Citrus Sinensis ID: 029684


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------19
MGGCCCSSRKPHLHGTPVYYYCPPALEERESLTSHNGTASTFTRGLLVDFHLEASTPDTFRAPPLPLPYDVVFGCPPSTDSESVGETVSGGSFETLAMCEVVEDADCKTQASSLIASPRKSEVSQLNVFAASEEEDTCPICLEEYDTENPKLITKCEHHFHLSCILEWNERSESCPICDQEMIFDHTFN
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccEEEccccccccHHHHHHHHHccccccccccccccccccc
cccccccccccccccccEEEEccccHHHcccccccccccccccccEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEccccccccccEHHccccccccEEcccccccHHHHHHHHHHHcccccccccEEEEccccc
mggcccssrkphlhgtpvyyycppaleeresltshngtastftRGLLvdfhleastpdtfrapplplpydvvfgcppstdsesvgetvsggsfeTLAMCEvvedadcktqassliasprksevsqlnvfaaseeedtcpicleeydtenpklitKCEHHFHLSCILEwnersescpicdqemifdhtfn
mggcccssrkphlhgtpVYYYCPPALEERESLTSHNGTASTFTRGLLVDFHLEASTPDTFRAPPLPLPYDVVFGCPPSTDSESVGETVSGGSFETLAMCEVVEDADCKTQAssliasprksevSQLNVFAASEEEDTCPICLEEYDTENPKLITKCEHHFHLSCILEWNERSESCPICDQEMIFDHTFN
MGGCCCSSRKPHLHGTPVYYYCPPALEERESLTSHNGTASTFTRGLLVDFHLEASTPDTFRAPPLPLPYDVVFGCPPSTDsesvgetvsggsFETLAMCEVVEDADCKTQASSLIASPRKSEVSQLNVFAASEEEDTCPICLEEYDTENPKLITKCEHHFHLSCILEWNERSESCPICDQEMIFDHTFN
****CC***KPHLHGTPVYYYCPPALE*********GTASTFTRGLLVDFHLEASTPDTFRAPPLPLPYDVVFGC****************SFETLAMCEVVEDADC*******************NVFAA**EEDTCPICLEEYDTENPKLITKCEHHFHLSCILEWNERSESCPICDQEMIFD****
**G****SRKP**HGTPVY*******************************************************************************************************************EDTCPICLEEYDTENPKLITKCEHHFHLSCILEWNERSESCPICDQEMIFD****
MGGCCCSSRKPHLHGTPVYYYCPPALEERESLTSHNGTASTFTRGLLVDFHLEASTPDTFRAPPLPLPYDVVFGCPPS**********SGGSFETLAMCEVVEDADCKTQASSLIASPRKSEVSQLNVFAASEEEDTCPICLEEYDTENPKLITKCEHHFHLSCILEWNERSESCPICDQEMIFDHTFN
***********HLHGTPVYYYCPPALE************************LEASTPDTFRAPPLPLPYDVVF****************************************************LNVFAASEEEDTCPICLEEYDTENPKLITKCEHHFHLSCILEWNERSESCPICDQEMIFD****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGGCCCSSRKPHLHGTPVYYYCPPALEERESLTSHNGTASTFTRGLLVDFHLEASTPDTFRAPPLPLPYDVVFGCPPSTDSESVGETVSGGSFETLAMCEVVEDADCKTQASSLIASPRKSEVSQLNVFAASEEEDTCPICLEEYDTENPKLITKCEHHFHLSCILEWNERSESCPICDQEMIFDHTFN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query189 2.2.26 [Sep-21-2011]
Q8LE94231 E3 ubiquitin-protein liga no no 0.687 0.562 0.384 6e-20
Q4TU14 371 E3 ubiquitin-protein liga no no 0.264 0.134 0.46 5e-10
Q9ZT42 375 E3 ubiquitin-protein liga no no 0.253 0.128 0.479 4e-08
Q8GT75236 NEP1-interacting protein no no 0.470 0.377 0.293 2e-06
Q8GT74241 NEP1-interacting protein no no 0.396 0.311 0.328 8e-06
Q7KRW1 809 Protein TRC8 homolog OS=D no no 0.513 0.119 0.242 1e-05
P38748 585 RING finger protein ETP1 yes no 0.211 0.068 0.441 1e-05
Q9CY62165 E3 ubiquitin-protein liga yes no 0.306 0.351 0.362 1e-05
Q7TMV1668 E3 ubiquitin-protein liga no no 0.343 0.097 0.301 2e-05
Q66HG0380 E3 ubiquitin-protein liga no no 0.338 0.168 0.343 2e-05
>sp|Q8LE94|RING3_ARATH E3 ubiquitin-protein ligase At3g02290 OS=Arabidopsis thaliana GN=At3g02290 PE=2 SV=1 Back     alignment and function desciption
 Score = 97.1 bits (240), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 60/156 (38%), Positives = 83/156 (53%), Gaps = 26/156 (16%)

Query: 58  DTFRAPPLPLPYDV---VFGC-----------------PPSTDSESVGETVSGGSFETLA 97
           + FR+ P PLPYD     F                   P  +DS++  E+   G  +   
Sbjct: 75  EAFRSTPRPLPYDADPRYFRSLVSRREKGSSHSHEEVEPLRSDSDADSESFGVGGCKWAN 134

Query: 98  MCEVVEDADCKTQAS-----SLIASPRKSEVSQL-NVFAASEEEDTCPICLEEYDTENPK 151
               + D D K + S      ++ S  KS ++   N++  SE+ED CP CLEEY +ENPK
Sbjct: 135 NKSTLSDKDSKEEYSSKSSLRILRSRSKSIMADSENMYILSEDEDVCPTCLEEYTSENPK 194

Query: 152 LITKCEHHFHLSCILEWNERSESCPICDQEMIFDHT 187
           ++TKC HHFHLSCI EW ERSE+CP+C + M F+ T
Sbjct: 195 IVTKCSHHFHLSCIYEWMERSENCPVCGKVMEFNET 230




Mediates E2-dependent protein ubiquitination.
Arabidopsis thaliana (taxid: 3702)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -
>sp|Q4TU14|RHF1A_ARATH E3 ubiquitin-protein ligase RHF1A OS=Arabidopsis thaliana GN=RHF1A PE=1 SV=1 Back     alignment and function description
>sp|Q9ZT42|RHF2A_ARATH E3 ubiquitin-protein ligase RHF2A OS=Arabidopsis thaliana GN=RHF2A PE=2 SV=1 Back     alignment and function description
>sp|Q8GT75|NIP1_ARATH NEP1-interacting protein 1 OS=Arabidopsis thaliana GN=NIP1 PE=1 SV=2 Back     alignment and function description
>sp|Q8GT74|NIP2_ARATH NEP1-interacting protein 2 OS=Arabidopsis thaliana GN=NIP2 PE=1 SV=1 Back     alignment and function description
>sp|Q7KRW1|TRC8_DROME Protein TRC8 homolog OS=Drosophila melanogaster GN=Trc8 PE=1 SV=1 Back     alignment and function description
>sp|P38748|ETP1_YEAST RING finger protein ETP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ETP1 PE=1 SV=1 Back     alignment and function description
>sp|Q9CY62|RN181_MOUSE E3 ubiquitin-protein ligase RNF181 OS=Mus musculus GN=Rnf181 PE=2 SV=1 Back     alignment and function description
>sp|Q7TMV1|RN139_MOUSE E3 ubiquitin-protein ligase RNF139 OS=Mus musculus GN=Rnf139 PE=1 SV=1 Back     alignment and function description
>sp|Q66HG0|RNF13_RAT E3 ubiquitin-protein ligase RNF13 OS=Rattus norvegicus GN=Rnf13 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query189
255541644199 protein binding protein, putative [Ricin 1.0 0.949 0.753 1e-80
224130328186 predicted protein [Populus trichocarpa] 0.952 0.967 0.758 1e-73
356520392191 PREDICTED: E3 ubiquitin-protein ligase A 1.0 0.989 0.701 2e-71
356560785227 PREDICTED: uncharacterized protein LOC10 1.0 0.832 0.685 2e-70
224067912185 predicted protein [Populus trichocarpa] 0.952 0.972 0.723 1e-68
356531973184 PREDICTED: E3 ubiquitin-protein ligase A 0.962 0.989 0.672 7e-66
357504425191 RING finger protein [Medicago truncatula 0.973 0.963 0.655 1e-64
356568411184 PREDICTED: E3 ubiquitin-protein ligase A 0.962 0.989 0.661 3e-64
225454365184 PREDICTED: E3 ubiquitin-protein ligase A 0.952 0.978 0.636 2e-61
18411296190 RING-H2 finger B1A [Arabidopsis thaliana 0.989 0.984 0.609 7e-58
>gi|255541644|ref|XP_002511886.1| protein binding protein, putative [Ricinus communis] gi|223549066|gb|EEF50555.1| protein binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  304 bits (779), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 144/191 (75%), Positives = 162/191 (84%), Gaps = 2/191 (1%)

Query: 1   MGGCCCSSRKPHLHGTPVYYYCPPALEERESLTSHNGTASTFTRGLLVDFHLEASTPDTF 60
           MGGCCCSSRKPHLHGTPVYYYCPPALEE ESLTSHNG AS F  GLL + +L  STPDTF
Sbjct: 9   MGGCCCSSRKPHLHGTPVYYYCPPALEEHESLTSHNGVASAFAAGLLAELNLNTSTPDTF 68

Query: 61  RAPPLPLPYDVVFGCPPSTDSESVGETVSGGSFETLAMCEVVEDADCKTQASSLIASPRK 120
           RAPP PLPYD+V GC  S+DSES+ ET+SGGSFETLA CE +ED DC+T ASSL  SP+K
Sbjct: 69  RAPPAPLPYDMVLGCRRSSDSESIRETISGGSFETLATCEDLEDPDCRTLASSLPVSPKK 128

Query: 121 SEVSQL--NVFAASEEEDTCPICLEEYDTENPKLITKCEHHFHLSCILEWNERSESCPIC 178
            ++S+L  NV +A+EEED CPICLEEYD +NPK  TKCEHHFHLSCILEW ERS++CPIC
Sbjct: 129 PDISKLSENVVSATEEEDACPICLEEYDIQNPKFFTKCEHHFHLSCILEWMERSDTCPIC 188

Query: 179 DQEMIFDHTFN 189
           DQEM+FDHTFN
Sbjct: 189 DQEMVFDHTFN 199




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224130328|ref|XP_002320810.1| predicted protein [Populus trichocarpa] gi|222861583|gb|EEE99125.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356520392|ref|XP_003528846.1| PREDICTED: E3 ubiquitin-protein ligase At3g02290-like [Glycine max] Back     alignment and taxonomy information
>gi|356560785|ref|XP_003548668.1| PREDICTED: uncharacterized protein LOC100804435 [Glycine max] Back     alignment and taxonomy information
>gi|224067912|ref|XP_002302595.1| predicted protein [Populus trichocarpa] gi|222844321|gb|EEE81868.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356531973|ref|XP_003534550.1| PREDICTED: E3 ubiquitin-protein ligase At3g02290-like [Glycine max] Back     alignment and taxonomy information
>gi|357504425|ref|XP_003622501.1| RING finger protein [Medicago truncatula] gi|357514547|ref|XP_003627562.1| RING finger protein [Medicago truncatula] gi|355497516|gb|AES78719.1| RING finger protein [Medicago truncatula] gi|355521584|gb|AET02038.1| RING finger protein [Medicago truncatula] gi|388504160|gb|AFK40146.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|356568411|ref|XP_003552404.1| PREDICTED: E3 ubiquitin-protein ligase At3g02290-like [Glycine max] Back     alignment and taxonomy information
>gi|225454365|ref|XP_002278589.1| PREDICTED: E3 ubiquitin-protein ligase At3g02290 [Vitis vinifera] gi|297745359|emb|CBI40439.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|18411296|ref|NP_567171.1| RING-H2 finger B1A [Arabidopsis thaliana] gi|42572783|ref|NP_974488.1| RING-H2 finger B1A [Arabidopsis thaliana] gi|88193784|gb|ABD42981.1| At4g00335 [Arabidopsis thaliana] gi|110736762|dbj|BAF00342.1| RING-H2 finger protein RHB1a [Arabidopsis thaliana] gi|332656459|gb|AEE81859.1| RING-H2 finger B1A [Arabidopsis thaliana] gi|332656460|gb|AEE81860.1| RING-H2 finger B1A [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query189
TAIR|locus:505006415190 RHB1A "RING-H2 finger B1A" [Ar 0.989 0.984 0.578 2e-56
TAIR|locus:2177881212 AT5G41350 [Arabidopsis thalian 0.460 0.410 0.534 6.7e-43
TAIR|locus:2076542231 AT3G02290 [Arabidopsis thalian 0.455 0.372 0.510 2.7e-25
TAIR|locus:2143251232 AT5G15790 [Arabidopsis thalian 0.460 0.375 0.477 2.4e-24
TAIR|locus:2129525 371 RHF1A "RING-H2 group F1A" [Ara 0.317 0.161 0.428 1.8e-11
TAIR|locus:2040085377 AT2G25410 [Arabidopsis thalian 0.349 0.175 0.388 4.6e-10
UNIPROTKB|C9J1C6139 RNF181 "E3 ubiquitin-protein l 0.349 0.474 0.397 1.1e-09
UNIPROTKB|Q9P0P0153 RNF181 "E3 ubiquitin-protein l 0.349 0.431 0.397 1.1e-09
UNIPROTKB|Q3T0W3153 RNF181 "E3 ubiquitin-protein l 0.349 0.431 0.382 1.4e-09
UNIPROTKB|E2QUN1153 RNF181 "Uncharacterized protei 0.349 0.431 0.382 1.4e-09
TAIR|locus:505006415 RHB1A "RING-H2 finger B1A" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 581 (209.6 bits), Expect = 2.0e-56, P = 2.0e-56
 Identities = 111/192 (57%), Positives = 129/192 (67%)

Query:     1 MGGCCCSSRKPHLHGTPVYYYCPPALEERESLTSHNGTASTFTRGLLVDFHLEASTPDTF 60
             MGGCC SSRK HL GTPVYYYCP + EE     +  G  S FT GLLVD  LE S PDTF
Sbjct:     1 MGGCCSSSRKSHLVGTPVYYYCPESFEELVPSGTRAGVGSAFTTGLLVDIGLETSIPDTF 60

Query:    61 RAPPLPLPYDVVFGCPPSTDXXXXXXXXXXXXFETLAMCEVVEDADCKTQASSLIASPRK 120
              AP  PLPYD++ G P  TD            FETLA CE + ++DCKT ASS+I SPRK
Sbjct:    61 CAPA-PLPYDLLLGRPQCTDSESIKGRMSGSSFETLATCEDLGESDCKTLASSVILSPRK 119

Query:   121 SEVSQ---LNVFAASEEEDTCPICLEEYDTENPKLITKCEHHFHLSCILEWNERSESCPI 177
             S+ S+   L +    EEED CPIC E+YD ENP+L TKCEH FHLSC+LEW ERS+ CPI
Sbjct:   120 SDFSKHQGLKILV-DEEEDCCPICFEDYDVENPRLTTKCEHEFHLSCLLEWIERSDRCPI 178

Query:   178 CDQEMIFDHTFN 189
             CD+E++FD   N
Sbjct:   179 CDKEVVFDDRLN 190




GO:0005634 "nucleus" evidence=ISM
GO:0008270 "zinc ion binding" evidence=IEA;ISS
GO:0048573 "photoperiodism, flowering" evidence=RCA
TAIR|locus:2177881 AT5G41350 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2076542 AT3G02290 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2143251 AT5G15790 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2129525 RHF1A "RING-H2 group F1A" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2040085 AT2G25410 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|C9J1C6 RNF181 "E3 ubiquitin-protein ligase RNF181" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q9P0P0 RNF181 "E3 ubiquitin-protein ligase RNF181" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q3T0W3 RNF181 "E3 ubiquitin-protein ligase RNF181" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2QUN1 RNF181 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query189
pfam1267873 pfam12678, zf-rbx1, RING-H2 zinc finger 2e-09
pfam1363946 pfam13639, zf-RING_2, Ring finger domain 6e-09
cd0016245 cd00162, RING, RING-finger (Really Interesting New 1e-07
COG5243 491 COG5243, HRD1, HRD ubiquitin ligase complex, ER me 1e-07
pfam1392345 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI 4e-07
pfam1286185 pfam12861, zf-Apc11, Anaphase-promoting complex su 3e-06
smart0018440 smart00184, RING, Ring finger 1e-05
pfam0009740 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING 3e-05
COG5540374 COG5540, COG5540, RING-finger-containing ubiquitin 3e-05
PHA02929238 PHA02929, PHA02929, N1R/p28-like protein; Provisio 8e-05
COG519488 COG5194, APC11, Component of SCF ubiquitin ligase 1e-04
COG52191525 COG5219, COG5219, Uncharacterized conserved protei 2e-04
COG5574271 COG5574, PEX10, RING-finger-containing E3 ubiquiti 0.004
>gnl|CDD|221705 pfam12678, zf-rbx1, RING-H2 zinc finger Back     alignment and domain information
 Score = 51.7 bits (124), Expect = 2e-09
 Identities = 18/55 (32%), Positives = 26/55 (47%), Gaps = 10/55 (18%)

Query: 134 EEDTCPICLEEYD----------TENPKLITKCEHHFHLSCILEWNERSESCPIC 178
           E+D C IC   +D           + P +  +C H FHL CI  W +   +CP+C
Sbjct: 18  EDDVCAICRNHFDGTCPECKSPGDDCPVVWGECGHAFHLHCISRWLKTRNTCPLC 72


There are 8 cysteine/ histidine residues which are proposed to be the conserved residues involved in zinc binding. The protein, of which this domain is the conserved region, participates in diverse functions relevant to chromosome metabolism and cell cycle control. Length = 73

>gnl|CDD|222279 pfam13639, zf-RING_2, Ring finger domain Back     alignment and domain information
>gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>gnl|CDD|227568 COG5243, HRD1, HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|193335 pfam12861, zf-Apc11, Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>gnl|CDD|214546 smart00184, RING, Ring finger Back     alignment and domain information
>gnl|CDD|215715 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|227827 COG5540, COG5540, RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|222944 PHA02929, PHA02929, N1R/p28-like protein; Provisional Back     alignment and domain information
>gnl|CDD|227521 COG5194, APC11, Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|227544 COG5219, COG5219, Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>gnl|CDD|227861 COG5574, PEX10, RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 189
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 99.65
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 99.51
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 99.49
PHA02929238 N1R/p28-like protein; Provisional 99.35
COG5243 491 HRD1 HRD ubiquitin ligase complex, ER membrane com 99.33
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 99.33
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 99.32
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 99.31
KOG0317293 consensus Predicted E3 ubiquitin ligase, integral 99.29
KOG0320187 consensus Predicted E3 ubiquitin ligase [Posttrans 99.24
PLN03208 193 E3 ubiquitin-protein ligase RMA2; Provisional 99.24
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 99.21
cd0016245 RING RING-finger (Really Interesting New Gene) dom 99.2
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 99.19
KOG0823 230 consensus Predicted E3 ubiquitin ligase [Posttrans 99.16
PF1463444 zf-RING_5: zinc-RING finger domain 99.15
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 99.12
smart0050463 Ubox Modified RING finger domain. Modified RING fi 99.11
PHA02926242 zinc finger-like protein; Provisional 99.08
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 98.97
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 98.94
KOG0802 543 consensus E3 ubiquitin ligase [Posttranslational m 98.93
COG519488 APC11 Component of SCF ubiquitin ligase and anapha 98.93
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 98.82
KOG149384 consensus Anaphase-promoting complex (APC), subuni 98.8
KOG2930114 consensus SCF ubiquitin ligase, Rbx1 component [Po 98.79
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 98.67
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 98.67
smart0074449 RINGv The RING-variant domain is a C4HC3 zinc-fing 98.64
KOG2164 513 consensus Predicted E3 ubiquitin ligase [Posttrans 98.64
KOG0287 442 consensus Postreplication repair protein RAD18 [Re 98.6
KOG0804 493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 98.58
COG5432 391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 98.5
KOG0828636 consensus Predicted E3 ubiquitin ligase [Posttrans 98.43
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 98.35
KOG2177 386 consensus Predicted E3 ubiquitin ligase [Posttrans 98.35
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 98.28
KOG1734328 consensus Predicted RING-containing E3 ubiquitin l 98.22
KOG4265349 consensus Predicted E3 ubiquitin ligase [Posttrans 98.14
KOG1039 344 consensus Predicted E3 ubiquitin ligase [Posttrans 98.11
KOG0311 381 consensus Predicted E3 ubiquitin ligase [Posttrans 98.08
COG52191525 Uncharacterized conserved protein, contains RING Z 98.07
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 97.96
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 97.93
KOG4445 368 consensus Uncharacterized conserved protein, conta 97.88
KOG417262 consensus Predicted E3 ubiquitin ligase [Posttrans 97.84
KOG0825 1134 consensus PHD Zn-finger protein [General function 97.8
KOG2660 331 consensus Locus-specific chromosome binding protei 97.79
KOG0297 391 consensus TNF receptor-associated factor [Signal t 97.78
KOG1428 3738 consensus Inhibitor of type V adenylyl cyclases/Ne 97.7
KOG4159 398 consensus Predicted E3 ubiquitin ligase [Posttrans 97.63
KOG1785 563 consensus Tyrosine kinase negative regulator CBL [ 97.58
COG5152259 Uncharacterized conserved protein, contains RING a 97.53
PF1290647 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A. 97.49
KOG2879298 consensus Predicted E3 ubiquitin ligase [Posttrans 97.46
KOG1941518 consensus Acetylcholine receptor-associated protei 97.42
PHA02862156 5L protein; Provisional 97.38
KOG4692489 consensus Predicted E3 ubiquitin ligase [Posttrans 97.25
PF05883134 Baculo_RING: Baculovirus U-box/Ring-like domain; I 97.25
KOG1002 791 consensus Nucleotide excision repair protein RAD16 97.23
KOG1813313 consensus Predicted E3 ubiquitin ligase [Posttrans 97.2
PHA02825162 LAP/PHD finger-like protein; Provisional 97.19
KOG3039303 consensus Uncharacterized conserved protein [Funct 96.87
KOG4275350 consensus Predicted E3 ubiquitin ligase [Posttrans 96.81
PF1457048 zf-RING_4: RING/Ubox like zinc-binding domain; PDB 96.78
PF04641260 Rtf2: Rtf2 RING-finger 96.69
PF10367109 Vps39_2: Vacuolar sorting protein 39 domain 2; Int 96.62
KOG1814 445 consensus Predicted E3 ubiquitin ligase [Posttrans 96.56
PHA03096284 p28-like protein; Provisional 96.55
KOG1952 950 consensus Transcription factor NF-X1, contains NFX 96.4
KOG1571355 consensus Predicted E3 ubiquitin ligase [Posttrans 96.33
KOG3970 299 consensus Predicted E3 ubiquitin ligase [Posttrans 96.32
COG5236 493 Uncharacterized conserved protein, contains RING Z 96.31
PF1444755 Prok-RING_4: Prokaryotic RING finger family 4 96.18
KOG1940276 consensus Zn-finger protein [General function pred 96.17
PF0385450 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc 95.87
COG5175 480 MOT2 Transcriptional repressor [Transcription] 95.59
COG5222427 Uncharacterized conserved protein, contains RING Z 95.53
COG5183 1175 SSM4 Protein involved in mRNA turnover and stabili 95.49
KOG0826357 consensus Predicted E3 ubiquitin ligase involved i 95.44
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 95.41
PF0874643 zf-RING-like: RING-like domain; InterPro: IPR01485 95.41
KOG1645 463 consensus RING-finger-containing E3 ubiquitin liga 95.09
KOG3268234 consensus Predicted E3 ubiquitin ligase [Posttrans 94.96
KOG1001 674 consensus Helicase-like transcription factor HLTF/ 94.95
KOG2034911 consensus Vacuolar sorting protein PEP3/VPS18 [Int 94.83
KOG3053 293 consensus Uncharacterized conserved protein [Funct 94.71
KOG0298 1394 consensus DEAD box-containing helicase-like transc 94.59
KOG0801205 consensus Predicted E3 ubiquitin ligase [Posttrans 94.53
KOG1609 323 consensus Protein involved in mRNA turnover and st 93.45
PF0289150 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR0041 93.36
KOG2932 389 consensus E3 ubiquitin ligase involved in ubiquiti 93.21
KOG1812 384 consensus Predicted E3 ubiquitin ligase [Posttrans 93.05
PF10272358 Tmpp129: Putative transmembrane protein precursor; 91.99
KOG3161 861 consensus Predicted E3 ubiquitin ligase [Posttrans 91.98
PF07800162 DUF1644: Protein of unknown function (DUF1644); In 91.85
KOG0827 465 consensus Predicted E3 ubiquitin ligase [Posttrans 91.84
COG5220 314 TFB3 Cdk activating kinase (CAK)/RNA polymerase II 91.26
KOG1100207 consensus Predicted E3 ubiquitin ligase [Posttrans 91.18
KOG3899381 consensus Uncharacterized conserved protein [Funct 91.07
PF05290140 Baculo_IE-1: Baculovirus immediate-early protein ( 90.66
KOG0802543 consensus E3 ubiquitin ligase [Posttranslational m 89.93
KOG3002 299 consensus Zn finger protein [General function pred 89.86
KOG03091081 consensus Conserved WD40 repeat-containing protein 89.57
KOG2817394 consensus Predicted E3 ubiquitin ligase [Posttrans 89.52
KOG4362 684 consensus Transcriptional regulator BRCA1 [Replica 88.7
KOG4185 296 consensus Predicted E3 ubiquitin ligase [Posttrans 87.32
PF1444654 Prok-RING_1: Prokaryotic RING finger family 1 87.08
KOG1815 444 consensus Predicted E3 ubiquitin ligase [Posttrans 83.02
KOG2066846 consensus Vacuolar assembly/sorting protein VPS41 82.6
KOG0825 1134 consensus PHD Zn-finger protein [General function 81.81
KOG2068327 consensus MOT2 transcription factor [Transcription 81.43
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
Probab=99.65  E-value=4.7e-17  Score=97.47  Aligned_cols=44  Identities=50%  Similarity=1.158  Sum_probs=39.6

Q ss_pred             CccccccccccCCCCeEEcCCCCcccHHHHHHHhhcCCCCccCC
Q 029684          136 DTCPICLEEYDTENPKLITKCEHHFHLSCILEWNERSESCPICD  179 (189)
Q Consensus       136 ~~C~ICle~~~~~~~~~~~~C~H~Fh~~CI~~Wl~~~~tCP~Cr  179 (189)
                      +.|+||++.|..++.++.++|||.||..||.+|++.+.+||+||
T Consensus         1 d~C~IC~~~~~~~~~~~~l~C~H~fh~~Ci~~~~~~~~~CP~CR   44 (44)
T PF13639_consen    1 DECPICLEEFEDGEKVVKLPCGHVFHRSCIKEWLKRNNSCPVCR   44 (44)
T ss_dssp             -CETTTTCBHHTTSCEEEETTSEEEEHHHHHHHHHHSSB-TTTH
T ss_pred             CCCcCCChhhcCCCeEEEccCCCeeCHHHHHHHHHhCCcCCccC
Confidence            46999999997778889999999999999999999999999997



...

>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2930 consensus SCF ubiquitin ligase, Rbx1 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information
>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4445 consensus Uncharacterized conserved protein, contains RWD domain [Function unknown] Back     alignment and domain information
>KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] Back     alignment and domain information
>KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] Back     alignment and domain information
>KOG1428 consensus Inhibitor of type V adenylyl cyclases/Neuronal presynaptic protein Highwire/PAM/RPM-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>PF12906 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A Back     alignment and domain information
>KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PHA02862 5L protein; Provisional Back     alignment and domain information
>KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02825 LAP/PHD finger-like protein; Provisional Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 Back     alignment and domain information
>KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA03096 p28-like protein; Provisional Back     alignment and domain information
>KOG1952 consensus Transcription factor NF-X1, contains NFX-type Zn2+-binding and R3H domains [Transcription] Back     alignment and domain information
>KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3970 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PF14447 Prok-RING_4: Prokaryotic RING finger family 4 Back     alignment and domain information
>KOG1940 consensus Zn-finger protein [General function prediction only] Back     alignment and domain information
>PF03854 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>COG5183 SSM4 Protein involved in mRNA turnover and stability [RNA processing and modification] Back     alignment and domain information
>KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF08746 zf-RING-like: RING-like domain; InterPro: IPR014857 This is a zinc finger domain that is related to the C3HC4 RING finger domain (IPR001841 from INTERPRO) Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3268 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG2034 consensus Vacuolar sorting protein PEP3/VPS18 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3053 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0298 consensus DEAD box-containing helicase-like transcription factor/DNA repair protein [Replication, recombination and repair] Back     alignment and domain information
>KOG0801 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1609 consensus Protein involved in mRNA turnover and stability [RNA processing and modification] Back     alignment and domain information
>PF02891 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG2932 consensus E3 ubiquitin ligase involved in ubiquitination of E-cadherin complex [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1812 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10272 Tmpp129: Putative transmembrane protein precursor; InterPro: IPR018801 This entry consists of proteins conserved from worms to humans Back     alignment and domain information
>KOG3161 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function Back     alignment and domain information
>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5220 TFB3 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB3 [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG1100 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3899 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0 Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3002 consensus Zn finger protein [General function prediction only] Back     alignment and domain information
>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG2817 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4362 consensus Transcriptional regulator BRCA1 [Replication, recombination and repair; Transcription] Back     alignment and domain information
>KOG4185 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14446 Prok-RING_1: Prokaryotic RING finger family 1 Back     alignment and domain information
>KOG1815 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG2068 consensus MOT2 transcription factor [Transcription] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query189
2ect_A78 Solution Structure Of The Zinc Finger, C3hc4 Type ( 2e-05
2ep4_A74 Solution Structure Of Ring Finger From Human Ring F 6e-05
2l0b_A91 Solution Nmr Structure Of Zinc Finger Domain Of E3 2e-04
>pdb|2ECT|A Chain A, Solution Structure Of The Zinc Finger, C3hc4 Type (Ring Finger) Domain Of Ring Finger Protein 126 Length = 78 Back     alignment and structure

Iteration: 1

Score = 45.1 bits (105), Expect = 2e-05, Method: Compositional matrix adjust. Identities = 19/50 (38%), Positives = 28/50 (56%) Query: 138 CPICLEEYDTENPKLITKCEHHFHLSCILEWNERSESCPICDQEMIFDHT 187 CP+C E+Y C H FH SCI+ W E+ +SCP+C + + +T Sbjct: 18 CPVCKEDYALGESVRQLPCNHLFHDSCIVPWLEQHDSCPVCRKSLTGQNT 67
>pdb|2EP4|A Chain A, Solution Structure Of Ring Finger From Human Ring Finger Protein 24 Length = 74 Back     alignment and structure
>pdb|2L0B|A Chain A, Solution Nmr Structure Of Zinc Finger Domain Of E3 Ubiquitin-Protein Ligase Praja-1 From Homo Sapiens, Northeast Structural Genomics Consortium (Nesg) Target Hr4710b Length = 91 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query189
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 7e-13
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 2e-12
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 8e-12
2ecm_A55 Ring finger and CHY zinc finger domain- containing 6e-11
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 7e-11
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 1e-10
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 3e-10
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 7e-10
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 7e-10
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 8e-10
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 8e-10
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 1e-09
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 1e-09
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 4e-09
2ect_A78 Ring finger protein 126; metal binding protein, st 7e-09
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 1e-08
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 2e-08
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 2e-08
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 5e-08
4epo_C149 E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 8e-08
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 2e-07
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 2e-07
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 4e-07
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 5e-07
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 6e-07
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 3e-06
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 8e-06
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 3e-05
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 4e-05
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 5e-05
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 6e-05
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 6e-05
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 6e-05
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 1e-04
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 1e-04
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 1e-04
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 2e-04
2ysl_A73 Tripartite motif-containing protein 31; ring-type 2e-04
1z6u_A150 NP95-like ring finger protein isoform B; structura 2e-04
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 3e-04
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 3e-04
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 3e-04
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 8e-04
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Length = 68 Back     alignment and structure
 Score = 60.1 bits (146), Expect = 7e-13
 Identities = 16/47 (34%), Positives = 24/47 (51%), Gaps = 2/47 (4%)

Query: 132 SEEEDTCPICLEEYDTENPKLITKCEHHFHLSCILEWNERSESCPIC 178
           +   + CPICLE+    N  +   C H F   CI  W  ++ +CP+C
Sbjct: 2   ATVAERCPICLEDP--SNYSMALPCLHAFCYVCITRWIRQNPTCPLC 46


>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Length = 55 Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Length = 117 Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Length = 108 Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64 Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Length = 55 Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71 Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 78 Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100 Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Length = 106 Back     alignment and structure
>4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149 Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Length = 99 Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389 Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Length = 381 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133 Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Length = 114 Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 117 Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Length = 165 Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 112 Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Length = 267 Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Length = 124 Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Length = 150 Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 94 Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Length = 78 Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 Back     alignment and structure

Structure Templates Detected by HHsearch ?

No hit with probability above 80.00


Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 189
d1iyma_55 g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati 3e-12
d1chca_68 g.44.1.1 (A:) Immediate early protein, IEEHV {Equi 3e-10
d3dplr188 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of S 7e-10
d1g25a_65 g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapi 5e-07
d1fbva479 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta 8e-07
d1jm7a_103 g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie 3e-06
d1vyxa_60 g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal do 2e-05
d1rmda286 g.44.1.1 (A:1-86) V(D)J recombination activating p 3e-05
d1jm7b_97 g.44.1.1 (B:) bard1 RING domain {Human (Homo sapie 7e-05
d1wima_94 g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA016 1e-04
d1bora_56 g.44.1.1 (A:) Acute promyelocytic leukaemia proto- 1e-04
d1ur6b_52 g.44.1.1 (B:) Not-4 N-terminal RING finger domain 2e-04
d1v87a_114 g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mou 0.001
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55 Back     information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: EL5 RING-H2 domain
species: Rice (Oryza sativa) [TaxId: 4530]
 Score = 56.8 bits (137), Expect = 3e-12
 Identities = 16/54 (29%), Positives = 27/54 (50%), Gaps = 1/54 (1%)

Query: 131 ASEEEDTCPICLEEY-DTENPKLITKCEHHFHLSCILEWNERSESCPICDQEMI 183
           A ++   C +CL E  D E  + + +C H FH  C+  W     +CP+C   ++
Sbjct: 1   AMDDGVECAVCLAELEDGEEARFLPRCGHGFHAECVDMWLGSHSTCPLCRLTVV 54


>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Length = 60 Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 114 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query189
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 99.66
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 99.61
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 99.59
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 99.57
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 99.54
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 99.49
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 99.45
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 99.42
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 99.41
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 99.38
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 99.35
d2c2la280 STIP1 homology and U box-containing protein 1, STU 99.25
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 99.22
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 99.19
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 99.18
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 99.18
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 98.76
d1f62a_51 Williams-Beuren syndrome transcription factor, WST 93.14
d1fp0a170 Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo 90.89
d1wila_89 Hypothetical protein KIAA1045 {Human (Homo sapiens 90.53
d1mm2a_61 Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 90.05
d1z60a159 TFIIH p44 subunit cysteine-rich domain {Human (Hom 85.32
d1wema_76 Death associated transcription factor 1, Datf1 (DI 83.8
d1wesa_71 PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mu 80.32
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: EL5 RING-H2 domain
species: Rice (Oryza sativa) [TaxId: 4530]
Probab=99.66  E-value=1.6e-17  Score=102.88  Aligned_cols=53  Identities=25%  Similarity=0.755  Sum_probs=45.5

Q ss_pred             CCCCCCCCCCCCCCCCCCCEEEC-CCCCCCCHHHHHHHHHCCCCCCCCCCCCCC
Q ss_conf             76667554333345689975873-899702199899996049988667767856
Q 029684          132 SEEEDTCPICLEEYDTENPKLIT-KCEHHFHLSCILEWNERSESCPICDQEMIF  184 (189)
Q Consensus       132 ~~~~~~C~ICle~~~~~~~~~~~-~C~H~Fh~~CI~~Wl~~~~tCPiCR~~l~~  184 (189)
                      .+++..|+|||++|..++.++.+ .|+|.||..||.+||+++.+||+||+.+.+
T Consensus         2 ~ed~~~C~ICl~~~~~~~~~~~l~~C~H~Fh~~Ci~~Wl~~~~~CP~CR~~i~v   55 (55)
T d1iyma_           2 MDDGVECAVCLAELEDGEEARFLPRCGHGFHAECVDMWLGSHSTCPLCRLTVVV   55 (55)
T ss_dssp             CCCSCCCTTTCCCCCTTSCCEECSSSCCEECTTHHHHTTTTCCSCSSSCCCSCC
T ss_pred             CCCCCCCEEECCCCCCCCEEEEECCCCCCCCHHHHHHHHHHCCCCCCCCCEEEC
T ss_conf             889999849790010798899908989810599999999849938788978489



>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wila_ g.50.1.3 (A:) Hypothetical protein KIAA1045 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z60a1 g.49.1.2 (A:328-386) TFIIH p44 subunit cysteine-rich domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure