
>sp|Q7L1T6|NB5R4_HUMAN Cytochrome b5 reductase 4 OS=Homo sapiens GN=CYB5R4 PE=1 SV=1 Back     alignment and function description
>sp|Q68EJ0|NB5R4_RAT Cytochrome b5 reductase 4 OS=Rattus norvegicus GN=Cyb5r4 PE=1 SV=2 Back     alignment and function description
>sp|Q502I6|NB5R4_DANRE Cytochrome b5 reductase 4 OS=Danio rerio GN=cyb5r4 PE=2 SV=1 Back     alignment and function description
>sp|Q32LH7|NB5R4_BOVIN Cytochrome b5 reductase 4 OS=Bos taurus GN=CYB5R4 PE=2 SV=1 Back     alignment and function description
>sp|Q28CZ9|NB5R4_XENTR Cytochrome b5 reductase 4 OS=Xenopus tropicalis GN=cyb5r4 PE=2 SV=1 Back     alignment and function description
>sp|Q10352|YDAA_SCHPO Uncharacterized protein C1F12.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1F12.10c PE=3 SV=1 Back     alignment and function description
>sp|Q04772|IRC21_YEAST Increased recombination centers protein 21 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IRC21 PE=1 SV=1 Back     alignment and function description
>sp|O74875|YJ83_SCHPO Uncharacterized heme-binding protein C330.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC330.03c PE=1 SV=1 Back     alignment and function description
>sp|O74212|FAD5_MORAP Delta(5) fatty acid desaturase OS=Mortierella alpina GN=DES1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query191
297736295226 unnamed protein product [Vitis vinifera] 0.984 0.831 0.637 7e-72
224055123229 predicted protein [Populus trichocarpa] 0.963 0.803 0.625 3e-71
359487399285 PREDICTED: uncharacterized protein LOC10 0.863 0.578 0.726 5e-69
356531661215 PREDICTED: cytochrome b5 reductase 4-lik 0.984 0.874 0.609 5e-67
356542758215 PREDICTED: cytochrome b5 reductase 4-lik 0.984 0.874 0.6 2e-66
255553510227 flavohemoprotein B5/b5r, putative [Ricin 0.879 0.740 0.678 5e-66
255645479215 unknown [Glycine max] 0.984 0.874 0.604 5e-66
255637223215 unknown [Glycine max] 0.984 0.874 0.595 5e-65
449436319226 PREDICTED: cytochrome b5 reductase 4-lik 0.979 0.827 0.577 6e-65
297811065215 cytochrome b5 domain-containing protein 0.979 0.869 0.612 1e-64
>gi|297736295|emb|CBI24933.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  275 bits (703), Expect = 7e-72,   Method: Compositional matrix adjust.
 Identities = 144/226 (63%), Positives = 164/226 (72%), Gaps = 38/226 (16%)

Query: 1   MNNDNDFTFCKVEKNQSSD--------------------ADGSVENQSSGFLWKQDELPS 40
           M+NDNDFTFC+V  + + D                    +   V N + GFLWK     +
Sbjct: 1   MDNDNDFTFCQVGSSVNQDGFEAQELVPGIGGITINDEFSSEVVGNGNGGFLWKGKSPNN 60

Query: 41  KTNK--TVGFLSYNVIDASS------------SSAAGTSVKV----ASRKPASRAKVPFE 82
            T+K  TVG LS+ VID SS            +  AG+SVKV    A+RKP +RAKVPFE
Sbjct: 61  STSKEATVGSLSFKVIDTSSPKKSNELSRQAATKDAGSSVKVPQKSATRKPVARAKVPFE 120

Query: 83  KGYSQVDWLRLTQTHPDLAGLKGQSNKRLITMDEVKQHQSEGSMWTVLKGRVYNLSPYMK 142
           KGYSQ+DWL+LTQTHPDLAGL GQSNKRLI+M+EVKQH+ EGSMWTVLKGRVYNLSPYMK
Sbjct: 121 KGYSQMDWLKLTQTHPDLAGLNGQSNKRLISMNEVKQHRMEGSMWTVLKGRVYNLSPYMK 180

Query: 143 FHPGGVDMLMKAVGKDCTALFNKYHAWVNAEFLLEKCLVGTLDDSR 188
           FHPGGVDMLMKAVGKDCT+LFNKYHAWVNAEFLLEKCLVGTLDDS+
Sbjct: 181 FHPGGVDMLMKAVGKDCTSLFNKYHAWVNAEFLLEKCLVGTLDDSQ 226

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224055123|ref|XP_002298420.1| predicted protein [Populus trichocarpa] gi|222845678|gb|EEE83225.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359487399|ref|XP_002273562.2| PREDICTED: uncharacterized protein LOC100261983 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356531661|ref|XP_003534395.1| PREDICTED: cytochrome b5 reductase 4-like [Glycine max] Back     alignment and taxonomy information
>gi|356542758|ref|XP_003539832.1| PREDICTED: cytochrome b5 reductase 4-like [Glycine max] Back     alignment and taxonomy information
>gi|255553510|ref|XP_002517796.1| flavohemoprotein B5/b5r, putative [Ricinus communis] gi|223543068|gb|EEF44603.1| flavohemoprotein B5/b5r, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|255645479|gb|ACU23235.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|255637223|gb|ACU18942.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|449436319|ref|XP_004135940.1| PREDICTED: cytochrome b5 reductase 4-like [Cucumis sativus] gi|449514884|ref|XP_004164506.1| PREDICTED: cytochrome b5 reductase 4-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|297811065|ref|XP_002873416.1| cytochrome b5 domain-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297319253|gb|EFH49675.1| cytochrome b5 domain-containing protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query191
TAIR|locus:2144811211 RLF "reduced lateral root form 0.989 0.895 0.597 7.1e-61
MGI|MGI:2386848 528 Cyb5r4 "cytochrome b5 reductas 0.659 0.238 0.442 1.6e-26
RGD|621834 520 Cyb5r4 "cytochrome b5 reductas 0.659 0.242 0.442 2.4e-26
UNIPROTKB|Q68EJ0 520 Cyb5r4 "Cytochrome b5 reductas 0.659 0.242 0.442 2.4e-26
UNIPROTKB|Q7L1T6 521 CYB5R4 "Cytochrome b5 reductas 0.659 0.241 0.442 2.4e-26
UNIPROTKB|I3LV78 264 LOC100622980 "Uncharacterized 0.743 0.537 0.402 2.5e-26
UNIPROTKB|F1MB85 520 CYB5R4 "Cytochrome b5 reductas 0.664 0.244 0.447 3.1e-26
UNIPROTKB|Q32LH7 520 CYB5R4 "Cytochrome b5 reductas 0.664 0.244 0.447 3.1e-26
ZFIN|ZDB-GENE-050522-225 527 cyb5r4 "cytochrome b5 reductas 0.659 0.239 0.458 3.3e-26
UNIPROTKB|E2R102 519 CYB5R4 "Uncharacterized protei 0.659 0.242 0.435 4e-26
TAIR|locus:2144811 RLF "reduced lateral root formation" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 623 (224.4 bits), Expect = 7.1e-61, P = 7.1e-61
 Identities = 123/206 (59%), Positives = 154/206 (74%)

Query:     2 NNDNDFTFCKVE------KNQSSDA------DGSVENQSSGFLWKQDELPSKTNKTVGFL 49
             + D+DFTF KV       K+ +SD       DG  + +S+G +WK   LP K  +T+G L
Sbjct:     4 SRDDDFTFSKVSPPDSEVKDLASDVGSITLKDGLDQQKSNGLIWKDKSLPPK-EETIGSL 62

Query:    50 SYNVIDASSS----SAAGTSVKVASRKPASRAKVPFEKGYSQVDWLRLTQTHPDLAGLKG 105
             S+ V D+SSS    + +  + K  +RKP +R KVPFEKGYSQ+DWL+LT+THPDLAGLKG
Sbjct:    63 SFTVTDSSSSKKQSNESSETFKTPARKPITRTKVPFEKGYSQMDWLKLTRTHPDLAGLKG 122

Query:   106 QSNKRLITMDEVKQHQSEGSMWTVLKGRVYNLSPYMKFHPGGVDMLMKAVGKDCTALFNK 165
             +SNKRLI MDEVK+H++  SMWTVLKGRVYN+SPYM FHPGGVDMLMKAVG+D T LFNK
Sbjct:   123 ESNKRLIPMDEVKKHRTGDSMWTVLKGRVYNISPYMNFHPGGVDMLMKAVGRDGTLLFNK 182

Query:   166 YHAWVNAEFLLEKCLVGTLDDSRPRQ 191
             YHAWVN + LLEKCLVG LDD++ ++
Sbjct:   183 YHAWVNVDILLEKCLVGVLDDTKVKK 208
GO:0005634 "nucleus" evidence=ISM
GO:0020037 "heme binding" evidence=IEA
GO:0005829 "cytosol" evidence=IDA
GO:0010311 "lateral root formation" evidence=IMP
MGI|MGI:2386848 Cyb5r4 "cytochrome b5 reductase 4" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|621834 Cyb5r4 "cytochrome b5 reductase 4" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q68EJ0 Cyb5r4 "Cytochrome b5 reductase 4" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q7L1T6 CYB5R4 "Cytochrome b5 reductase 4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|I3LV78 LOC100622980 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1MB85 CYB5R4 "Cytochrome b5 reductase 4" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q32LH7 CYB5R4 "Cytochrome b5 reductase 4" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050522-225 cyb5r4 "cytochrome b5 reductase 4" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E2R102 CYB5R4 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
grail3.0053005601
hypothetical protein (229 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query191
pfam0017374 pfam00173, Cyt-b5, Cytochrome b5-like Heme/Steroid 2e-27
COG5274164 COG5274, CYB5, Cytochrome b involved in lipid meta 8e-18
PLN02252 888 PLN02252, PLN02252, nitrate reductase [NADPH] 1e-16
PLN03199 485 PLN03199, PLN03199, delta6-acyl-lipid desaturase-l 8e-06
PLN03198 526 PLN03198, PLN03198, delta6-acyl-lipid desaturase; 1e-05
>gnl|CDD|201057 pfam00173, Cyt-b5, Cytochrome b5-like Heme/Steroid binding domain Back     alignment and domain information 
 Score = 98.0 bits (245), Expect = 2e-27
 Identities = 33/75 (44%), Positives = 49/75 (65%), Gaps = 2/75 (2%)

Query: 112 ITMDEVKQHQSEGSMWTVLKGRVYNLSPYMKFHPGGVDMLMKAVGKDCTALF-NKYHAWV 170
            T++EVK+H  +G  W V+ G+VY+++ ++K HPGG D+++ A GKD T  F +  H+  
Sbjct: 1   FTLEEVKKHNKDGDCWIVINGKVYDVTRFLKDHPGGEDVILSAAGKDATEAFEDAIHSE- 59

Query: 171 NAEFLLEKCLVGTLD 185
            A  LLEK  VG LD
Sbjct: 60  AARKLLEKYRVGELD 74

This family includes heme binding domains from a diverse range of proteins. This family also includes proteins that bind to steroids. The family includes progesterone receptors. Many members of this subfamily are membrane anchored by an N-terminal transmembrane alpha helix. This family also includes a domain in some chitin synthases. There is no known ligand for this domain in the chitin synthases. Length = 74
>gnl|CDD|227599 COG5274, CYB5, Cytochrome b involved in lipid metabolism [Energy production and conversion / Lipid metabolism] Back     alignment and domain information
>gnl|CDD|215141 PLN02252, PLN02252, nitrate reductase [NADPH] Back     alignment and domain information
>gnl|CDD|178740 PLN03199, PLN03199, delta6-acyl-lipid desaturase-like protein; Provisional Back     alignment and domain information
>gnl|CDD|178739 PLN03198, PLN03198, delta6-acyl-lipid desaturase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 191
KOG0536145 consensus Flavohemoprotein b5+b5R [Energy producti 100.0
KOG0537124 consensus Cytochrome b5 [Energy production and con 99.94
PF0017376 Cyt-b5: Cytochrome b5-like Heme/Steroid binding do 99.88
COG5274164 CYB5 Cytochrome b involved in lipid metabolism [En 99.86
PLN02252 888 nitrate reductase [NADPH] 99.78
PLN03199 485 delta6-acyl-lipid desaturase-like protein; Provisi 99.77
PLN03198 526 delta6-acyl-lipid desaturase; Provisional 99.77
KOG4232 430 consensus Delta 6-fatty acid desaturase/delta-8 sp 99.51
KOG4576167 consensus Sulfite oxidase, heme-binding component 99.41
COG489281 Predicted heme/steroid binding protein [General fu 98.7
KOG1110183 consensus Putative steroid membrane receptor Hpr6. 97.59
KOG1108 281 consensus Predicted heme/steroid binding protein [ 96.01
PF1490194 Jiv90: Cleavage inducing molecular chaperone 84.06
>KOG0536 consensus Flavohemoprotein b5+b5R [Energy production and conversion] Back     alignment and domain information 
Probab=100.00  E-value=4.3e-38  Score=248.71  Aligned_cols=108  Identities=52%  Similarity=0.960  Sum_probs=103.2

Q ss_pred             CccccccccccchHHhHhhcCCCcccCCCCCCCCcccCHHHHhhhcCCCCeEEEEcCeEeeccccccccccchhhhhhcc
Q 029559           76 RAKVPFEKGYSQVDWLRLTQTHPDLAGLKGQSNKRLITMDEVKQHQSEGSMWTVLKGRVYNLSPYMKFHPGGVDMLMKAV  155 (191)
Q Consensus        76 r~kv~l~pG~s~mdw~~L~~~~~~l~~~~~~~~~~~it~~Ev~~H~~~~d~WvvI~GkVYDVT~fl~~HPGG~~iL~~~a  155 (191)
                      |.|++|+||+++|||.+|+.+.+++.+..   ....+|.+||++|++.+||||+|+|+|||||+||++||||.+.|++++
T Consensus        37 R~K~~l~PG~s~mdW~rL~~s~~~lag~~---~~i~vt~~El~KH~~~dDcW~~i~G~VYnVt~Yl~fHPgG~d~lmk~a  113 (145)
T KOG0536|consen   37 RTKVALAPGHSQMDWSRLTASGKNLAGVE---SPIPVTAEELKKHNKKDDCWIAIRGKVYNVTAYLDFHPGGVDELMKHA  113 (145)
T ss_pred             cceeecCCCcchhhHHHHhccCccccccc---CCCccCHHHHHhhCCccceEEEEcCEEEecccccccCCCCHHHHHHhc
Confidence            89999999999999999999999998774   345799999999999999999999999999999999999999999999


Q ss_pred             CCchhHHHHhcCChHHHHHHhhhCeeeeecC
Q 029559          156 GKDCTALFNKYHAWVNAEFLLEKCLVGTLDD  186 (191)
Q Consensus       156 GkDaT~~F~~~H~~~na~~lL~~~~VG~l~~  186 (191)
                      |+|+|.+|++||.|+|.+.||+.|+||.|.+
T Consensus       114 GrD~T~~Fnk~H~WVN~e~LL~~c~VGvl~d  144 (145)
T KOG0536|consen  114 GRDATKLFNKYHAWVNYEELLKKCFVGVLVD  144 (145)
T ss_pred             CcchHHHHHHHHHHhcHHHHHhhceeeeecc
Confidence            9999999999999999999999999999864

>KOG0537 consensus Cytochrome b5 [Energy production and conversion] Back     alignment and domain information
>PF00173 Cyt-b5: Cytochrome b5-like Heme/Steroid binding domain This prints entry is a subset of the Pfam entry; InterPro: IPR001199 Cytochromes b5 are ubiquitous electron transport proteins found in animals, plants and yeasts [] Back     alignment and domain information
>COG5274 CYB5 Cytochrome b involved in lipid metabolism [Energy production and conversion / Lipid metabolism] Back     alignment and domain information
>PLN02252 nitrate reductase [NADPH] Back     alignment and domain information
>PLN03199 delta6-acyl-lipid desaturase-like protein; Provisional Back     alignment and domain information
>PLN03198 delta6-acyl-lipid desaturase; Provisional Back     alignment and domain information
>KOG4232 consensus Delta 6-fatty acid desaturase/delta-8 sphingolipid desaturase [Lipid transport and metabolism] Back     alignment and domain information
>KOG4576 consensus Sulfite oxidase, heme-binding component [Energy production and conversion] Back     alignment and domain information
>COG4892 Predicted heme/steroid binding protein [General function prediction only] Back     alignment and domain information
>KOG1110 consensus Putative steroid membrane receptor Hpr6 Back     alignment and domain information
>KOG1108 consensus Predicted heme/steroid binding protein [General function prediction only] Back     alignment and domain information
>PF14901 Jiv90: Cleavage inducing molecular chaperone Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query191
3lf5_A88 Structure Of Human Nadh Cytochrome B5 Oxidoreductas 3e-18
3ks0_A95 Crystal Structure Of The Heme Domain Of Flavocytoch 5e-09
1szf_A 511 A198g:l230a Mutant Flavocytochrome B2 With Pyruvate 7e-09
1ldc_A 511 X-Ray Structure Of Two Complexes Of The Y143f Flavo 7e-09
2oz0_A 511 Mechanistic And Structural Studies Of H373q Flavocy 7e-09
1fcb_A 511 Molecular Structure Of Flavocytochrome B2 At 2.4 An 7e-09
1ltd_A 506 The 2.6 Angstroms Refined Structure Of The Escheric 7e-09
1sze_A 511 L230a Mutant Flavocytochrome B2 With Benzoylformate 7e-09
1ib7_A94 Solution Structure Of F35y Mutant Of Rat Ferro Cyto 3e-08
1i87_A98 Solution Structure Of The Water-Soluble Fragment Of 4e-08
2i96_A108 Solution Structure Of The Oxidized Microsomal Human 5e-08
2m33_A104 Solution Nmr Structure Of Full-length Oxidized Micr 6e-08
1bfx_A99 The Solution Nmr Structure Of The B Form Of Oxidize 6e-08
1cxy_A90 Structure And Characterization Of Ectothiorhodospir 9e-08
2i89_A93 Structure Of Septuple Mutant Of Rat Outer Mitochond 9e-08
1aqa_A94 Solution Structure Of Reduced Microsomal Rat Cytoch 1e-07
1blv_A94 Solution Structure Of Oxidized Rat Microsomal Cytoc 1e-07
1m20_A82 Crystal Structure Of F35y Mutant Of Trypsin-Solubil 2e-07
1do9_A94 Solution Structure Of Oxidized Microsomal Rabbit Cy 2e-07
1es1_A82 Crystal Structure Of Val61his Mutant Of Trypsin-Sol 2e-07
1j0q_A82 Solution Structure Of Oxidized Bovine Microsomal Cy 2e-07
1hko_A104 Nmr Structure Of Bovine Cytochrome B5 Length = 104 2e-07
1cyo_A93 Bovine Cytochrome B(5) Length = 93 2e-07
1i5u_A82 Solution Structure Of Cytochrome B5 Triple Mutant ( 3e-07
1m2i_A82 Crystal Structure Of E44aE56A MUTANT OF CYTOCHROME 3e-07
1jex_A94 Solution Structure Of A67v Mutant Of Rat Ferro Cyto 4e-07
3ozz_B82 Structure Of A Cytochrome B5 Core-Swap Mutant Lengt 5e-07
1ehb_A82 Crystal Structure Of Recombinant Trypsin-Solubilize 5e-07
1m2m_A82 Crystal Structure Of E44aE48AE56AD60A MUTANT OF Cyt 6e-07
1awp_A92 Rat Outer Mitochondrial Membrane Cytochrome B5 Leng 7e-07
1f03_A82 Solution Structure Of Oxidized Bovine Microsomal Cy 7e-07
1lr6_A82 Crystal Structure Of V45y Mutant Of Cytochrome B5 L 7e-07
1sh4_A82 Solution Structure Of Oxidized Bovine Microsomal Cy 8e-07
1lqx_A82 Crystal Structure Of V45e Mutant Of Cytochrome B5 L 9e-07
1u9u_A82 Crystal Structure Of F58y Mutant Of Cytochrome B5 L 1e-06
3ner_A92 Structure Of Human Type B Cytochrome B5 Length = 92 1e-06
1icc_A87 Rat Outer Mitochondrial Membrane Cytochrome B5 Leng 2e-06
1eue_A86 Rat Outer Mitochondrial Membrane Cytochrome B5 Leng 2e-06
1u9m_A82 Crystal Structure Of F58w Mutant Of Cytochrome B5 L 3e-06
3mus_A87 2a Resolution Structure Of Rat Type B Cytochrome B5 3e-06
1b5m_A84 Rat Outer Mitochondrial Membrane Cytochrome B5 Leng 3e-06
1lj0_A92 Structure Of Quintuple Mutant Of The Rat Outer Mito 4e-06
1m59_A82 Crystal Structure Of P40v Mutant Of Trypsin-Solubil 8e-06
2ibj_A88 Structure Of House Fly Cytochrome B5 Length = 88 2e-05
1x3x_A82 Crystal Structure Of Cytochrome B5 From Ascaris Suu 9e-05
1mj4_A82 Crystal Structure Analysis Of The Cytochrome B5 Dom 9e-04
>pdb|3LF5|A Chain A, Structure Of Human Nadh Cytochrome B5 Oxidoreductase (Ncb5or) B5 Domain To 1.25a Resolution Length = 88 Back     alignment and structure 
Iteration: 1

 Score = 87.8 bits (216), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 53/73 (72%)
Query: 112 ITMDEVKQHQSEGSMWTVLKGRVYNLSPYMKFHPGGVDMLMKAVGKDCTALFNKYHAWVN 171
           +T +E+K+H  +   W  ++G VYN+SPYM++HPGG D LM+A G D T LF++ H WVN
Sbjct: 8   VTEEELKKHNKKDDCWICIRGFVYNVSPYMEYHPGGEDELMRAAGSDGTELFDQVHRWVN 67
Query: 172 AEFLLEKCLVGTL 184
            E +L++CLVG +
Sbjct: 68  YESMLKECLVGRM 80
>pdb|3KS0|A Chain A, Crystal Structure Of The Heme Domain Of Flavocytochrome B2 In Complex With Fab B2b4 Length = 95 Back     alignment and structure
>pdb|1SZF|A Chain A, A198g:l230a Mutant Flavocytochrome B2 With Pyruvate Bound Length = 511 Back     alignment and structure
>pdb|1LDC|A Chain A, X-Ray Structure Of Two Complexes Of The Y143f Flavocytochrome B2 Mutant Crystallized In The Presence Of Lactate Or Phenyl-Lactate Length = 511 Back     alignment and structure
>pdb|2OZ0|A Chain A, Mechanistic And Structural Studies Of H373q Flavocytochrome B2: Effects Of Mutating The Active Site Base Length = 511 Back     alignment and structure
>pdb|1FCB|A Chain A, Molecular Structure Of Flavocytochrome B2 At 2.4 Angstroms Resolution Length = 511 Back     alignment and structure
>pdb|1LTD|A Chain A, The 2.6 Angstroms Refined Structure Of The Escherichia Coli Recombinant Saccharomyces Cerevisiae Flavocytochrome B2-Sulphite Complex Length = 506 Back     alignment and structure
>pdb|1SZE|A Chain A, L230a Mutant Flavocytochrome B2 With Benzoylformate Length = 511 Back     alignment and structure
>pdb|1I87|A Chain A, Solution Structure Of The Water-Soluble Fragment Of Rat Hepatic Apocytochrome B5 Length = 98 Back     alignment and structure
>pdb|2I96|A Chain A, Solution Structure Of The Oxidized Microsomal Human Cytochrome B5 Length = 108 Back     alignment and structure
>pdb|2M33|A Chain A, Solution Nmr Structure Of Full-length Oxidized Microsomal Rabbit Cytochrome B5 Length = 104 Back     alignment and structure
>pdb|1BFX|A Chain A, The Solution Nmr Structure Of The B Form Of Oxidized Rat Microsomal Cytochrome B5, Minimized Average Structure Length = 99 Back     alignment and structure
>pdb|1CXY|A Chain A, Structure And Characterization Of Ectothiorhodospira Vacuolata Cytochrome B558, A Prokaryotic Homologue Of Cytochrome B5 Length = 90 Back     alignment and structure
>pdb|2I89|A Chain A, Structure Of Septuple Mutant Of Rat Outer Mitochondrial Membrane Cytochrome B5 Length = 93 Back     alignment and structure
>pdb|1AQA|A Chain A, Solution Structure Of Reduced Microsomal Rat Cytochrome B5, Nmr, Minimized Average Structure Length = 94 Back     alignment and structure
>pdb|1BLV|A Chain A, Solution Structure Of Oxidized Rat Microsomal Cytochrome B5 In The Presence Of 2 M Guanidinium Chloride: Monitoring The Early Steps In Protein Unfolding Length = 94 Back     alignment and structure
>pdb|1M20|A Chain A, Crystal Structure Of F35y Mutant Of Trypsin-Solubilized Fragment Of Cytochrome B5 Length = 82 Back     alignment and structure
>pdb|1DO9|A Chain A, Solution Structure Of Oxidized Microsomal Rabbit Cytochrome B5. Factors Determining The Heterogeneous Binding Of The Heme Length = 94 Back     alignment and structure
>pdb|1ES1|A Chain A, Crystal Structure Of Val61his Mutant Of Trypsin-Solubilized Fragment Of Cytochrome B5 Length = 82 Back     alignment and structure
>pdb|1J0Q|A Chain A, Solution Structure Of Oxidized Bovine Microsomal Cytochrome B5 Mutant V61h Length = 82 Back     alignment and structure
>pdb|1HKO|A Chain A, Nmr Structure Of Bovine Cytochrome B5 Length = 104 Back     alignment and structure
>pdb|1CYO|A Chain A, Bovine Cytochrome B(5) Length = 93 Back     alignment and structure
>pdb|1I5U|A Chain A, Solution Structure Of Cytochrome B5 Triple Mutant (E48aE56AD60A) Length = 82 Back     alignment and structure
>pdb|1M2I|A Chain A, Crystal Structure Of E44aE56A MUTANT OF CYTOCHROME B5 Length = 82 Back     alignment and structure
>pdb|1JEX|A Chain A, Solution Structure Of A67v Mutant Of Rat Ferro Cytochrome B5 Length = 94 Back     alignment and structure
>pdb|3OZZ|B Chain B, Structure Of A Cytochrome B5 Core-Swap Mutant Length = 82 Back     alignment and structure
>pdb|1EHB|A Chain A, Crystal Structure Of Recombinant Trypsin-Solubilized Fragment Of Cytochrome B5 Length = 82 Back     alignment and structure
>pdb|1M2M|A Chain A, Crystal Structure Of E44aE48AE56AD60A MUTANT OF Cytochrome B5 Length = 82 Back     alignment and structure
>pdb|1AWP|A Chain A, Rat Outer Mitochondrial Membrane Cytochrome B5 Length = 92 Back     alignment and structure
>pdb|1F03|A Chain A, Solution Structure Of Oxidized Bovine Microsomal Cytochrome B5 Mutant (E44a, E48a, E56a, D60a) And Its Interaction With Cytochrome C Length = 82 Back     alignment and structure
>pdb|1LR6|A Chain A, Crystal Structure Of V45y Mutant Of Cytochrome B5 Length = 82 Back     alignment and structure
>pdb|1SH4|A Chain A, Solution Structure Of Oxidized Bovine Microsomal Cytochrome B5 Mutant V45h Length = 82 Back     alignment and structure
>pdb|1LQX|A Chain A, Crystal Structure Of V45e Mutant Of Cytochrome B5 Length = 82 Back     alignment and structure
>pdb|1U9U|A Chain A, Crystal Structure Of F58y Mutant Of Cytochrome B5 Length = 82 Back     alignment and structure
>pdb|3NER|A Chain A, Structure Of Human Type B Cytochrome B5 Length = 92 Back     alignment and structure
>pdb|1ICC|A Chain A, Rat Outer Mitochondrial Membrane Cytochrome B5 Length = 87 Back     alignment and structure
>pdb|1EUE|A Chain A, Rat Outer Mitochondrial Membrane Cytochrome B5 Length = 86 Back     alignment and structure
>pdb|1U9M|A Chain A, Crystal Structure Of F58w Mutant Of Cytochrome B5 Length = 82 Back     alignment and structure
>pdb|3MUS|A Chain A, 2a Resolution Structure Of Rat Type B Cytochrome B5 Length = 87 Back     alignment and structure
>pdb|1B5M|A Chain A, Rat Outer Mitochondrial Membrane Cytochrome B5 Length = 84 Back     alignment and structure
>pdb|1LJ0|A Chain A, Structure Of Quintuple Mutant Of The Rat Outer Mitocondrial Cytochrome B5. Length = 92 Back     alignment and structure
>pdb|1M59|A Chain A, Crystal Structure Of P40v Mutant Of Trypsin-Solubilized Fragment Of Cytochrome B5 Length = 82 Back     alignment and structure
>pdb|2IBJ|A Chain A, Structure Of House Fly Cytochrome B5 Length = 88 Back     alignment and structure
>pdb|1X3X|A Chain A, Crystal Structure Of Cytochrome B5 From Ascaris Suum Length = 82 Back     alignment and structure
>pdb|1MJ4|A Chain A, Crystal Structure Analysis Of The Cytochrome B5 Domain Of Human Sulfite Oxidase Length = 82 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query191
3lf5_A88 Cytochrome B5 reductase 4; NCB5OR, electron transf 9e-37
3ner_A92 Cytochrome B5 type B; heme, electron transport; HE 4e-32
1cyo_A93 Cytochrome B5; electron transport; HET: HEM; 1.50A 2e-30
2keo_A112 Probable E3 ubiquitin-protein ligase HERC2; protei 2e-30
2ibj_A88 Cytochrome B5, CYTB5; FLY cytochrome B5, X-RAY dif 3e-30
1hko_A104 Cytochrome B5; electron transfer protein, heme, el 5e-30
1cxy_A90 Cytochrome B5; helix, beta-strand, electron transp 3e-27
1x3x_A82 Cytochrome B5; hemoprotein, porcine parasitic nama 3e-25
1mj4_A82 Sulfite oxidase; cytochrome B5, heme, oxidoreducta 6e-23
1kbi_A 511 Cytochrome B2, L-LCR; flavocytochrome B2, electron 8e-17
1sox_A 466 Sulfite oxidase; oxidoreductase, sulfite oxidation 9e-09
>3lf5_A Cytochrome B5 reductase 4; NCB5OR, electron transfer, redox, heme, endoplasmic reticulu flavoprotein, iron, metal-binding, NAD, oxidoreductase; HET: HEM; 1.25A {Homo sapiens} Length = 88 Back     alignment and structure
 Score =  121 bits (307), Expect = 9e-37
 Identities = 36/84 (42%), Positives = 54/84 (64%)

Query: 106 QSNKRLITMDEVKQHQSEGSMWTVLKGRVYNLSPYMKFHPGGVDMLMKAVGKDCTALFNK 165
           +     +T +E+K+H  +   W  ++G VYN+SPYM++HPGG D LM+A G D T LF++
Sbjct: 2   KGRLIEVTEEELKKHNKKDDCWICIRGFVYNVSPYMEYHPGGEDELMRAAGSDGTELFDQ 61

Query: 166 YHAWVNAEFLLEKCLVGTLDDSRP 189
            H WVN E +L++CLVG +     
Sbjct: 62  VHRWVNYESMLKECLVGRMAIKPA 85
>3ner_A Cytochrome B5 type B; heme, electron transport; HET: HEM; 1.45A {Homo sapiens} PDB: 1awp_A* 3mus_A* 1b5m_A* 1eue_A* 1icc_A* 1lj0_A* 2i89_A* Length = 92 Back     alignment and structure
>1cyo_A Cytochrome B5; electron transport; HET: HEM; 1.50A {Bos taurus} SCOP: d.120.1.1 PDB: 1bfx_A* 1i87_A 1i8c_A 1iet_A 1ieu_A 1do9_A* 1aqa_A* 1aw3_A* 1axx_A* 1b5a_A* 1b5b_A* 1blv_A* 1mny_A* 2axx_A* 1ib7_A* 1jex_A* 1ehb_A* 1nx7_A* 1u9u_A* 1m20_A* ... Length = 93 Back     alignment and structure
>2keo_A Probable E3 ubiquitin-protein ligase HERC2; protein of unknown function, HERC2 cytochrome domain, ligase binding, phosphoprotein; NMR {Homo sapiens} Length = 112 Back     alignment and structure
>2ibj_A Cytochrome B5, CYTB5; FLY cytochrome B5, X-RAY diffraction, heme, electron transport; HET: HEM; 1.55A {Musca domestica} Length = 88 Back     alignment and structure
>1hko_A Cytochrome B5; electron transfer protein, heme, electron transport; HET: HEM; NMR {Bos taurus} SCOP: d.120.1.1 PDB: 2i96_A* Length = 104 Back     alignment and structure
>1cxy_A Cytochrome B5; helix, beta-strand, electron transport; HET: HEM; 1.65A {Ectothiorhodospira shaposhnikovii} SCOP: d.120.1.1 Length = 90 Back     alignment and structure
>1x3x_A Cytochrome B5; hemoprotein, porcine parasitic namatode, electron transport; HET: HEM; 1.80A {Ascaris suum} Length = 82 Back     alignment and structure
>1mj4_A Sulfite oxidase; cytochrome B5, heme, oxidoreductase; HET: HEM; 1.20A {Homo sapiens} SCOP: d.120.1.1 Length = 82 Back     alignment and structure
>1kbi_A Cytochrome B2, L-LCR; flavocytochrome B2, electron transfer, oxidoreductase; HET: HEM FMN; 2.30A {Saccharomyces cerevisiae} SCOP: c.1.4.1 d.120.1.1 PDB: 1fcb_A* 1lco_A* 1ldc_A* 1sze_A* 2oz0_A* 1szf_A* 1szg_A* 1ltd_A* 1kbj_A* 1qcw_A* 3ks0_A* Length = 511 Back     alignment and structure
>1sox_A Sulfite oxidase; oxidoreductase, sulfite oxidation; HET: MTE HEM EPE; 1.90A {Gallus gallus} SCOP: b.1.18.6 d.120.1.1 d.176.1.1 PDB: 3hc2_A* 3hbq_A* 3hbg_A* 3hbp_A* 3r18_A* 3r19_A* Length = 466 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query191
3ner_A92 Cytochrome B5 type B; heme, electron transport; HE 99.94
3lf5_A88 Cytochrome B5 reductase 4; NCB5OR, electron transf 99.94
1cyo_A93 Cytochrome B5; electron transport; HET: HEM; 1.50A 99.94
2ibj_A88 Cytochrome B5, CYTB5; FLY cytochrome B5, X-RAY dif 99.94
1hko_A104 Cytochrome B5; electron transfer protein, heme, el 99.94
1x3x_A82 Cytochrome B5; hemoprotein, porcine parasitic nama 99.93
1cxy_A90 Cytochrome B5; helix, beta-strand, electron transp 99.93
1mj4_A82 Sulfite oxidase; cytochrome B5, heme, oxidoreducta 99.92
2keo_A112 Probable E3 ubiquitin-protein ligase HERC2; protei 99.91
1kbi_A 511 Cytochrome B2, L-LCR; flavocytochrome B2, electron 99.83
1sox_A 466 Sulfite oxidase; oxidoreductase, sulfite oxidation 99.82
1j03_A102 Putative steroid binding protein; alpha and beta, 99.65
>3ner_A Cytochrome B5 type B; heme, electron transport; HET: HEM; 1.45A {Homo sapiens} SCOP: d.120.1.1 PDB: 1awp_A* 3mus_A* 1b5m_A* 1eue_A* 1icc_A* 1lj0_A* 2i89_A* Back     alignment and structure
Probab=99.94  E-value=5.8e-28  Score=179.27  Aligned_cols=84  Identities=25%  Similarity=0.550  Sum_probs=78.8

Q ss_pred             CCCCcccCHHHHhhhcCCCCeEEEEcCeEeeccccccccccchhhhhhccCCchhHHHHhcCChHHHHHHhhhCeeeeec
Q 029559          106 QSNKRLITMDEVKQHQSEGSMWTVLKGRVYNLSPYMKFHPGGVDMLMKAVGKDCTALFNKYHAWVNAEFLLEKCLVGTLD  185 (191)
Q Consensus       106 ~~~~~~it~~Ev~~H~~~~d~WvvI~GkVYDVT~fl~~HPGG~~iL~~~aGkDaT~~F~~~H~~~na~~lL~~~~VG~l~  185 (191)
                      .+.++.||++||++|+++++|||+|+|+|||||+|+..||||..+|+.++|+|+|++|+.++|+.+++++|++|+||+|.
T Consensus         6 ~~~~~~~t~~Ev~~h~~~~~~wv~i~g~VYDvT~f~~~HPGG~~~l~~~aG~DaT~~F~~~~Hs~~a~~~L~~~~IG~l~   85 (92)
T 3ner_A            6 ETSVTYYRLEEVAKRNSLKELWLVIHGRVYDVTRFLNEHPGGEEVLLEQAGVDASESFEDVGHSSDAREMLKQYYIGDIH   85 (92)
T ss_dssp             CCCSCEECHHHHTTCEETTEEEEEETTEEEECGGGTTTCTTCSHHHHTTTTSBCHHHHHHTTCCHHHHHHHGGGEEEEEC
T ss_pred             CCCCCeeCHHHHHhhCCCCCEEEEECCEEEEcccccccCCCHHHHHHHhcCCcchHHHHHcCCCHHHHHHHHhCeeEEEC
Confidence            35678999999999999999999999999999999999999999999999999999999988888899999999999998


Q ss_pred             CCCC
Q 029559          186 DSRP  189 (191)
Q Consensus       186 ~~~~  189 (191)
                      +++.
T Consensus        86 ~~~~   89 (92)
T 3ner_A           86 PSDL   89 (92)
T ss_dssp             GGGS
T ss_pred             hHhc
Confidence            7654
>3lf5_A Cytochrome B5 reductase 4; NCB5OR, electron transfer, redox, heme, endoplasmic reticulu flavoprotein, iron, metal-binding, NAD, oxidoreductase; HET: HEM; 1.25A {Homo sapiens} Back     alignment and structure
>1cyo_A Cytochrome B5; electron transport; HET: HEM; 1.50A {Bos taurus} SCOP: d.120.1.1 PDB: 1bfx_A* 1i87_A 1i8c_A 1iet_A 1ieu_A 1do9_A* 1aqa_A* 1aw3_A* 1axx_A* 1b5a_A* 1b5b_A* 1blv_A* 1mny_A* 2axx_A* 1ib7_A* 1jex_A* 1ehb_A* 1nx7_A* 1u9u_A* 1m20_A* ... Back     alignment and structure
>2ibj_A Cytochrome B5, CYTB5; FLY cytochrome B5, X-RAY diffraction, heme, electron transport; HET: HEM; 1.55A {Musca domestica} Back     alignment and structure
>1hko_A Cytochrome B5; electron transfer protein, heme, electron transport; HET: HEM; NMR {Bos taurus} SCOP: d.120.1.1 PDB: 2i96_A* Back     alignment and structure
>1x3x_A Cytochrome B5; hemoprotein, porcine parasitic namatode, electron transport; HET: HEM; 1.80A {Ascaris suum} Back     alignment and structure
>1cxy_A Cytochrome B5; helix, beta-strand, electron transport; HET: HEM; 1.65A {Ectothiorhodospira shaposhnikovii} SCOP: d.120.1.1 Back     alignment and structure
>1mj4_A Sulfite oxidase; cytochrome B5, heme, oxidoreductase; HET: HEM; 1.20A {Homo sapiens} SCOP: d.120.1.1 Back     alignment and structure
>2keo_A Probable E3 ubiquitin-protein ligase HERC2; protein of unknown function, HERC2 cytochrome domain, ligase binding, phosphoprotein; NMR {Homo sapiens} Back     alignment and structure
>1kbi_A Cytochrome B2, L-LCR; flavocytochrome B2, electron transfer, oxidoreductase; HET: HEM FMN; 2.30A {Saccharomyces cerevisiae} SCOP: c.1.4.1 d.120.1.1 PDB: 1fcb_A* 1lco_A* 1ldc_A* 1sze_A* 2oz0_A* 1szf_A* 1szg_A* 1ltd_A* 1kbj_A* 1qcw_A* 3ks0_A* Back     alignment and structure
>1sox_A Sulfite oxidase; oxidoreductase, sulfite oxidation; HET: MTE HEM EPE; 1.90A {Gallus gallus} SCOP: b.1.18.6 d.120.1.1 d.176.1.1 PDB: 3hc2_A* 3hbq_A* 3hbg_A* 3hbp_A* 3r18_A* 3r19_A* Back     alignment and structure
>1j03_A Putative steroid binding protein; alpha and beta, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: d.120.1.2 PDB: 1t0g_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 191
d1kbia297 d.120.1.1 (A:1-97) Flavocytochrome b2, N-terminal 4e-28
d1cyoa_88 d.120.1.1 (A:) Cytochrome b5 {Cow (Bos taurus) [Ta 1e-25
d1euea_86 d.120.1.1 (A:) Cytochrome b5 {Rat (Rattus norvegic 3e-25
d1cxya_81 d.120.1.1 (A:) Cytochrome b558 {Ectothiorhodospira 3e-24
d1soxa291 d.120.1.1 (A:3-93) Sulfite oxidase, N-terminal dom 1e-22
d1mj4a_80 d.120.1.1 (A:) Sulfite oxidase, N-terminal domain 3e-22
>d1kbia2 d.120.1.1 (A:1-97) Flavocytochrome b2, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 97 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Cytochrome b5-like heme/steroid binding domain
superfamily: Cytochrome b5-like heme/steroid binding domain
family: Cytochrome b5
domain: Flavocytochrome b2, N-terminal domain
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

 Score = 99.2 bits (247), Expect = 4e-28
 Identities = 31/87 (35%), Positives = 47/87 (54%), Gaps = 1/87 (1%)

Query: 104 KGQSNKRLITMDEVKQHQSEGSMWTVLKGRVYNLSPYMKFHPGGVDMLMKAVGKDCTALF 163
           K   NK+ I+  EV +H      W V+ G VY+L+ ++  HPGG D++    GKD TA+F
Sbjct: 3   KLDMNKQKISPAEVAKHNKPDDCWVVINGYVYDLTRFLPNHPGGQDVIKFNAGKDVTAIF 62

Query: 164 NKYHAW-VNAEFLLEKCLVGTLDDSRP 189
              HA  V  +++  +  +G L  S P
Sbjct: 63  EPLHAPNVIDKYIAPEKKLGPLQGSMP 89
>d1cyoa_ d.120.1.1 (A:) Cytochrome b5 {Cow (Bos taurus) [TaxId: 9913]} Length = 88 Back     information, alignment and structure
>d1euea_ d.120.1.1 (A:) Cytochrome b5 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 86 Back     information, alignment and structure
>d1cxya_ d.120.1.1 (A:) Cytochrome b558 {Ectothiorhodospira vacuolata [TaxId: 1054]} Length = 81 Back     information, alignment and structure
>d1soxa2 d.120.1.1 (A:3-93) Sulfite oxidase, N-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 91 Back     information, alignment and structure
>d1mj4a_ d.120.1.1 (A:) Sulfite oxidase, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query191
d1cyoa_88 Cytochrome b5 {Cow (Bos taurus) [TaxId: 9913]} 99.96
d1euea_86 Cytochrome b5 {Rat (Rattus norvegicus) [TaxId: 101 99.96
d1cxya_81 Cytochrome b558 {Ectothiorhodospira vacuolata [Tax 99.95
d1soxa291 Sulfite oxidase, N-terminal domain {Chicken (Gallu 99.94
d1kbia297 Flavocytochrome b2, N-terminal domain {Baker's yea 99.93
d1mj4a_80 Sulfite oxidase, N-terminal domain {Human (Homo sa 99.93
d1t0ga_109 Putative steroid binding protein AT2G24940 {Thale 98.51
>d1cyoa_ d.120.1.1 (A:) Cytochrome b5 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Cytochrome b5-like heme/steroid binding domain
superfamily: Cytochrome b5-like heme/steroid binding domain
family: Cytochrome b5
domain: Cytochrome b5
species: Cow (Bos taurus) [TaxId: 9913]

Probab=99.96  E-value=5e-30  Score=187.05  Aligned_cols=82  Identities=27%  Similarity=0.538  Sum_probs=78.5

Q ss_pred             CCcccCHHHHhhhcCCCCeEEEEcCeEeeccccccccccchhhhhhccCCchhHHHHhcCChHHHHHHhhhCeeeeecCC
Q 029559          108 NKRLITMDEVKQHQSEGSMWTVLKGRVYNLSPYMKFHPGGVDMLMKAVGKDCTALFNKYHAWVNAEFLLEKCLVGTLDDS  187 (191)
Q Consensus       108 ~~~~it~~Ev~~H~~~~d~WvvI~GkVYDVT~fl~~HPGG~~iL~~~aGkDaT~~F~~~H~~~na~~lL~~~~VG~l~~~  187 (191)
                      .++.||++||++|+++++|||+|+|+|||||+|+..||||.++|+.++|+|+|+.|+.+||+.+++++|++|+||+|.++
T Consensus         3 ~~k~yt~~Ev~~H~~~~d~Wvii~g~VYDvT~f~~~HPGG~~~i~~~aG~D~T~~F~~~~hs~~a~~~l~~~~IG~l~~~   82 (88)
T d1cyoa_           3 AVKYYTLEEIQKHNNSKSTWLILHYKVYDLTKFLEEHPGGEEVLREQAGGDATENFEDVGHSTDARELSKTFIIGELHPD   82 (88)
T ss_dssp             SCCEECHHHHTTCEETTEEEEEETTEEEECTTTTTTCTTCSHHHHHHTTSBCHHHHHHTTCCHHHHHHHTTTEEEEECGG
T ss_pred             ccccccHHHHHhhCCCCCeEEEECCEEEecchhhcccCCchHHHHHHcCCchHHHHHHHCCCHHHHHHHHcCccEEECcc
Confidence            46899999999999999999999999999999999999999999999999999999999999999999999999999877


Q ss_pred             CC
Q 029559          188 RP  189 (191)
Q Consensus       188 ~~  189 (191)
                      ++
T Consensus        83 ~~   84 (88)
T d1cyoa_          83 DR   84 (88)
T ss_dssp             GG
T ss_pred             cc
Confidence            64
>d1euea_ d.120.1.1 (A:) Cytochrome b5 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1cxya_ d.120.1.1 (A:) Cytochrome b558 {Ectothiorhodospira vacuolata [TaxId: 1054]} Back     information, alignment and structure
>d1soxa2 d.120.1.1 (A:3-93) Sulfite oxidase, N-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1kbia2 d.120.1.1 (A:1-97) Flavocytochrome b2, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mj4a_ d.120.1.1 (A:) Sulfite oxidase, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t0ga_ d.120.1.2 (A:) Putative steroid binding protein AT2G24940 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure