Citrus Sinensis ID: 029690

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------19
MLRCCASRYLLKRNLGIATSLILTRHFTSNCKQTLLRPSKSNPISLVSRPCFFASRSDHTMASQSKTSVHDFSVKDAKGQDVDLSIYKGKLLLIVNVASQCGLTNSNYTELSQLYDKYKNQGLEILAFPCNQFGAQEPGDNEQIQEFACTRFKAEFPIFDKVLALQLYKFYKQKIHSHGFAYACRILIL
cccccHHHHHHHHHHcccHHHHHHccccccccccccccccccccccccccccccccccccccccccccEEEEEEEcccccccccccccccEEEEEEcccccccccccHHHHHHHHHHHcccccEEEEcccccccccccccHHHHHHHHHHcccccccccccccHHHHHHHHHHcccccccccccccccc
ccEEEEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccHcccccccEEEEEEEccccccEEHHHHcccEEEEEEEccccccHHHHHHHHHHHHHHHHHHcEEEEEEEcccccccccccHHHHHHHHHHccccEcccHHHcccHHHHHHHHHccccccEEEEEEEEEc
MLRCCASRYLLKRNLGIATSLILTRhftsnckqtllrpsksnpislvsrpcffasrsdhtmasqsktsvhdfsvkdakgqdvdlsiykGKLLLIVNVASqcgltnsnytELSQLYDKYKNQGLeilafpcnqfgaqepgdneqIQEFACTRFKAEFPIFDKVLALQLYKFYKQKIHSHGFAYACRILIL
MLRCCASRYLLKRNLGIATSLILTRHFTSNCKQtllrpsksnpislVSRPCFFASRSDHTMASQSKTSVHDFSVKDAKGQDVDLSIYKGKLLLIVNVASQCGLTNSNYTELSQLYDKYKNQGLEILAFPCNQFGAQEPGDNEQIQEFACTRFKAEFPIFDKVLALQLYKFYKQKIHSHGFAYACRILIL
MLRCCASRYLLKRNLGIATSLILTRHFTSNCKQTLLRPSKSNPISLVSRPCFFASRSDHTMASQSKTSVHDFSVKDAKGQDVDLSIYKGKLLLIVNVASQCGLTNSNYTELSQLYDKYKNQGLEILAFPCNQFGAQEPGDNEQIQEFACTRFKAEFPIFDKVLALQLYKFYKQKIHSHGFAYACRILIL
**RCCASRYLLKRNLGIATSLILTRHFTSNCKQTLLR******ISLVSRPCFF*************************GQDVDLSIYKGKLLLIVNVASQCGLTNSNYTELSQLYDKYKNQGLEILAFPCNQFGAQEPGDNEQIQEFACTRFKAEFPIFDKVLALQLYKFYKQKIHSHGFAYACRILI*
************RNLGI********************PSKSNPISLVSRPCF****************VHDFSVKDAKGQDVDLSIYKGKLLLIVNVASQCGLTNSNYTELSQLYDKYKNQGLEILAFPCNQFGAQEPGDNEQIQEFACTRFKAEFPIFDKVLALQLYKFYKQKIHSHGFAYACRILIL
MLRCCASRYLLKRNLGIATSLILTRHFTSNCKQTLLRPSKSNPISLVSRPCFFASR**************DFSVKDAKGQDVDLSIYKGKLLLIVNVASQCGLTNSNYTELSQLYDKYKNQGLEILAFPCNQFGAQEPGDNEQIQEFACTRFKAEFPIFDKVLALQLYKFYKQKIHSHGFAYACRILIL
MLRCCASRYLLKRN*****S****R****NCKQTLLRPSKSNPISLVSRPCFFA**********SKTSVHDFSVKDAKGQDVDLSIYKGKLLLIVNVASQCGLTNSNYTELSQLYDKYKNQGLEILAFPCNQFGAQEPGDNEQIQEFACTRFKAEFPIFDKVLALQLYKFYKQKIHSHGFAYACRILIL
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLRCCASRYLLKRNLGIATSLILTRHFTSNCKQTLLRPSKSNPISLVSRPCFFASRSDHTMASQSKTSVHDFSVKDAKGQDVDLSIYKGKLLLIVNVASQCGLTNSNYTELSQLYDKYKNQGLEILAFPCNQFGAQEPGDNEQIQEFACTRFKAEFPIFDKVLALQLYKFYKQKIHSHGFAYACRILIL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query189 2.2.26 [Sep-21-2011]
Q06652167 Probable phospholipid hyd no no 0.539 0.610 0.990 5e-55
O48646232 Probable phospholipid hyd yes no 0.624 0.508 0.733 4e-47
Q9LEF0170 Probable phospholipid hyd N/A no 0.592 0.658 0.75 1e-45
P30708169 Probable phospholipid hyd N/A no 0.592 0.662 0.722 2e-43
Q9FXS3169 Probable phospholipid hyd N/A no 0.592 0.662 0.714 3e-43
O23814171 Probable phospholipid hyd N/A no 0.592 0.654 0.708 3e-43
O24031169 Probable phospholipid hyd N/A no 0.592 0.662 0.705 4e-43
O49069170 Probable phospholipid hyd N/A no 0.592 0.658 0.716 4e-42
Q9SZ54233 Putative glutathione pero no no 0.603 0.489 0.669 4e-41
O23970167 Glutathione peroxidase 1 N/A no 0.619 0.700 0.631 2e-40
>sp|Q06652|GPX4_CITSI Probable phospholipid hydroperoxide glutathione peroxidase OS=Citrus sinensis GN=CSA PE=1 SV=1 Back     alignment and function desciption
 Score =  213 bits (543), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 101/102 (99%), Positives = 102/102 (100%)

Query: 61  MASQSKTSVHDFSVKDAKGQDVDLSIYKGKLLLIVNVASQCGLTNSNYTELSQLYDKYKN 120
           MASQSKTSVHDF+VKDAKGQDVDLSIYKGKLLLIVNVASQCGLTNSNYTELSQLYDKYKN
Sbjct: 1   MASQSKTSVHDFTVKDAKGQDVDLSIYKGKLLLIVNVASQCGLTNSNYTELSQLYDKYKN 60

Query: 121 QGLEILAFPCNQFGAQEPGDNEQIQEFACTRFKAEFPIFDKV 162
           QGLEILAFPCNQFGAQEPGDNEQIQEFACTRFKAEFPIFDKV
Sbjct: 61  QGLEILAFPCNQFGAQEPGDNEQIQEFACTRFKAEFPIFDKV 102
Protects cells and enzymes from oxidative damage, by catalyzing the reduction of hydrogen peroxide, lipid peroxides and organic hydroperoxide, by glutathione.
Citrus sinensis (taxid: 2711)
EC: 1EC: .EC: 1EC: 1EC: .EC: 1EC: .EC: 1EC: 2
>sp|O48646|GPX6_ARATH Probable phospholipid hydroperoxide glutathione peroxidase 6, mitochondrial OS=Arabidopsis thaliana GN=GPX6 PE=2 SV=2 Back     alignment and function description
>sp|Q9LEF0|GPX4_MESCR Probable phospholipid hydroperoxide glutathione peroxidase OS=Mesembryanthemum crystallinum GN=GPXMC1 PE=2 SV=1 Back     alignment and function description
>sp|P30708|GPX4_NICSY Probable phospholipid hydroperoxide glutathione peroxidase OS=Nicotiana sylvestris PE=2 SV=1 Back     alignment and function description
>sp|Q9FXS3|GPX4_TOBAC Probable phospholipid hydroperoxide glutathione peroxidase OS=Nicotiana tabacum PE=2 SV=1 Back     alignment and function description
>sp|O23814|GPX4_SPIOL Probable phospholipid hydroperoxide glutathione peroxidase OS=Spinacia oleracea PE=2 SV=1 Back     alignment and function description
>sp|O24031|GPX4_SOLLC Probable phospholipid hydroperoxide glutathione peroxidase OS=Solanum lycopersicum GN=GPXle-1 PE=2 SV=1 Back     alignment and function description
>sp|O49069|GPX4_GOSHI Probable phospholipid hydroperoxide glutathione peroxidase OS=Gossypium hirsutum PE=2 SV=1 Back     alignment and function description
>sp|Q9SZ54|GPX7_ARATH Putative glutathione peroxidase 7, chloroplastic OS=Arabidopsis thaliana GN=GPX7 PE=3 SV=2 Back     alignment and function description
>sp|O23970|GPX1_HELAN Glutathione peroxidase 1 OS=Helianthus annuus GN=GPXHA-1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query189
34786892167 phospholipid hydroperoxide glutathione p 0.539 0.610 1.0 1e-53
544437167 RecName: Full=Probable phospholipid hydr 0.539 0.610 0.990 2e-53
224071850251 glutathione peroxidase [Populus trichoca 0.878 0.661 0.606 4e-51
356528228225 PREDICTED: probable phospholipid hydrope 0.899 0.755 0.612 5e-51
118485257238 unknown [Populus trichocarpa] 0.878 0.697 0.606 5e-51
449452336241 PREDICTED: probable phospholipid hydrope 0.894 0.701 0.597 4e-50
255628131225 unknown [Glycine max] 0.899 0.755 0.606 4e-50
206604173185 glutathione peroxidase [Cucumis sativus] 0.634 0.648 0.776 2e-49
37930463236 glutathione peroxidase 1 [Lotus japonicu 0.798 0.639 0.647 4e-49
121078789173 glutathione peroxidase [Prunus avium] 0.592 0.647 0.791 5e-47
>gi|34786892|emb|CAE46896.1| phospholipid hydroperoxide glutathione peroxidase [Citrus sinensis] Back     alignment and taxonomy information
 Score =  214 bits (545), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 102/102 (100%), Positives = 102/102 (100%)

Query: 61  MASQSKTSVHDFSVKDAKGQDVDLSIYKGKLLLIVNVASQCGLTNSNYTELSQLYDKYKN 120
           MASQSKTSVHDFSVKDAKGQDVDLSIYKGKLLLIVNVASQCGLTNSNYTELSQLYDKYKN
Sbjct: 1   MASQSKTSVHDFSVKDAKGQDVDLSIYKGKLLLIVNVASQCGLTNSNYTELSQLYDKYKN 60

Query: 121 QGLEILAFPCNQFGAQEPGDNEQIQEFACTRFKAEFPIFDKV 162
           QGLEILAFPCNQFGAQEPGDNEQIQEFACTRFKAEFPIFDKV
Sbjct: 61  QGLEILAFPCNQFGAQEPGDNEQIQEFACTRFKAEFPIFDKV 102

Source: Citrus sinensis

Species: Citrus sinensis

Genus: Citrus

Family: Rutaceae

Order: Sapindales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|544437|sp|Q06652.1|GPX4_CITSI RecName: Full=Probable phospholipid hydroperoxide glutathione peroxidase; Short=PHGPx; AltName: Full=Salt-associated protein gi|296358|emb|CAA47018.1| CIT-SAP [Citrus sinensis] gi|119367482|gb|ABL67656.1| putative phospholipid hydroperoxide glutathione peroxidase [Citrus hybrid cultivar] Back     alignment and taxonomy information
>gi|224071850|ref|XP_002303583.1| glutathione peroxidase [Populus trichocarpa] gi|222841015|gb|EEE78562.1| glutathione peroxidase [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356528228|ref|XP_003532707.1| PREDICTED: probable phospholipid hydroperoxide glutathione peroxidase [Glycine max] Back     alignment and taxonomy information
>gi|118485257|gb|ABK94488.1| unknown [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449452336|ref|XP_004143915.1| PREDICTED: probable phospholipid hydroperoxide glutathione peroxidase 6, mitochondrial-like [Cucumis sativus] gi|449495824|ref|XP_004159955.1| PREDICTED: probable phospholipid hydroperoxide glutathione peroxidase 6, mitochondrial-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|255628131|gb|ACU14410.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|206604173|gb|ACI16507.1| glutathione peroxidase [Cucumis sativus] Back     alignment and taxonomy information
>gi|37930463|gb|AAP69867.1| glutathione peroxidase 1 [Lotus japonicus] Back     alignment and taxonomy information
>gi|121078789|gb|ABM47416.1| glutathione peroxidase [Prunus avium] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query189
TAIR|locus:2139712232 GPX6 "glutathione peroxidase 6 0.910 0.741 0.569 3.1e-44
TAIR|locus:2116782233 GPX7 "glutathione peroxidase 7 0.640 0.519 0.651 2.6e-38
TAIR|locus:2040179236 GPX1 "glutathione peroxidase 1 0.645 0.516 0.650 1.5e-37
TAIR|locus:2065928169 GPX2 "glutathione peroxidase 2 0.592 0.662 0.649 7.2e-36
TAIR|locus:2031331167 GPX8 "AT1G63460" [Arabidopsis 0.597 0.676 0.618 9.2e-36
TAIR|locus:2099252173 GPX5 "glutathione peroxidase 5 0.597 0.653 0.593 2.4e-35
TAIR|locus:2039346170 GPX4 "glutathione peroxidase 4 0.587 0.652 0.594 3.2e-33
TAIR|locus:2058233206 GPX3 "glutathione peroxidase 3 0.624 0.572 0.577 5.2e-33
WB|WBGene00009165163 gpx-1 [Caenorhabditis elegans 0.603 0.699 0.537 6.4e-28
WB|WBGene00011045163 gpx-2 [Caenorhabditis elegans 0.566 0.656 0.544 7.3e-27
TAIR|locus:2139712 GPX6 "glutathione peroxidase 6" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 466 (169.1 bits), Expect = 3.1e-44, P = 3.1e-44
 Identities = 103/181 (56%), Positives = 127/181 (70%)

Query:     1 MLRCCASRYLLKRNLGIATSLILTRHFTSNCKQTLLRP--SKSNPISL-VSRPCFFASRS 57
             MLR       ++R   +  SL  +   +S+ +    +P  +    ISL +S      SRS
Sbjct:     1 MLRSSIRLLYIRRTSPLLRSLSSSSSSSSSKRFDSAKPLFNSHRIISLPISTTGAKLSRS 60

Query:    58 DHTMASQSKT-SVHDFSVKDAKGQDVDLSIYKGKLLLIVNVASQCGLTNSNYTELSQLYD 116
             +H+MA+ S+  S++DF+VKDAKG DVDLSIYKGK+LLIVNVASQCGLTNSNYTEL+QLY+
Sbjct:    61 EHSMAASSEPKSLYDFTVKDAKGNDVDLSIYKGKVLLIVNVASQCGLTNSNYTELAQLYE 120

Query:   117 KYKNQGLEILAFPCNQFGAQEPGDNEQIQEFACTRFKAEFPIFDKV-----LALQLYKFY 171
             KYK  G EILAFPCNQFG QEPG NE+I +FACTRFKAE+PIFDKV      A  +YKF 
Sbjct:   121 KYKGHGFEILAFPCNQFGNQEPGTNEEIVQFACTRFKAEYPIFDKVDVNGDKAAPVYKFL 180

Query:   172 K 172
             K
Sbjct:   181 K 181
GO:0004602 "glutathione peroxidase activity" evidence=IEA;ISS
GO:0005739 "mitochondrion" evidence=ISM;IDA;TAS
GO:0006979 "response to oxidative stress" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0005829 "cytosol" evidence=IDA;TAS
GO:0005886 "plasma membrane" evidence=IDA
GO:0046686 "response to cadmium ion" evidence=IEP
GO:0009651 "response to salt stress" evidence=IEP
GO:0009507 "chloroplast" evidence=IDA
GO:0048046 "apoplast" evidence=IDA
GO:0006333 "chromatin assembly or disassembly" evidence=RCA
GO:0007623 "circadian rhythm" evidence=RCA
GO:0009407 "toxin catabolic process" evidence=RCA
TAIR|locus:2116782 GPX7 "glutathione peroxidase 7" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2040179 GPX1 "glutathione peroxidase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2065928 GPX2 "glutathione peroxidase 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2031331 GPX8 "AT1G63460" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2099252 GPX5 "glutathione peroxidase 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2039346 GPX4 "glutathione peroxidase 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2058233 GPX3 "glutathione peroxidase 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
WB|WBGene00009165 gpx-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
WB|WBGene00011045 gpx-2 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q06652GPX4_CITSI1, ., 1, 1, ., 1, ., 1, 20.99010.53960.6107nono
O48646GPX6_ARATH1, ., 1, 1, ., 1, ., 1, 20.73380.62430.5086yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query189
PLN02399236 PLN02399, PLN02399, phospholipid hydroperoxide glu 1e-57
PLN02412167 PLN02412, PLN02412, probable glutathione peroxidas 2e-55
cd00340152 cd00340, GSH_Peroxidase, Glutathione (GSH) peroxid 1e-53
pfam00255108 pfam00255, GSHPx, Glutathione peroxidase 2e-50
COG0386162 COG0386, BtuE, Glutathione peroxidase [Posttransla 1e-47
PTZ00256183 PTZ00256, PTZ00256, glutathione peroxidase; Provis 2e-38
PRK10606183 PRK10606, btuE, putative glutathione peroxidase; P 2e-32
TIGR02540153 TIGR02540, gpx7, putative glutathione peroxidase G 5e-31
PTZ00056199 PTZ00056, PTZ00056, glutathione peroxidase; Provis 7e-25
cd02966116 cd02966, TlpA_like_family, TlpA-like family; compo 1e-08
pfam00578124 pfam00578, AhpC-TSA, AhpC/TSA family 2e-05
PRK03147173 PRK03147, PRK03147, thiol-disulfide oxidoreductase 9e-05
pfam08534142 pfam08534, Redoxin, Redoxin 0.001
>gnl|CDD|178021 PLN02399, PLN02399, phospholipid hydroperoxide glutathione peroxidase Back     alignment and domain information 
 Score =  180 bits (458), Expect = 1e-57
 Identities = 86/152 (56%), Positives = 106/152 (69%), Gaps = 13/152 (8%)

Query: 11  LKRNLGIATSLILTRHFTSNCKQTLLRPSKSNPISLVSRPCFFASRSDHTMASQSKTSVH 70
           LK + GI+ S  L+  F+       L+   S      SR     +R+       ++ SVH
Sbjct: 34  LKSSTGISKSAFLSNGFS-------LKSPNSPGFLSKSRSFGVYARA------ATEKSVH 80

Query: 71  DFSVKDAKGQDVDLSIYKGKLLLIVNVASQCGLTNSNYTELSQLYDKYKNQGLEILAFPC 130
           DF+VKD  G+DV LS +KGK+LLIVNVAS+CGLT+SNY+ELS LY+KYK QG EILAFPC
Sbjct: 81  DFTVKDIDGKDVALSKFKGKVLLIVNVASKCGLTSSNYSELSHLYEKYKTQGFEILAFPC 140

Query: 131 NQFGAQEPGDNEQIQEFACTRFKAEFPIFDKV 162
           NQFG QEPG N +I++FACTRFKAEFPIFDKV
Sbjct: 141 NQFGGQEPGSNPEIKQFACTRFKAEFPIFDKV 172

Length = 236
>gnl|CDD|166053 PLN02412, PLN02412, probable glutathione peroxidase Back     alignment and domain information
>gnl|CDD|238207 cd00340, GSH_Peroxidase, Glutathione (GSH) peroxidase family; tetrameric selenoenzymes that catalyze the reduction of a variety of hydroperoxides including lipid peroxidases, using GSH as a specific electron donor substrate Back     alignment and domain information
>gnl|CDD|201117 pfam00255, GSHPx, Glutathione peroxidase Back     alignment and domain information
>gnl|CDD|223463 COG0386, BtuE, Glutathione peroxidase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|173495 PTZ00256, PTZ00256, glutathione peroxidase; Provisional Back     alignment and domain information
>gnl|CDD|182585 PRK10606, btuE, putative glutathione peroxidase; Provisional Back     alignment and domain information
>gnl|CDD|131592 TIGR02540, gpx7, putative glutathione peroxidase Gpx7 Back     alignment and domain information
>gnl|CDD|240248 PTZ00056, PTZ00056, glutathione peroxidase; Provisional Back     alignment and domain information
>gnl|CDD|239264 cd02966, TlpA_like_family, TlpA-like family; composed of TlpA, ResA, DsbE and similar proteins Back     alignment and domain information
>gnl|CDD|216002 pfam00578, AhpC-TSA, AhpC/TSA family Back     alignment and domain information
>gnl|CDD|179545 PRK03147, PRK03147, thiol-disulfide oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|219888 pfam08534, Redoxin, Redoxin Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 189
PRK10606183 btuE putative glutathione peroxidase; Provisional 99.94
PTZ00056199 glutathione peroxidase; Provisional 99.94
cd00340152 GSH_Peroxidase Glutathione (GSH) peroxidase family 99.92
PLN02399236 phospholipid hydroperoxide glutathione peroxidase 99.92
PLN02412167 probable glutathione peroxidase 99.92
PTZ00256183 glutathione peroxidase; Provisional 99.91
TIGR02540153 gpx7 putative glutathione peroxidase Gpx7. This mo 99.91
COG0386162 BtuE Glutathione peroxidase [Posttranslational mod 99.88
PF00578124 AhpC-TSA: AhpC/TSA family; InterPro: IPR000866 Per 99.88
PF00255108 GSHPx: Glutathione peroxidase; InterPro: IPR000889 99.88
PF08534146 Redoxin: Redoxin; InterPro: IPR013740 This redoxin 99.86
cd03018149 PRX_AhpE_like Peroxiredoxin (PRX) family, AhpE-lik 99.85
PRK00522167 tpx lipid hydroperoxide peroxidase; Provisional 99.85
cd03014143 PRX_Atyp2cys Peroxiredoxin (PRX) family, Atypical 99.85
PRK09437154 bcp thioredoxin-dependent thiol peroxidase; Review 99.84
COG1225157 Bcp Peroxiredoxin [Posttranslational modification, 99.84
cd03017140 PRX_BCP Peroxiredoxin (PRX) family, Bacterioferrit 99.83
KOG1651171 consensus Glutathione peroxidase [Posttranslationa 99.83
cd02968142 SCO SCO (an acronym for Synthesis of Cytochrome c 99.83
cd03015173 PRX_Typ2cys Peroxiredoxin (PRX) family, Typical 2- 99.82
TIGR03137187 AhpC peroxiredoxin. This gene contains two invaria 99.82
cd02969171 PRX_like1 Peroxiredoxin (PRX)-like 1 family; hypot 99.82
cd03012126 TlpA_like_DipZ_like TlpA-like family, DipZ-like su 99.81
PRK03147173 thiol-disulfide oxidoreductase; Provisional 99.8
cd02970149 PRX_like2 Peroxiredoxin (PRX)-like 2 family; hypot 99.8
cd02971140 PRX_family Peroxiredoxin (PRX) family; composed of 99.8
PRK15412185 thiol:disulfide interchange protein DsbE; Provisio 99.78
PRK13190202 putative peroxiredoxin; Provisional 99.78
cd02967114 mauD Methylamine utilization (mau) D family; mauD 99.78
cd03010127 TlpA_like_DsbE TlpA-like family, DsbE (also known 99.77
cd03008146 TryX_like_RdCVF Tryparedoxin (TryX)-like family, R 99.77
PRK10382187 alkyl hydroperoxide reductase subunit C; Provision 99.77
PRK13599215 putative peroxiredoxin; Provisional 99.77
cd03016203 PRX_1cys Peroxiredoxin (PRX) family, 1-cys PRX sub 99.76
TIGR02661189 MauD methylamine dehydrogenase accessory protein M 99.76
PRK14018 521 trifunctional thioredoxin/methionine sulfoxide red 99.75
PRK13191215 putative peroxiredoxin; Provisional 99.75
PRK15000200 peroxidase; Provisional 99.74
TIGR00385173 dsbE periplasmic protein thiol:disulfide oxidoredu 99.73
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 99.73
PTZ00137261 2-Cys peroxiredoxin; Provisional 99.73
PTZ00253199 tryparedoxin peroxidase; Provisional 99.72
PRK13189222 peroxiredoxin; Provisional 99.7
cd03011123 TlpA_like_ScsD_MtbDsbE TlpA-like family, suppresso 99.69
cd02966116 TlpA_like_family TlpA-like family; composed of Tlp 99.69
cd03013155 PRX5_like Peroxiredoxin (PRX) family, PRX5-like su 99.68
cd02964132 TryX_like_family Tryparedoxin (TryX)-like family; 99.68
cd03009131 TryX_like_TryX_NRX Tryparedoxin (TryX)-like family 99.66
PF1390595 Thioredoxin_8: Thioredoxin-like; PDB: 1FG4_A 1I5G_ 99.6
TIGR01626184 ytfJ_HI0045 conserved hypothetical protein YtfJ-fa 99.6
PF02630174 SCO1-SenC: SCO1/SenC; InterPro: IPR003782 This fam 99.59
PRK13728181 conjugal transfer protein TrbB; Provisional 99.56
COG0450194 AhpC Peroxiredoxin [Posttranslational modification 99.49
COG1999207 Uncharacterized protein SCO1/SenC/PrrC, involved i 99.4
cd02985103 TRX_CDSP32 TRX family, chloroplastic drought-induc 99.39
KOG0855211 consensus Alkyl hydroperoxide reductase, thiol spe 99.37
cd02950142 TxlA TRX-like protein A (TxlA) family; TxlA was or 99.28
TIGR02738153 TrbB type-F conjugative transfer system pilin asse 99.27
cd02948102 TRX_NDPK TRX domain, TRX and NDP-kinase (NDPK) fus 99.25
KOG2501157 consensus Thioredoxin, nucleoredoxin and related p 99.21
cd02999100 PDI_a_ERp44_like PDIa family, endoplasmic reticulu 99.19
cd02954114 DIM1 Dim1 family; Dim1 is also referred to as U5 s 99.19
cd02986114 DLP Dim1 family, Dim1-like protein (DLP) subfamily 99.11
KOG0910150 consensus Thioredoxin-like protein [Posttranslatio 99.09
cd02963111 TRX_DnaJ TRX domain, DnaJ domain containing protei 99.08
KOG0907106 consensus Thioredoxin [Posttranslational modificat 99.05
cd03003101 PDI_a_ERdj5_N PDIa family, N-terminal ERdj5 subfam 99.05
PHA02278103 thioredoxin-like protein 99.03
cd0295696 ybbN ybbN protein family; ybbN is a hypothetical p 99.01
KOG2792280 consensus Putative cytochrome C oxidase assembly p 99.01
cd03006113 PDI_a_EFP1_N PDIa family, N-terminal EFP1 subfamil 99.01
cd02993109 PDI_a_APS_reductase PDIa family, 5'-Adenylylsulfat 99.0
cd02953104 DsbDgamma DsbD gamma family; DsbD gamma is the C-t 99.0
COG3118 304 Thioredoxin domain-containing protein [Posttransla 99.0
cd02962152 TMX2 TMX2 family; composed of proteins similar to 98.99
cd03002109 PDI_a_MPD1_like PDI family, MPD1-like subfamily; c 98.97
KOG0854224 consensus Alkyl hydroperoxide reductase, thiol spe 98.97
PLN00410142 U5 snRNP protein, DIM1 family; Provisional 98.97
TIGR02740271 TraF-like TraF-like protein. This protein is relat 98.95
cd03004104 PDI_a_ERdj5_C PDIa family, C-terminal ERdj5 subfam 98.94
cd02994101 PDI_a_TMX PDIa family, TMX subfamily; composed of 98.93
PRK09381109 trxA thioredoxin; Provisional 98.9
cd03000104 PDI_a_TMX3 PDIa family, TMX3 subfamily; composed o 98.88
COG2077158 Tpx Peroxiredoxin [Posttranslational modification, 98.84
PRK10996139 thioredoxin 2; Provisional 98.84
cd02952119 TRP14_like Human TRX-related protein 14 (TRP14)-li 98.83
cd02959117 ERp19 Endoplasmic reticulum protein 19 (ERp19) fam 98.82
cd02997104 PDI_a_PDIR PDIa family, PDIR subfamily; composed o 98.81
TIGR01295122 PedC_BrcD bacteriocin transport accessory protein, 98.79
cd03005102 PDI_a_ERp46 PDIa family, endoplasmic reticulum pro 98.79
cd02951125 SoxW SoxW family; SoxW is a bacterial periplasmic 98.79
cd02992114 PDI_a_QSOX PDIa family, Quiescin-sulfhydryl oxidas 98.79
cd02957113 Phd_like Phosducin (Phd)-like family; composed of 98.77
cd02996108 PDI_a_ERp44 PDIa family, endoplasmic reticulum pro 98.75
cd0294997 TRX_NTR TRX domain, novel NADPH thioredoxin reduct 98.73
cd02989113 Phd_like_TxnDC9 Phosducin (Phd)-like family, Thior 98.73
PF00085103 Thioredoxin: Thioredoxin; InterPro: IPR013766 Thio 98.73
cd0298497 TRX_PICOT TRX domain, PICOT (for PKC-interacting c 98.72
TIGR00424463 APS_reduc 5'-adenylylsulfate reductase, thioredoxi 98.71
cd02995104 PDI_a_PDI_a'_C PDIa family, C-terminal TRX domain 98.69
PTZ0005198 thioredoxin; Provisional 98.69
cd02998105 PDI_a_ERp38 PDIa family, endoplasmic reticulum pro 98.68
TIGR01126102 pdi_dom protein disulfide-isomerase domain. This m 98.65
TIGR01068101 thioredoxin thioredoxin. Several proteins, such as 98.64
cd03001103 PDI_a_P5 PDIa family, P5 subfamily; composed of eu 98.61
cd02965111 HyaE HyaE family; HyaE is also called HupG and Hox 98.57
PTZ00443224 Thioredoxin domain-containing protein; Provisional 98.56
cd02987175 Phd_like_Phd Phosducin (Phd)-like family, Phd subf 98.56
PLN02309457 5'-adenylylsulfate reductase 98.55
KOG0852196 consensus Alkyl hydroperoxide reductase, thiol spe 98.54
cd02975113 PfPDO_like_N Pyrococcus furiosus protein disulfide 98.5
COG0526127 TrxA Thiol-disulfide isomerase and thioredoxins [P 98.46
TIGR0041182 redox_disulf_1 small redox-active disulfide protei 98.46
KOG0908 288 consensus Thioredoxin-like protein [Posttranslatio 98.42
cd02961101 PDI_a_family Protein Disulfide Isomerase (PDIa) fa 98.42
PTZ00102477 disulphide isomerase; Provisional 98.42
cd02982103 PDI_b'_family Protein Disulfide Isomerase (PDIb') 98.41
cd03065120 PDI_b_Calsequestrin_N PDIb family, Calsequestrin s 98.4
cd02988192 Phd_like_VIAF Phosducin (Phd)-like family, Viral i 98.39
PRK00293571 dipZ thiol:disulfide interchange protein precursor 98.34
cd0294793 TRX_family TRX family; composed of two groups: Gro 98.31
TIGR0041276 redox_disulf_2 small redox-active disulfide protei 98.22
PF13098112 Thioredoxin_2: Thioredoxin-like domain; PDB: 1T3B_ 98.19
TIGR01130 462 ER_PDI_fam protein disulfide isomerases, eukaryoti 98.17
PTZ00062204 glutaredoxin; Provisional 98.17
cd02955124 SSP411 TRX domain, SSP411 protein family; members 98.16
TIGR01130462 ER_PDI_fam protein disulfide isomerases, eukaryoti 98.06
PF00837237 T4_deiodinase: Iodothyronine deiodinase; InterPro: 98.05
PF1389982 Thioredoxin_7: Thioredoxin-like; PDB: 2LST_A 3PH9_ 98.03
cd0297367 TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)- 98.02
PTZ00102 477 disulphide isomerase; Provisional 98.0
cd0165969 TRX_superfamily Thioredoxin (TRX) superfamily; a l 97.97
PHA0212575 thioredoxin-like protein 97.87
cd0302689 AhpF_NTD_C TRX-GRX-like family, Alkyl hydroperoxid 97.87
TIGR02187215 GlrX_arch Glutaredoxin-like domain protein. This f 97.84
TIGR0218084 GRX_euk Glutaredoxin. This model represents eukary 97.83
TIGR02187215 GlrX_arch Glutaredoxin-like domain protein. This f 97.82
TIGR0219674 GlrX_YruB Glutaredoxin-like protein, YruB-family. 97.79
KOG0190 493 consensus Protein disulfide isomerase (prolyl 4-hy 97.69
PF04592 238 SelP_N: Selenoprotein P, N terminal region; InterP 97.68
COG0678165 AHP1 Peroxiredoxin [Posttranslational modification 97.6
KOG0191 383 consensus Thioredoxin/protein disulfide isomerase 97.59
KOG0190493 consensus Protein disulfide isomerase (prolyl 4-hy 97.51
PF13728215 TraF: F plasmid transfer operon protein 97.51
TIGR0220077 GlrX_actino Glutaredoxin-like protein. This family 97.42
cd02960130 AGR Anterior Gradient (AGR) family; members of thi 97.38
PF05988211 DUF899: Bacterial protein of unknown function (DUF 97.32
PF14595129 Thioredoxin_9: Thioredoxin; PDB: 1Z6N_A. 97.23
cd02958114 UAS UAS family; UAS is a domain of unknown functio 97.22
TIGR02739256 TraF type-F conjugative transfer system pilin asse 97.2
smart00594122 UAS UAS domain. 97.03
PRK13703248 conjugal pilus assembly protein TraF; Provisional 97.0
cd03007116 PDI_a_ERp29_N PDIa family, endoplasmic reticulum p 96.98
PRK1120085 grxA glutaredoxin 1; Provisional 96.95
cd0297673 NrdH NrdH-redoxin (NrdH) family; NrdH is a small m 96.8
PF06110119 DUF953: Eukaryotic protein of unknown function (DU 96.76
KOG1731 606 consensus FAD-dependent sulfhydryl oxidase/quiesci 96.7
KOG0541171 consensus Alkyl hydroperoxide reductase/peroxiredo 96.67
cd0341982 GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX h 96.55
cd03023154 DsbA_Com1_like DsbA family, Com1-like subfamily; c 96.53
PF13911115 AhpC-TSA_2: AhpC/TSA antioxidant enzyme 96.51
KOG3425128 consensus Uncharacterized conserved protein [Funct 96.45
PF0046260 Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Gl 96.34
KOG0912 375 consensus Thiol-disulfide isomerase and thioredoxi 96.34
PF13462162 Thioredoxin_4: Thioredoxin; PDB: 3FEU_A 3HZ8_A 3DV 96.33
cd0206672 GRX_family Glutaredoxin (GRX) family; composed of 96.25
TIGR0218386 GRXA Glutaredoxin, GrxA family. This model include 96.25
COG4232569 Thiol:disulfide interchange protein [Posttranslati 96.18
cd0341875 GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX b 96.02
KOG4277 468 consensus Uncharacterized conserved protein, conta 95.93
TIGR0218179 GRX_bact Glutaredoxin, GrxC family. This family of 95.93
TIGR0219079 GlrX-dom Glutaredoxin-family domain. This C-termin 95.84
PRK1032981 glutaredoxin-like protein; Provisional 95.6
cd03019178 DsbA_DsbA DsbA family, DsbA subfamily; DsbA is a m 95.36
KOG0191 383 consensus Thioredoxin/protein disulfide isomerase 95.3
PHA03050108 glutaredoxin; Provisional 95.2
TIGR0219472 GlrX_NrdH Glutaredoxin-like protein NrdH. NrdH-red 94.98
COG4312247 Uncharacterized protein conserved in bacteria [Fun 94.87
COG069580 GrxC Glutaredoxin and related proteins [Posttransl 94.8
cd0302773 GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Eg 94.69
cd0302972 GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hyb 94.35
TIGR0036597 monothiol glutaredoxin, Grx4 family. The gene for 94.28
TIGR0218999 GlrX-like_plant Glutaredoxin-like family. This fam 94.21
cd03020197 DsbA_DsbC_DsbG DsbA family, DsbC and DsbG subfamil 94.16
cd0302890 GRX_PICOT_like Glutaredoxin (GRX) family, PKC-inte 93.91
KOG0911 227 consensus Glutaredoxin-related protein [Posttransl 93.87
KOG0914265 consensus Thioredoxin-like protein [Posttranslatio 93.74
PRK1063883 glutaredoxin 3; Provisional 93.27
PRK10877232 protein disulfide isomerase II DsbC; Provisional 93.24
cd0297298 DsbA_family DsbA family; consists of DsbA and DsbA 92.92
PRK10954207 periplasmic protein disulfide isomerase I; Provisi 92.55
KOG4498197 consensus Uncharacterized conserved protein [Funct 92.43
PF03190163 Thioredox_DsbH: Protein of unknown function, DUF25 92.12
PRK10824115 glutaredoxin-4; Provisional 91.56
cd03035105 ArsC_Yffb Arsenate Reductase (ArsC) family, Yffb s 91.22
KOG1752104 consensus Glutaredoxin and related proteins [Postt 91.18
cd03036111 ArsC_like Arsenate Reductase (ArsC) family, unknow 90.83
cd02991116 UAS_ETEA UAS family, ETEA subfamily; composed of p 90.78
cd03032115 ArsC_Spx Arsenate Reductase (ArsC) family, Spx sub 90.74
TIGR01617117 arsC_related transcriptional regulator, Spx/MgsR f 90.61
cd02977105 ArsC_family Arsenate Reductase (ArsC) family; comp 90.59
PF1319276 Thioredoxin_3: Thioredoxin domain; PDB: 1ZYP_B 1ZY 90.39
KOG3414142 consensus Component of the U4/U6.U5 snRNP/mitosis 89.99
PRK01655131 spxA transcriptional regulator Spx; Reviewed 89.88
PF0576881 DUF836: Glutaredoxin-like domain (DUF836); InterPr 89.63
PRK11657251 dsbG disulfide isomerase/thiol-disulfide oxidase; 89.6
COG1651244 DsbG Protein-disulfide isomerase [Posttranslationa 89.22
PF02114265 Phosducin: Phosducin; InterPro: IPR024253 The oute 88.85
PRK12559131 transcriptional regulator Spx; Provisional 88.12
PTZ00062204 glutaredoxin; Provisional 88.12
PF11009105 DUF2847: Protein of unknown function (DUF2847); In 86.73
PRK13344132 spxA transcriptional regulator Spx; Reviewed 83.84
TIGR03759200 conj_TIGR03759 integrating conjugative element pro 83.42
TIGR03143555 AhpF_homolog putative alkyl hydroperoxide reductas 83.12
PF09695160 YtfJ_HI0045: Bacterial protein of unknown function 83.02
PF02966133 DIM1: Mitosis protein DIM1; InterPro: IPR004123 Th 81.39
KOG2961190 consensus Predicted hydrolase (HAD superfamily) [G 80.61
>PRK10606 btuE putative glutathione peroxidase; Provisional Back     alignment and domain information 
Probab=99.94  E-value=1.8e-26  Score=177.35  Aligned_cols=110  Identities=38%  Similarity=0.694  Sum_probs=102.0

Q ss_pred             CcccCeEEeCCCCCeeecCccCCCEEEEEEecCCCcccHHHHHHHHHHHHHhccCCcEEEEEecCCCCCCCCCCHHHHHH
Q 029690           67 TSVHDFSVKDAKGQDVDLSIYKGKLLLIVNVASQCGLTNSNYTELSQLYDKYKNQGLEILAFPCNQFGAQEPGDNEQIQE  146 (189)
Q Consensus        67 ~~~p~f~l~d~~G~~~~l~~~~gk~vlv~F~a~~C~~C~~~~~~l~~l~~~~~~~~v~vi~vs~d~~~~~~~~~~~~~~~  146 (189)
                      ..+++|+++|++|+.++|++++||++||+|||+||++|. +++.|++++++|+++|+.|++|+.|+|+.+++++.+++++
T Consensus         3 ~~~~~f~~~~~~G~~v~Ls~~~GKvvLVvf~AS~C~~~~-q~~~L~~L~~~y~~~gl~Vlg~p~nqf~~qe~~~~~ei~~   81 (183)
T PRK10606          3 DSILTTVVTTIDGEVTTLEKYAGNVLLIVNVASKCGLTP-QYEQLENIQKAWADQGFVVLGFPCNQFLGQEPGSDEEIKT   81 (183)
T ss_pred             CCccCcEeECCCCCEEeHHHhCCCEEEEEEEeCCCCCcH-HHHHHHHHHHHHhhCCeEEEEeeccccccCCCCCHHHHHH
Confidence            468999999999999999999999999999999999995 7999999999999999999999999999999999999999


Q ss_pred             HHHhhCCcccceecccc-----chHHHHHHHhcCCC
Q 029690          147 FACTRFKAEFPIFDKVL-----ALQLYKFYKQKIHS  177 (189)
Q Consensus       147 ~~~~~~~~~fp~l~d~~-----~~p~~~~l~~~~~~  177 (189)
                      |+.++++++||++.+.+     +||+|+||+...+.
T Consensus        82 f~~~~~g~~Fpv~~k~dvnG~~~~pl~~~Lk~~~~~  117 (183)
T PRK10606         82 YCRTTWGVTFPMFSKIEVNGEGRHPLYQKLIAAAPT  117 (183)
T ss_pred             HHHHccCCCceeEEEEccCCCCCCHHHHHHHHhCCC
Confidence            99447999999996666     99999999987763

>PTZ00056 glutathione peroxidase; Provisional Back     alignment and domain information
>cd00340 GSH_Peroxidase Glutathione (GSH) peroxidase family; tetrameric selenoenzymes that catalyze the reduction of a variety of hydroperoxides including lipid peroxidases, using GSH as a specific electron donor substrate Back     alignment and domain information
>PLN02399 phospholipid hydroperoxide glutathione peroxidase Back     alignment and domain information
>PLN02412 probable glutathione peroxidase Back     alignment and domain information
>PTZ00256 glutathione peroxidase; Provisional Back     alignment and domain information
>TIGR02540 gpx7 putative glutathione peroxidase Gpx7 Back     alignment and domain information
>COG0386 BtuE Glutathione peroxidase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00578 AhpC-TSA: AhpC/TSA family; InterPro: IPR000866 Peroxiredoxins (Prxs) are a ubiquitous family of antioxidant enzymes that also control cytokine-induced peroxide levels which mediate signal transduction in mammalian cells Back     alignment and domain information
>PF00255 GSHPx: Glutathione peroxidase; InterPro: IPR000889 Glutathione peroxidase (GSHPx) (1 Back     alignment and domain information
>PF08534 Redoxin: Redoxin; InterPro: IPR013740 This redoxin domain is found in peroxiredoxin, thioredoxin and glutaredoxin proteins Back     alignment and domain information
>cd03018 PRX_AhpE_like Peroxiredoxin (PRX) family, AhpE-like subfamily; composed of proteins similar to Mycobacterium tuberculosis AhpE Back     alignment and domain information
>PRK00522 tpx lipid hydroperoxide peroxidase; Provisional Back     alignment and domain information
>cd03014 PRX_Atyp2cys Peroxiredoxin (PRX) family, Atypical 2-cys PRX subfamily; composed of PRXs containing peroxidatic and resolving cysteines, similar to the homodimeric thiol specific antioxidant (TSA) protein also known as TRX-dependent thiol peroxidase (Tpx) Back     alignment and domain information
>PRK09437 bcp thioredoxin-dependent thiol peroxidase; Reviewed Back     alignment and domain information
>COG1225 Bcp Peroxiredoxin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03017 PRX_BCP Peroxiredoxin (PRX) family, Bacterioferritin comigratory protein (BCP) subfamily; composed of thioredoxin-dependent thiol peroxidases, widely expressed in pathogenic bacteria, that protect cells against toxicity from reactive oxygen species by reducing and detoxifying hydroperoxides Back     alignment and domain information
>KOG1651 consensus Glutathione peroxidase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02968 SCO SCO (an acronym for Synthesis of Cytochrome c Oxidase) family; composed of proteins similar to Sco1, a membrane-anchored protein possessing a soluble domain with a TRX fold Back     alignment and domain information
>cd03015 PRX_Typ2cys Peroxiredoxin (PRX) family, Typical 2-Cys PRX subfamily; PRXs are thiol-specific antioxidant (TSA) proteins, which confer a protective role in cells through its peroxidase activity by reducing hydrogen peroxide, peroxynitrite, and organic hydroperoxides Back     alignment and domain information
>TIGR03137 AhpC peroxiredoxin Back     alignment and domain information
>cd02969 PRX_like1 Peroxiredoxin (PRX)-like 1 family; hypothetical proteins that show sequence similarity to PRXs Back     alignment and domain information
>cd03012 TlpA_like_DipZ_like TlpA-like family, DipZ-like subfamily; composed uncharacterized proteins containing a TlpA-like TRX domain Back     alignment and domain information
>PRK03147 thiol-disulfide oxidoreductase; Provisional Back     alignment and domain information
>cd02970 PRX_like2 Peroxiredoxin (PRX)-like 2 family; hypothetical proteins that show sequence similarity to PRXs Back     alignment and domain information
>cd02971 PRX_family Peroxiredoxin (PRX) family; composed of the different classes of PRXs including many proteins originally known as bacterioferritin comigratory proteins (BCP), based on their electrophoretic mobility before their function was identified Back     alignment and domain information
>PRK15412 thiol:disulfide interchange protein DsbE; Provisional Back     alignment and domain information
>PRK13190 putative peroxiredoxin; Provisional Back     alignment and domain information
>cd02967 mauD Methylamine utilization (mau) D family; mauD protein is the translation product of the mauD gene found in methylotrophic bacteria, which are able to use methylamine as a sole carbon source and a nitrogen source Back     alignment and domain information
>cd03010 TlpA_like_DsbE TlpA-like family, DsbE (also known as CcmG and CycY) subfamily; DsbE is a membrane-anchored, periplasmic TRX-like reductase containing a CXXC motif that specifically donates reducing equivalents to apocytochrome c via CcmH, another cytochrome c maturation (Ccm) factor with a redox active CXXC motif Back     alignment and domain information
>cd03008 TryX_like_RdCVF Tryparedoxin (TryX)-like family, Rod-derived cone viability factor (RdCVF) subfamily; RdCVF is a thioredoxin (TRX)-like protein specifically expressed in photoreceptors Back     alignment and domain information
>PRK10382 alkyl hydroperoxide reductase subunit C; Provisional Back     alignment and domain information
>PRK13599 putative peroxiredoxin; Provisional Back     alignment and domain information
>cd03016 PRX_1cys Peroxiredoxin (PRX) family, 1-cys PRX subfamily; composed of PRXs containing only one conserved cysteine, which serves as the peroxidatic cysteine Back     alignment and domain information
>TIGR02661 MauD methylamine dehydrogenase accessory protein MauD Back     alignment and domain information
>PRK14018 trifunctional thioredoxin/methionine sulfoxide reductase A/B protein; Provisional Back     alignment and domain information
>PRK13191 putative peroxiredoxin; Provisional Back     alignment and domain information
>PRK15000 peroxidase; Provisional Back     alignment and domain information
>TIGR00385 dsbE periplasmic protein thiol:disulfide oxidoreductases, DsbE subfamily Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PTZ00137 2-Cys peroxiredoxin; Provisional Back     alignment and domain information
>PTZ00253 tryparedoxin peroxidase; Provisional Back     alignment and domain information
>PRK13189 peroxiredoxin; Provisional Back     alignment and domain information
>cd03011 TlpA_like_ScsD_MtbDsbE TlpA-like family, suppressor for copper sensitivity D protein (ScsD) and actinobacterial DsbE homolog subfamily; composed of ScsD, the DsbE homolog of Mycobacterium tuberculosis (MtbDsbE) and similar proteins, all containing a redox-active CXXC motif Back     alignment and domain information
>cd02966 TlpA_like_family TlpA-like family; composed of TlpA, ResA, DsbE and similar proteins Back     alignment and domain information
>cd03013 PRX5_like Peroxiredoxin (PRX) family, PRX5-like subfamily; members are similar to the human protein, PRX5, a homodimeric TRX peroxidase, widely expressed in tissues and found cellularly in mitochondria, peroxisomes and the cytosol Back     alignment and domain information
>cd02964 TryX_like_family Tryparedoxin (TryX)-like family; composed of TryX and related proteins including nucleoredoxin (NRX), rod-derived cone viability factor (RdCVF) and the nematode homolog described as a 16-kD class of TRX Back     alignment and domain information
>cd03009 TryX_like_TryX_NRX Tryparedoxin (TryX)-like family, TryX and nucleoredoxin (NRX) subfamily; TryX and NRX are thioredoxin (TRX)-like protein disulfide oxidoreductases that alter the redox state of target proteins via the reversible oxidation of an active center CXXC motif Back     alignment and domain information
>PF13905 Thioredoxin_8: Thioredoxin-like; PDB: 1FG4_A 1I5G_A 1OC8_B 1O6J_A 1OC9_B 1O81_A 3FKF_A 1O85_A 1O7U_A 1O8W_A Back     alignment and domain information
>TIGR01626 ytfJ_HI0045 conserved hypothetical protein YtfJ-family, TIGR01626 Back     alignment and domain information
>PF02630 SCO1-SenC: SCO1/SenC; InterPro: IPR003782 This family is involved in biogenesis of respiratory and photosynthetic systems Back     alignment and domain information
>PRK13728 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>COG0450 AhpC Peroxiredoxin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1999 Uncharacterized protein SCO1/SenC/PrrC, involved in biogenesis of respiratory and photosynthetic systems [General function prediction only] Back     alignment and domain information
>cd02985 TRX_CDSP32 TRX family, chloroplastic drought-induced stress protein of 32 kD (CDSP32); CDSP32 is composed of two TRX domains, a C-terminal TRX domain which contains a redox active CXXC motif and an N-terminal TRX-like domain which contains an SXXS sequence instead of the redox active motif Back     alignment and domain information
>KOG0855 consensus Alkyl hydroperoxide reductase, thiol specific antioxidant and related enzymes [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02950 TxlA TRX-like protein A (TxlA) family; TxlA was originally isolated from the cyanobacterium Synechococcus Back     alignment and domain information
>TIGR02738 TrbB type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB Back     alignment and domain information
>cd02948 TRX_NDPK TRX domain, TRX and NDP-kinase (NDPK) fusion protein family; most members of this group are fusion proteins which contain one redox active TRX domain containing a CXXC motif and three NDPK domains, and are characterized as intermediate chains (ICs) of axonemal outer arm dynein Back     alignment and domain information
>KOG2501 consensus Thioredoxin, nucleoredoxin and related proteins [General function prediction only] Back     alignment and domain information
>cd02999 PDI_a_ERp44_like PDIa family, endoplasmic reticulum protein 44 (ERp44)-like subfamily; composed of uncharacterized PDI-like eukaryotic proteins containing only one redox active TRX (a) domain with a CXXS motif, similar to ERp44 Back     alignment and domain information
>cd02954 DIM1 Dim1 family; Dim1 is also referred to as U5 small nuclear ribonucleoprotein particle (snRNP)-specific 15kD protein Back     alignment and domain information
>cd02986 DLP Dim1 family, Dim1-like protein (DLP) subfamily; DLP is a novel protein which shares 38% sequence identity to Dim1 Back     alignment and domain information
>KOG0910 consensus Thioredoxin-like protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02963 TRX_DnaJ TRX domain, DnaJ domain containing protein family; composed of uncharacterized proteins of about 500-800 amino acids, containing an N-terminal DnaJ domain followed by one redox active TRX domain Back     alignment and domain information
>KOG0907 consensus Thioredoxin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03003 PDI_a_ERdj5_N PDIa family, N-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains Back     alignment and domain information
>PHA02278 thioredoxin-like protein Back     alignment and domain information
>cd02956 ybbN ybbN protein family; ybbN is a hypothetical protein containing a redox-inactive TRX-like domain Back     alignment and domain information
>KOG2792 consensus Putative cytochrome C oxidase assembly protein [Energy production and conversion] Back     alignment and domain information
>cd03006 PDI_a_EFP1_N PDIa family, N-terminal EFP1 subfamily; EFP1 is a binding partner protein of thyroid oxidase (ThOX), also called Duox Back     alignment and domain information
>cd02993 PDI_a_APS_reductase PDIa family, 5'-Adenylylsulfate (APS) reductase subfamily; composed of plant-type APS reductases containing a C-terminal redox active TRX domain and an N-terminal reductase domain which is part of a superfamily that includes N type ATP PPases Back     alignment and domain information
>cd02953 DsbDgamma DsbD gamma family; DsbD gamma is the C-terminal periplasmic domain of the bacterial protein DsbD Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02962 TMX2 TMX2 family; composed of proteins similar to human TMX2, a 372-amino acid TRX-related transmembrane protein, identified and characterized through the cloning of its cDNA from a human fetal library Back     alignment and domain information
>cd03002 PDI_a_MPD1_like PDI family, MPD1-like subfamily; composed of eukaryotic proteins similar to Saccharomyces cerevisiae MPD1 protein, which contains a single redox active TRX domain located at the N-terminus, and an ER retention signal at the C-terminus indicative of an ER-resident protein Back     alignment and domain information
>KOG0854 consensus Alkyl hydroperoxide reductase, thiol specific antioxidant and related enzymes [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN00410 U5 snRNP protein, DIM1 family; Provisional Back     alignment and domain information
>TIGR02740 TraF-like TraF-like protein Back     alignment and domain information
>cd03004 PDI_a_ERdj5_C PDIa family, C-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains Back     alignment and domain information
>cd02994 PDI_a_TMX PDIa family, TMX subfamily; composed of proteins similar to the TRX-related human transmembrane protein, TMX Back     alignment and domain information
>PRK09381 trxA thioredoxin; Provisional Back     alignment and domain information
>cd03000 PDI_a_TMX3 PDIa family, TMX3 subfamily; composed of eukaryotic proteins similar to human TMX3, a TRX related transmembrane protein containing one redox active TRX domain at the N-terminus and a classical ER retrieval sequence for type I transmembrane proteins at the C-terminus Back     alignment and domain information
>COG2077 Tpx Peroxiredoxin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10996 thioredoxin 2; Provisional Back     alignment and domain information
>cd02952 TRP14_like Human TRX-related protein 14 (TRP14)-like family; composed of proteins similar to TRP14, a 14kD cytosolic protein that shows disulfide reductase activity in vitro with a different substrate specificity compared with another human cytosolic protein, TRX1 Back     alignment and domain information
>cd02959 ERp19 Endoplasmic reticulum protein 19 (ERp19) family; ERp19 is also known as ERp18, a protein located in the ER containing one redox active TRX domain Back     alignment and domain information
>cd02997 PDI_a_PDIR PDIa family, PDIR subfamily; composed of proteins similar to human PDIR (for Protein Disulfide Isomerase Related) Back     alignment and domain information
>TIGR01295 PedC_BrcD bacteriocin transport accessory protein, putative Back     alignment and domain information
>cd03005 PDI_a_ERp46 PDIa family, endoplasmic reticulum protein 46 (ERp46) subfamily; ERp46 is an ER-resident protein containing three redox active TRX domains Back     alignment and domain information
>cd02951 SoxW SoxW family; SoxW is a bacterial periplasmic TRX, containing a redox active CXXC motif, encoded by a genetic locus (sox operon) involved in thiosulfate oxidation Back     alignment and domain information
>cd02992 PDI_a_QSOX PDIa family, Quiescin-sulfhydryl oxidase (QSOX) subfamily; QSOX is a eukaryotic protein containing an N-terminal redox active TRX domain, similar to that of PDI, and a small C-terminal flavin adenine dinucleotide (FAD)-binding domain homologous to the yeast ERV1p protein Back     alignment and domain information
>cd02957 Phd_like Phosducin (Phd)-like family; composed of Phd and Phd-like proteins (PhLP), characterized as cytosolic regulators of G protein functions Back     alignment and domain information
>cd02996 PDI_a_ERp44 PDIa family, endoplasmic reticulum protein 44 (ERp44) subfamily; ERp44 is an ER-resident protein, induced during stress, involved in thiol-mediated ER retention Back     alignment and domain information
>cd02949 TRX_NTR TRX domain, novel NADPH thioredoxin reductase (NTR) family; composed of fusion proteins found only in oxygenic photosynthetic organisms containing both TRX and NTR domains Back     alignment and domain information
>cd02989 Phd_like_TxnDC9 Phosducin (Phd)-like family, Thioredoxin (TRX) domain containing protein 9 (TxnDC9) subfamily; composed of predominantly uncharacterized eukaryotic proteins, containing a TRX-like domain without the redox active CXXC motif Back     alignment and domain information
>PF00085 Thioredoxin: Thioredoxin; InterPro: IPR013766 Thioredoxins [, , , ] are small disulphide-containing redox proteins that have been found in all the kingdoms of living organisms Back     alignment and domain information
>cd02984 TRX_PICOT TRX domain, PICOT (for PKC-interacting cousin of TRX) subfamily; PICOT is a protein that interacts with protein kinase C (PKC) theta, a calcium independent PKC isoform selectively expressed in skeletal muscle and T lymphocytes Back     alignment and domain information
>TIGR00424 APS_reduc 5'-adenylylsulfate reductase, thioredoxin-independent Back     alignment and domain information
>cd02995 PDI_a_PDI_a'_C PDIa family, C-terminal TRX domain (a') subfamily; composed of the C-terminal redox active a' domains of PDI, ERp72, ERp57 (or ERp60) and EFP1 Back     alignment and domain information
>PTZ00051 thioredoxin; Provisional Back     alignment and domain information
>cd02998 PDI_a_ERp38 PDIa family, endoplasmic reticulum protein 38 (ERp38) subfamily; composed of proteins similar to the P5-like protein first isolated from alfalfa, which contains two redox active TRX (a) domains at the N-terminus, like human P5, and a C-terminal domain with homology to the C-terminal domain of ERp29, unlike human P5 Back     alignment and domain information
>TIGR01126 pdi_dom protein disulfide-isomerase domain Back     alignment and domain information
>TIGR01068 thioredoxin thioredoxin Back     alignment and domain information
>cd03001 PDI_a_P5 PDIa family, P5 subfamily; composed of eukaryotic proteins similar to human P5, a PDI-related protein with a domain structure of aa'b (where a and a' are redox active TRX domains and b is a redox inactive TRX-like domain) Back     alignment and domain information
>cd02965 HyaE HyaE family; HyaE is also called HupG and HoxO Back     alignment and domain information
>PTZ00443 Thioredoxin domain-containing protein; Provisional Back     alignment and domain information
>cd02987 Phd_like_Phd Phosducin (Phd)-like family, Phd subfamily; Phd is a cytosolic regulator of G protein functions Back     alignment and domain information
>PLN02309 5'-adenylylsulfate reductase Back     alignment and domain information
>KOG0852 consensus Alkyl hydroperoxide reductase, thiol specific antioxidant and related enzymes [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02975 PfPDO_like_N Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO)-like family, N-terminal TRX-fold subdomain; composed of proteins with similarity to PfPDO, a redox active thermostable protein believed to be the archaeal counterpart of bacterial DsbA and eukaryotic protein disulfide isomerase (PDI), which are both involved in oxidative protein folding Back     alignment and domain information
>COG0526 TrxA Thiol-disulfide isomerase and thioredoxins [Posttranslational modification, protein turnover, chaperones / Energy production and conversion] Back     alignment and domain information
>TIGR00411 redox_disulf_1 small redox-active disulfide protein 1 Back     alignment and domain information
>KOG0908 consensus Thioredoxin-like protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02961 PDI_a_family Protein Disulfide Isomerase (PDIa) family, redox active TRX domains; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants Back     alignment and domain information
>PTZ00102 disulphide isomerase; Provisional Back     alignment and domain information
>cd02982 PDI_b'_family Protein Disulfide Isomerase (PDIb') family, redox inactive TRX-like domain b'; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants Back     alignment and domain information
>cd03065 PDI_b_Calsequestrin_N PDIb family, Calsequestrin subfamily, N-terminal TRX-fold domain; Calsequestrin is the major calcium storage protein in the sarcoplasmic reticulum (SR) of skeletal and cardiac muscle Back     alignment and domain information
>cd02988 Phd_like_VIAF Phosducin (Phd)-like family, Viral inhibitor of apoptosis (IAP)-associated factor (VIAF) subfamily; VIAF is a Phd-like protein that functions in caspase activation during apoptosis Back     alignment and domain information
>PRK00293 dipZ thiol:disulfide interchange protein precursor; Provisional Back     alignment and domain information
>cd02947 TRX_family TRX family; composed of two groups: Group I, which includes proteins that exclusively encode a TRX domain; and Group II, which are composed of fusion proteins of TRX and additional domains Back     alignment and domain information
>TIGR00412 redox_disulf_2 small redox-active disulfide protein 2 Back     alignment and domain information
>PF13098 Thioredoxin_2: Thioredoxin-like domain; PDB: 1T3B_A 2L57_A 1EEJ_B 1TJD_A 1JZD_B 1JZO_A 1G0T_B 3GV1_A 1V58_A 2H0H_A Back     alignment and domain information
>TIGR01130 ER_PDI_fam protein disulfide isomerases, eukaryotic Back     alignment and domain information
>PTZ00062 glutaredoxin; Provisional Back     alignment and domain information
>cd02955 SSP411 TRX domain, SSP411 protein family; members of this family are highly conserved proteins present in eukaryotes, bacteria and archaea, about 600-800 amino acids in length, which contain a TRX domain with a redox active CXXC motif Back     alignment and domain information
>TIGR01130 ER_PDI_fam protein disulfide isomerases, eukaryotic Back     alignment and domain information
>PF00837 T4_deiodinase: Iodothyronine deiodinase; InterPro: IPR000643 Iodothyronine deiodinase (1 Back     alignment and domain information
>PF13899 Thioredoxin_7: Thioredoxin-like; PDB: 2LST_A 3PH9_A 1UC7_A 2JU5_A 1VRS_D 2FWG_A 2FWF_A 2FWH_A 2FWE_A 3FK8_A Back     alignment and domain information
>cd02973 TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)-like family; composed of archaeal and bacterial proteins that show similarity to both TRX and GRX, including the C-terminal TRX-fold subdomain of Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO) Back     alignment and domain information
>PTZ00102 disulphide isomerase; Provisional Back     alignment and domain information
>cd01659 TRX_superfamily Thioredoxin (TRX) superfamily; a large, diverse group of proteins containing a TRX-fold Back     alignment and domain information
>PHA02125 thioredoxin-like protein Back     alignment and domain information
>cd03026 AhpF_NTD_C TRX-GRX-like family, Alkyl hydroperoxide reductase F subunit (AhpF) N-terminal domain (NTD) subfamily, C-terminal TRX-fold subdomain; AhpF is a homodimeric flavoenzyme which catalyzes the NADH-dependent reduction of the peroxiredoxin AhpC, which then reduces hydrogen peroxide and organic hydroperoxides Back     alignment and domain information
>TIGR02187 GlrX_arch Glutaredoxin-like domain protein Back     alignment and domain information
>TIGR02180 GRX_euk Glutaredoxin Back     alignment and domain information
>TIGR02187 GlrX_arch Glutaredoxin-like domain protein Back     alignment and domain information
>TIGR02196 GlrX_YruB Glutaredoxin-like protein, YruB-family Back     alignment and domain information
>KOG0190 consensus Protein disulfide isomerase (prolyl 4-hydroxylase beta subunit) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04592 SelP_N: Selenoprotein P, N terminal region; InterPro: IPR007671 SelP is the only known eukaryotic selenoprotein that contains multiple selenocysteine (Sec) residues, and accounts for more than 50% of the selenium content of rat and human plasma [] Back     alignment and domain information
>COG0678 AHP1 Peroxiredoxin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0191 consensus Thioredoxin/protein disulfide isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0190 consensus Protein disulfide isomerase (prolyl 4-hydroxylase beta subunit) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13728 TraF: F plasmid transfer operon protein Back     alignment and domain information
>TIGR02200 GlrX_actino Glutaredoxin-like protein Back     alignment and domain information
>cd02960 AGR Anterior Gradient (AGR) family; members of this family are similar to secreted proteins encoded by the cement gland-specific genes XAG-1 and XAG-2, expressed in the anterior region of dorsal ectoderm of Xenopus Back     alignment and domain information
>PF05988 DUF899: Bacterial protein of unknown function (DUF899); InterPro: IPR010296 This family consists of uncharacterised bacterial proteins of unknown function which are thioredoxin-like Back     alignment and domain information
>PF14595 Thioredoxin_9: Thioredoxin; PDB: 1Z6N_A Back     alignment and domain information
>cd02958 UAS UAS family; UAS is a domain of unknown function Back     alignment and domain information
>TIGR02739 TraF type-F conjugative transfer system pilin assembly protein TraF Back     alignment and domain information
>smart00594 UAS UAS domain Back     alignment and domain information
>PRK13703 conjugal pilus assembly protein TraF; Provisional Back     alignment and domain information
>cd03007 PDI_a_ERp29_N PDIa family, endoplasmic reticulum protein 29 (ERp29) subfamily; ERp29 is a ubiquitous ER-resident protein expressed in high levels in secretory cells Back     alignment and domain information
>PRK11200 grxA glutaredoxin 1; Provisional Back     alignment and domain information
>cd02976 NrdH NrdH-redoxin (NrdH) family; NrdH is a small monomeric protein with a conserved redox active CXXC motif within a TRX fold, characterized by a glutaredoxin (GRX)-like sequence and TRX-like activity profile Back     alignment and domain information
>PF06110 DUF953: Eukaryotic protein of unknown function (DUF953); InterPro: IPR010357 This family consists of several hypothetical eukaryotic proteins of unknown function that are thioredoxin-like Back     alignment and domain information
>KOG1731 consensus FAD-dependent sulfhydryl oxidase/quiescin and related proteins [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0541 consensus Alkyl hydroperoxide reductase/peroxiredoxin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03419 GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX human class 1 and 2 (h_1_2)-like subfamily; composed of proteins similar to human GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain Back     alignment and domain information
>cd03023 DsbA_Com1_like DsbA family, Com1-like subfamily; composed of proteins similar to Com1, a 27-kDa outer membrane-associated immunoreactive protein originally found in both acute and chronic disease strains of the pathogenic bacteria Coxiella burnetti Back     alignment and domain information
>PF13911 AhpC-TSA_2: AhpC/TSA antioxidant enzyme Back     alignment and domain information
>KOG3425 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00462 Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors Back     alignment and domain information
>KOG0912 consensus Thiol-disulfide isomerase and thioredoxin [Posttranslational modification, protein turnover, chaperones; Energy production and conversion] Back     alignment and domain information
>PF13462 Thioredoxin_4: Thioredoxin; PDB: 3FEU_A 3HZ8_A 3DVW_A 3A3T_E 3GMF_A 1Z6M_A 3GYK_C 3BCK_A 3BD2_A 3BCI_A Back     alignment and domain information
>cd02066 GRX_family Glutaredoxin (GRX) family; composed of GRX, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain Back     alignment and domain information
>TIGR02183 GRXA Glutaredoxin, GrxA family Back     alignment and domain information
>COG4232 Thiol:disulfide interchange protein [Posttranslational modification, protein turnover, chaperones / Energy production and conversion] Back     alignment and domain information
>cd03418 GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX bacterial class 1 and 3 (b_1_3)-like subfamily; composed of bacterial GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain Back     alignment and domain information
>KOG4277 consensus Uncharacterized conserved protein, contains thioredoxin domain [General function prediction only] Back     alignment and domain information
>TIGR02181 GRX_bact Glutaredoxin, GrxC family Back     alignment and domain information
>TIGR02190 GlrX-dom Glutaredoxin-family domain Back     alignment and domain information
>PRK10329 glutaredoxin-like protein; Provisional Back     alignment and domain information
>cd03019 DsbA_DsbA DsbA family, DsbA subfamily; DsbA is a monomeric thiol disulfide oxidoreductase protein containing a redox active CXXC motif imbedded in a TRX fold Back     alignment and domain information
>KOG0191 consensus Thioredoxin/protein disulfide isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA03050 glutaredoxin; Provisional Back     alignment and domain information
>TIGR02194 GlrX_NrdH Glutaredoxin-like protein NrdH Back     alignment and domain information
>COG4312 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG0695 GrxC Glutaredoxin and related proteins [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03027 GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Egl-10, and Pleckstrin (DEP) subfamily; composed of uncharacterized proteins containing a GRX domain and additional domains DEP and DUF547, both of which have unknown functions Back     alignment and domain information
>cd03029 GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hybrid subfamily; composed of hybrid proteins containing peroxiredoxin (PRX) and GRX domains, which is found in some pathogenic bacteria and cyanobacteria Back     alignment and domain information
>TIGR00365 monothiol glutaredoxin, Grx4 family Back     alignment and domain information
>TIGR02189 GlrX-like_plant Glutaredoxin-like family Back     alignment and domain information
>cd03020 DsbA_DsbC_DsbG DsbA family, DsbC and DsbG subfamily; V-shaped homodimeric proteins containing a redox active CXXC motif imbedded in a TRX fold Back     alignment and domain information
>cd03028 GRX_PICOT_like Glutaredoxin (GRX) family, PKC-interacting cousin of TRX (PICOT)-like subfamily; composed of PICOT and GRX-PICOT-like proteins Back     alignment and domain information
>KOG0911 consensus Glutaredoxin-related protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0914 consensus Thioredoxin-like protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10638 glutaredoxin 3; Provisional Back     alignment and domain information
>PRK10877 protein disulfide isomerase II DsbC; Provisional Back     alignment and domain information
>cd02972 DsbA_family DsbA family; consists of DsbA and DsbA-like proteins, including DsbC, DsbG, glutathione (GSH) S-transferase kappa (GSTK), 2-hydroxychromene-2-carboxylate (HCCA) isomerase, an oxidoreductase (FrnE) presumed to be involved in frenolicin biosynthesis, a 27-kDa outer membrane protein, and similar proteins Back     alignment and domain information
>PRK10954 periplasmic protein disulfide isomerase I; Provisional Back     alignment and domain information
>KOG4498 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF03190 Thioredox_DsbH: Protein of unknown function, DUF255; InterPro: IPR004879 This is a group of uncharacterised proteins Back     alignment and domain information
>PRK10824 glutaredoxin-4; Provisional Back     alignment and domain information
>cd03035 ArsC_Yffb Arsenate Reductase (ArsC) family, Yffb subfamily; Yffb is an uncharacterized bacterial protein encoded by the yffb gene, related to the thioredoxin-fold arsenic reductases, ArsC Back     alignment and domain information
>KOG1752 consensus Glutaredoxin and related proteins [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03036 ArsC_like Arsenate Reductase (ArsC) family, unknown subfamily; uncharacterized proteins containing a CXXC motif with similarity to thioredoxin (TRX)-fold arsenic reductases, ArsC Back     alignment and domain information
>cd02991 UAS_ETEA UAS family, ETEA subfamily; composed of proteins similar to human ETEA protein, the translation product of a highly expressed gene in the T-cells and eosinophils of atopic dermatitis patients compared with those of normal individuals Back     alignment and domain information
>cd03032 ArsC_Spx Arsenate Reductase (ArsC) family, Spx subfamily; Spx is a unique RNA polymerase (RNAP)-binding protein present in bacilli and some mollicutes Back     alignment and domain information
>TIGR01617 arsC_related transcriptional regulator, Spx/MgsR family Back     alignment and domain information
>cd02977 ArsC_family Arsenate Reductase (ArsC) family; composed of TRX-fold arsenic reductases and similar proteins including the transcriptional regulator, Spx Back     alignment and domain information
>PF13192 Thioredoxin_3: Thioredoxin domain; PDB: 1ZYP_B 1ZYN_A 1HYU_A 1ILO_A 1J08_F 2YWM_B 2AYT_B 2HLS_B 1A8L_A 2K8S_B Back     alignment and domain information
>KOG3414 consensus Component of the U4/U6 Back     alignment and domain information
>PRK01655 spxA transcriptional regulator Spx; Reviewed Back     alignment and domain information
>PF05768 DUF836: Glutaredoxin-like domain (DUF836); InterPro: IPR008554 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors Back     alignment and domain information
>PRK11657 dsbG disulfide isomerase/thiol-disulfide oxidase; Provisional Back     alignment and domain information
>COG1651 DsbG Protein-disulfide isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF02114 Phosducin: Phosducin; InterPro: IPR024253 The outer and inner segments of vertebrate rod photoreceptor cells contain phosducin, a soluble phosphoprotein that complexes with the beta/gamma-subunits of the GTP-binding protein, transducin Back     alignment and domain information
>PRK12559 transcriptional regulator Spx; Provisional Back     alignment and domain information
>PTZ00062 glutaredoxin; Provisional Back     alignment and domain information
>PF11009 DUF2847: Protein of unknown function (DUF2847); InterPro: IPR022551 Members of this protein family, including YtxJ from Bacillus subtilis, occur in species that encode proteins for synthesizing bacillithiol Back     alignment and domain information
>PRK13344 spxA transcriptional regulator Spx; Reviewed Back     alignment and domain information
>TIGR03759 conj_TIGR03759 integrating conjugative element protein, PFL_4693 family Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>PF09695 YtfJ_HI0045: Bacterial protein of unknown function (YtfJ_HI0045); InterPro: IPR006513 These are sequences from gammaproteobacteria that are related to the Escherichia coli protein, YtfJ Back     alignment and domain information
>PF02966 DIM1: Mitosis protein DIM1; InterPro: IPR004123 Thioredoxins [, , , ] are small disulphide-containing redox proteins that have been found in all the kingdoms of living organisms Back     alignment and domain information
>KOG2961 consensus Predicted hydrolase (HAD superfamily) [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query189
2p5q_A170 Crystal Structure Of The Poplar Glutathione Peroxid 7e-44
3e0u_A166 Crystal Structure Of T. Cruzi Gpx1 Length = 166 5e-28
2vup_A190 Crystal Structure Of A Type Ii Tryparedoxin-Dependa 5e-28
3dwv_A187 Glutathione Peroxidase-Type Tryparedoxin Peroxidase 3e-27
2rm5_A167 Glutathione Peroxidase-Type Tryparedoxin Peroxidase 7e-27
2obi_A183 Crystal Structure Of The Selenocysteine To Cysteine 1e-24
2wgr_A169 Combining Crystallography And Molecular Dynamics: T 6e-23
2v1m_A169 Crystal Structure Of Schistosoma Mansoni Glutathion 9e-23
2gs3_A185 Crystal Structure Of The Selenocysteine To Glycine 2e-22
3kij_A180 Crystal Structure Of The Human Pdi-Peroxidase Lengt 4e-21
3cyn_A189 The Structure Of Human Gpx8 Length = 189 5e-21
3cmi_A171 Crystal Structure Of Glutathione-Dependent Phosphol 5e-20
2p31_A181 Crystal Structure Of Human Glutathione Peroxidase 7 7e-19
2i3y_A215 Crystal Structure Of Human Glutathione Peroxidase 5 4e-14
2f8a_A208 Crystal Structure Of The Selenocysteine To Glycine 5e-14
1gp1_A198 The Refined Structure Of The Selenoenzyme Glutathio 1e-12
2he3_A208 Crystal Structure Of The Selenocysteine To Cysteine 2e-12
2r37_A207 Crystal Structure Of Human Glutathione Peroxidase 3 1e-11
>pdb|2P5Q|A Chain A, Crystal Structure Of The Poplar Glutathione Peroxidase 5 In The Reduced Form Length = 170 Back     alignment and structure 
Iteration: 1

 Score =  173 bits (438), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 81/118 (68%), Positives = 98/118 (83%), Gaps = 5/118 (4%)
Query: 60  TMASQSKTSVHDFSVKDAKGQDVDLSIYKGKLLLIVNVASQCGLTNSNYTELSQLYDKYK 119
           T  S++  SVHDF+VKDAK  DVDLSI+KGK+LLIVNVAS+CG+TNSNY E++QLY+KYK
Sbjct: 3   TQTSKNPESVHDFTVKDAKENDVDLSIFKGKVLLIVNVASKCGMTNSNYAEMNQLYEKYK 62
Query: 120 NQGLEILAFPCNQFGAQEPGDNEQIQEFACTRFKAEFPIFDKVL-----ALQLYKFYK 172
           +QGLEILAFPCNQFG +EPG N+QI +F CTRFK+EFPIFDK+      A  LY+F K
Sbjct: 63  DQGLEILAFPCNQFGEEEPGTNDQITDFVCTRFKSEFPIFDKIDVNGENASPLYRFLK 120
>pdb|3E0U|A Chain A, Crystal Structure Of T. Cruzi Gpx1 Length = 166 Back     alignment and structure
>pdb|2VUP|A Chain A, Crystal Structure Of A Type Ii Tryparedoxin-Dependant Peroxidase From Trypanosoma Brucei Length = 190 Back     alignment and structure
>pdb|3DWV|A Chain A, Glutathione Peroxidase-Type Tryparedoxin Peroxidase, Oxidized Form Length = 187 Back     alignment and structure
>pdb|2RM5|A Chain A, Glutathione Peroxidase-Type Tryparedoxin Peroxidase, Oxidized Form Length = 167 Back     alignment and structure
>pdb|2OBI|A Chain A, Crystal Structure Of The Selenocysteine To Cysteine Mutant Of Human Phospholipid Hydroperoxide Glutathione Peroxidase (Gpx4) Length = 183 Back     alignment and structure
>pdb|2WGR|A Chain A, Combining Crystallography And Molecular Dynamics: The Case Of Schistosoma Mansoni Phospholipid Glutathione Peroxidase Length = 169 Back     alignment and structure
>pdb|2V1M|A Chain A, Crystal Structure Of Schistosoma Mansoni Glutathione Peroxidase Length = 169 Back     alignment and structure
>pdb|2GS3|A Chain A, Crystal Structure Of The Selenocysteine To Glycine Mutant Of Human Glutathione Peroxidase 4(Gpx4) Length = 185 Back     alignment and structure
>pdb|3KIJ|A Chain A, Crystal Structure Of The Human Pdi-Peroxidase Length = 180 Back     alignment and structure
>pdb|3CYN|A Chain A, The Structure Of Human Gpx8 Length = 189 Back     alignment and structure
>pdb|3CMI|A Chain A, Crystal Structure Of Glutathione-Dependent Phospholipid Peroxidase Hyr1 From The Yeast Saccharomyces Cerevisiae Length = 171 Back     alignment and structure
>pdb|2P31|A Chain A, Crystal Structure Of Human Glutathione Peroxidase 7 Length = 181 Back     alignment and structure
>pdb|2I3Y|A Chain A, Crystal Structure Of Human Glutathione Peroxidase 5 Length = 215 Back     alignment and structure
>pdb|2F8A|A Chain A, Crystal Structure Of The Selenocysteine To Glycine Mutant Of Human Glutathione Peroxidase 1 Length = 208 Back     alignment and structure
>pdb|1GP1|A Chain A, The Refined Structure Of The Selenoenzyme Glutathione Peroxidase At 0.2-Nm Resolution Length = 198 Back     alignment and structure
>pdb|2HE3|A Chain A, Crystal Structure Of The Selenocysteine To Cysteine Mutant Of Human Glutathionine Peroxidase 2 (Gpx2) Length = 208 Back     alignment and structure
>pdb|2R37|A Chain A, Crystal Structure Of Human Glutathione Peroxidase 3 (Selenocysteine To Glycine Mutant) Length = 207 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query189
2p5q_A170 Glutathione peroxidase 5; thioredoxin fold, oxidor 2e-66
2v1m_A169 Glutathione peroxidase; selenium, selenocysteine, 6e-66
2obi_A183 PHGPX, GPX-4, phospholipid hydroperoxide glutathio 1e-65
2vup_A190 Glutathione peroxidase-like protein; oxidoreductas 2e-65
3dwv_A187 Glutathione peroxidase-like protein; alpha beta, 3 2e-65
3kij_A180 Probable glutathione peroxidase 8; human PDI-perox 3e-64
2gs3_A185 PHGPX, GPX-4, phospholipid hydroperoxide glutathio 4e-64
2p31_A181 CL683, glutathione peroxidase 7; thioredoxin fold, 3e-63
3cmi_A171 Peroxiredoxin HYR1; thioredoxin-like fold, oxidore 3e-60
2f8a_A208 Glutathione peroxidase 1; thioredoxin fold, struct 1e-58
2i3y_A215 Epididymal secretory glutathione peroxidase; thior 3e-56
2r37_A207 Glutathione peroxidase 3; plasma, structural genom 9e-55
3ewl_A142 Uncharacterized conserved protein BF1870; alpha-be 1e-10
2lrt_A152 Uncharacterized protein; structural genomics, thio 2e-10
3hcz_A148 Possible thiol-disulfide isomerase; APC61559.2, cy 9e-10
2h30_A164 Thioredoxin, peptide methionine sulfoxide reductas 1e-09
3eur_A142 Uncharacterized protein; PSI2,MCSG, conserved prot 1e-09
3kcm_A154 Thioredoxin family protein; SGX, thioredoxin prote 4e-09
2lja_A152 Putative thiol-disulfide oxidoreductase; structura 5e-09
2lrn_A152 Thiol:disulfide interchange protein; structural ge 7e-09
3or5_A165 Thiol:disulfide interchange protein, thioredoxin p 1e-08
2f9s_A151 Thiol-disulfide oxidoreductase RESA; thioredoxin-l 5e-08
2l5o_A153 Putative thioredoxin; structural genomics, unknown 6e-08
4evm_A138 Thioredoxin family protein; structural genomics, n 9e-08
3erw_A145 Sporulation thiol-disulfide oxidoreductase A; thio 1e-07
3hdc_A158 Thioredoxin family protein; ATCC53774, DSM 7210, , 1e-07
1jfu_A186 Thiol:disulfide interchange protein TLPA; thioredo 1e-07
2hyx_A 352 Protein DIPZ; thioredoxin fold, jelly-roll, struct 5e-07
3raz_A151 Thioredoxin-related protein; structural genomics, 7e-07
3eyt_A158 Uncharacterized protein SPOA0173; thioredoxin-like 7e-07
3gl3_A152 Putative thiol:disulfide interchange protein DSBE; 1e-06
3fw2_A150 Thiol-disulfide oxidoreductase; structural genomic 1e-06
3fkf_A148 Thiol-disulfide oxidoreductase; structural genomic 8e-06
4fo5_A143 Thioredoxin-like protein; AHPC/TSA family protein, 1e-05
1o73_A144 Tryparedoxin; electron transport, trypanosomatid, 2e-05
3lor_A160 Thiol-disulfide isomerase and thioredoxins; PSI, M 2e-05
3ha9_A165 Uncharacterized thioredoxin-like protein; PSI, MCS 6e-05
3u5r_E218 Uncharacterized protein; structural genomics, PSI- 7e-05
2b5x_A148 YKUV protein, TRXY; thioredoxin-like, oxidoreducta 1e-04
1lu4_A136 Soluble secreted antigen MPT53; thioredoxin-like f 1e-04
3ia1_A154 THIO-disulfide isomerase/thioredoxin; oxidoreducta 1e-04
1o8x_A146 Tryparedoxin, TRYX, TXNI; tryparedoxin-I, synchrot 2e-04
1zzo_A136 RV1677; thioredoxin fold, structural genomics, PSI 4e-04
2ls5_A159 Uncharacterized protein; structural genomics, unkn 4e-04
3lwa_A183 Secreted thiol-disulfide isomerase; thioredoxin, P 7e-04
>2p5q_A Glutathione peroxidase 5; thioredoxin fold, oxidoreductase; 2.00A {Populus trichocarpa x populusdeltoides} PDB: 2p5r_A Length = 170 Back     alignment and structure
 Score =  200 bits (510), Expect = 2e-66
 Identities = 81/120 (67%), Positives = 98/120 (81%), Gaps = 5/120 (4%)

Query: 60  TMASQSKTSVHDFSVKDAKGQDVDLSIYKGKLLLIVNVASQCGLTNSNYTELSQLYDKYK 119
           T  S++  SVHDF+VKDAK  DVDLSI+KGK+LLIVNVAS+CG+TNSNY E++QLY+KYK
Sbjct: 3   TQTSKNPESVHDFTVKDAKENDVDLSIFKGKVLLIVNVASKCGMTNSNYAEMNQLYEKYK 62

Query: 120 NQGLEILAFPCNQFGAQEPGDNEQIQEFACTRFKAEFPIFDKVL-----ALQLYKFYKQK 174
           +QGLEILAFPCNQFG +EPG N+QI +F CTRFK+EFPIFDK+      A  LY+F K  
Sbjct: 63  DQGLEILAFPCNQFGEEEPGTNDQITDFVCTRFKSEFPIFDKIDVNGENASPLYRFLKLG 122
>2v1m_A Glutathione peroxidase; selenium, selenocysteine, oxidoreductase, lipid peroxidase, schistosoma detoxification pathway; 1.00A {Schistosoma mansoni} PDB: 2wgr_A Length = 169 Back     alignment and structure
>2obi_A PHGPX, GPX-4, phospholipid hydroperoxide glutathione peroxidase (GPX4); human GPX4, selenoprotein, thioredoxin-fold, anti-oxidatve defense system; 1.55A {Homo sapiens} Length = 183 Back     alignment and structure
>2vup_A Glutathione peroxidase-like protein; oxidoreductase, trypanothione, dithiol-dependant peroxidase; 2.10A {Trypanosoma brucei} Length = 190 Back     alignment and structure
>3dwv_A Glutathione peroxidase-like protein; alpha beta, 3-layer(ABA) sandwich, glutaredoxin fold, oxidoreductase; 1.41A {Trypanosoma brucei} PDB: 2rm5_A 2rm6_A 3e0u_A Length = 187 Back     alignment and structure
>3kij_A Probable glutathione peroxidase 8; human PDI-peroxidase, membrane, oxidoreductase, transmembrane; 1.80A {Homo sapiens} PDB: 3cyn_A Length = 180 Back     alignment and structure
>2gs3_A PHGPX, GPX-4, phospholipid hydroperoxide glutathione peroxidase; GSHPX-4,phospholipid hydroperoxide; 1.90A {Homo sapiens} Length = 185 Back     alignment and structure
>2p31_A CL683, glutathione peroxidase 7; thioredoxin fold, NPGPX, phospholipid hydroperoxidase, struc genomics, structural genomics consortium, SGC; 2.00A {Homo sapiens} Length = 181 Back     alignment and structure
>3cmi_A Peroxiredoxin HYR1; thioredoxin-like fold, oxidoreductase, peroxidase, redox-ACT center; 2.02A {Saccharomyces cerevisiae} Length = 171 Back     alignment and structure
>2f8a_A Glutathione peroxidase 1; thioredoxin fold, structural genomics, structural genomics consortium, SGC, oxidoreductase; 1.50A {Homo sapiens} SCOP: c.47.1.10 PDB: 1gp1_A 2he3_A Length = 208 Back     alignment and structure
>2i3y_A Epididymal secretory glutathione peroxidase; thioredoxin fold, epididymal androgen related protein, struc genomics, structural genomics consortium; 2.00A {Homo sapiens} Length = 215 Back     alignment and structure
>2r37_A Glutathione peroxidase 3; plasma, structural genomics consort oxidoreductase, secreted, selenium, selenocysteine; 1.85A {Homo sapiens} Length = 207 Back     alignment and structure
>3ewl_A Uncharacterized conserved protein BF1870; alpha-beta fold, structural genomics, PSI-2, protein structu initiative; 2.00A {Bacteroides fragilis} Length = 142 Back     alignment and structure
>2lrt_A Uncharacterized protein; structural genomics, thioredoxin-like, NEW YORK structural G research consortium, nysgrc, PSI-biology; NMR {Bacteroides vulgatus} Length = 152 Back     alignment and structure
>3hcz_A Possible thiol-disulfide isomerase; APC61559.2, cytophaga hutchinsoni structural genomics, PSI-2, protein structure initiative; 1.88A {Cytophaga hutchinsonii} Length = 148 Back     alignment and structure
>2h30_A Thioredoxin, peptide methionine sulfoxide reductase MSRA/MSRB; reduced, thiol-disulfide exchange, oxidoreductase; 1.60A {Neisseria gonorrhoeae} PDB: 2jzr_A 2jzs_A 2k9f_A 2fy6_A Length = 164 Back     alignment and structure
>3eur_A Uncharacterized protein; PSI2,MCSG, conserved protein, structural genomics, protein S initiative, midwest center for structural genomics; HET: MSE; 1.30A {Bacteroides fragilis} Length = 142 Back     alignment and structure
>3kcm_A Thioredoxin family protein; SGX, thioredoxin protein, PSI, structural genomics, protein initiative; 2.45A {Geobacter metallireducens gs-15} Length = 154 Back     alignment and structure
>2lja_A Putative thiol-disulfide oxidoreductase; structural genomics, unknown function, thioredoxin-like; NMR {Bacteroides vulgatus} Length = 152 Back     alignment and structure
>2lrn_A Thiol:disulfide interchange protein; structural genomics, thioredoxin-like, NEW YORK structural G research consortium, oxidoreductase; NMR {Bacteroides SP} Length = 152 Back     alignment and structure
>3or5_A Thiol:disulfide interchange protein, thioredoxin protein; PSI-II, structural genomics, protein structure initiative; 1.66A {Chlorobaculum tepidum} Length = 165 Back     alignment and structure
>2f9s_A Thiol-disulfide oxidoreductase RESA; thioredoxin-like protein; HET: MSE; 1.40A {Bacillus subtilis} SCOP: c.47.1.10 PDB: 1st9_A 1su9_A 2h1d_A 2h1b_A 2h1a_A 2h19_A 2h1g_A 3c71_A 3c73_A Length = 151 Back     alignment and structure
>2l5o_A Putative thioredoxin; structural genomics, unknown function, PSI-2, protein struct initiative; NMR {Neisseria meningitidis serogroup B} Length = 153 Back     alignment and structure
>4evm_A Thioredoxin family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.51A {Streptococcus pneumoniae} Length = 138 Back     alignment and structure
>3erw_A Sporulation thiol-disulfide oxidoreductase A; thioredoxin-like fold, RESA-like fold, dithiol, STOA, redox-active center; 2.50A {Bacillus subtilis} Length = 145 Back     alignment and structure
>3hdc_A Thioredoxin family protein; ATCC53774, DSM 7210, , structural genomics, PSI-2, protein structure initiative; 1.77A {Geobacter metallireducens gs-15} Length = 158 Back     alignment and structure
>1jfu_A Thiol:disulfide interchange protein TLPA; thioredoxin-like, double disulfide bridge, membrane protein; 1.60A {Bradyrhizobium japonicum} SCOP: c.47.1.10 Length = 186 Back     alignment and structure
>2hyx_A Protein DIPZ; thioredoxin fold, jelly-roll, structural genomics, TB struct genomics consortium, TBSGC, unknown function; 1.90A {Mycobacterium tuberculosis} Length = 352 Back     alignment and structure
>3raz_A Thioredoxin-related protein; structural genomics, PSI-2, protein structure initiative; 2.00A {Neisseria meningitidis serogroup B} Length = 151 Back     alignment and structure
>3eyt_A Uncharacterized protein SPOA0173; thioredoxin-like superfamily protein SPOA0173, silicibacter DSS, structural genomics, PSI-2; 1.95A {Silicibacter pomeroyi} Length = 158 Back     alignment and structure
>3gl3_A Putative thiol:disulfide interchange protein DSBE; oxidoreductase, PSI-II, structural genomics, protein structure initiative; 2.09A {Chlorobium tepidum tls} Length = 152 Back     alignment and structure
>3fw2_A Thiol-disulfide oxidoreductase; structural genomics, APC61456.1, thiol-disulfide oxidoreduct TLPA-like family, PSI-2; 1.74A {Bacteroides thetaiotaomicron} Length = 150 Back     alignment and structure
>3fkf_A Thiol-disulfide oxidoreductase; structural genomics, PSI-2, structure initiative, midwest center for structural genomic oxidoreductase; 2.20A {Bacteroides fragilis} Length = 148 Back     alignment and structure
>4fo5_A Thioredoxin-like protein; AHPC/TSA family protein, structural genomics, joint center F structural genomics, JCSG; 2.02A {Parabacteroides distasonis} Length = 143 Back     alignment and structure
>1o73_A Tryparedoxin; electron transport, trypanosomatid, thioredoxin; 2.28A {Trypanosoma brucei brucei} SCOP: c.47.1.10 Length = 144 Back     alignment and structure
>3lor_A Thiol-disulfide isomerase and thioredoxins; PSI, MCSG, structural genomics, midwest CE structural genomics; HET: MSE; 2.20A {Corynebacterium glutamicum} Length = 160 Back     alignment and structure
>3ha9_A Uncharacterized thioredoxin-like protein; PSI, MCSG, structural G midwest center for structural genomics, protein structure initiative; 1.70A {Aeropyrum pernix} Length = 165 Back     alignment and structure
>3u5r_E Uncharacterized protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, hypothetical protein; 2.05A {Sinorhizobium meliloti} Length = 218 Back     alignment and structure
>2b5x_A YKUV protein, TRXY; thioredoxin-like, oxidoreductase; NMR {Bacillus subtilis} SCOP: c.47.1.10 PDB: 2b5y_A Length = 148 Back     alignment and structure
>1lu4_A Soluble secreted antigen MPT53; thioredoxin-like fold, structural genomics, PSI, protein structure initiative; 1.12A {Mycobacterium tuberculosis} SCOP: c.47.1.10 Length = 136 Back     alignment and structure
>3ia1_A THIO-disulfide isomerase/thioredoxin; oxidoreductase, PSI-2, NYSGXRC, structu genomics, protein structure initiative; 1.76A {Thermus thermophilus} Length = 154 Back     alignment and structure
>1o8x_A Tryparedoxin, TRYX, TXNI; tryparedoxin-I, synchrotron radiation, disulfide bonds tryparedoxin, thioredoxin, trypanosome; 1.3A {Crithidia fasciculata} SCOP: c.47.1.10 PDB: 1okd_A 1qk8_A 1o85_A 1o8w_A 1o7u_A 1ezk_A 1ewx_A Length = 146 Back     alignment and structure
>1zzo_A RV1677; thioredoxin fold, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 1.60A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 3ios_A Length = 136 Back     alignment and structure
>2ls5_A Uncharacterized protein; structural genomics, unknown function, thioredoxin-like, NEW structural genomics research consortium; NMR {Bacteroides thetaiotaomicron} Length = 159 Back     alignment and structure
>3lwa_A Secreted thiol-disulfide isomerase; thioredoxin, PSI, MCSG, structural genomics, midwest center for structural genomics; 1.75A {Corynebacterium glutamicum} Length = 183 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

No hit with probability above 80.00

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 189
d2f8aa1184 c.47.1.10 (A:12-195) Glutathione peroxidase {Human 4e-18
d2fy6a1143 c.47.1.10 (A:33-175) Peptide methionine sulfoxide 3e-07
d1wp0a1160 c.47.1.10 (A:138-297) Thioredoxin-like protein Sco 1e-05
d1o73a_144 c.47.1.10 (A:) Tryparedoxin I {Trypanosoma brucei 3e-05
d1zzoa1134 c.47.1.10 (A:45-178) Lipoprotein DsbF {Mycobacteri 1e-04
d2cvba1187 c.47.1.10 (A:2-188) Probable thiol-disulfide isome 2e-04
d2b7ka1169 c.47.1.10 (A:111-279) Thioredoxin-like protein Sco 3e-04
d1i5ga_144 c.47.1.10 (A:) Tryparedoxin II {Crithidia fascicul 4e-04
d1lu4a_134 c.47.1.10 (A:) Soluble secreted antigen MPT53 {Myc 4e-04
d1jfua_176 c.47.1.10 (A:) Membrane-anchored thioredoxin-like 0.001
>d2f8aa1 c.47.1.10 (A:12-195) Glutathione peroxidase {Human (Homo sapiens) [TaxId: 9606]} Length = 184 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Thioredoxin fold
superfamily: Thioredoxin-like
family: Glutathione peroxidase-like
domain: Glutathione peroxidase
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 75.7 bits (185), Expect = 4e-18
 Identities = 41/121 (33%), Positives = 62/121 (51%), Gaps = 8/121 (6%)

Query: 68  SVHDFSVKD-AKGQDVDLSIYKGKLLLIVNVASQCGLTNSNYTELSQLYDKYKNQGLEIL 126
           SV+ FS +  A G+ V L   +GK+LLI NVAS  G T  +YT++++L  +   +GL +L
Sbjct: 2   SVYAFSARPLAGGEPVSLGSLRGKVLLIENVASLGGTTVRDYTQMNELQRRLGPRGLVVL 61

Query: 127 AFPCNQFGAQEPGDNEQIQEFAC-----TRFKAEFPIFD--KVLALQLYKFYKQKIHSHG 179
            FPCNQFG QE   NE+I            F+  F +F+  +V     +  +     +  
Sbjct: 62  GFPCNQFGHQENAKNEEILNSLKYVRPGGGFEPNFMLFEKCEVNGAGAHPLFAFLREALP 121

Query: 180 F 180
            
Sbjct: 122 A 122
>d2fy6a1 c.47.1.10 (A:33-175) Peptide methionine sulfoxide reductase MsrA/MsrB, N-terminal domain {Neisseria meningitidis serogroup A [TaxId: 65699]} Length = 143 Back     information, alignment and structure
>d1wp0a1 c.47.1.10 (A:138-297) Thioredoxin-like protein Sco1 (YpmQ), soluble domain {Human (Homo sapiens) [TaxId: 9606]} Length = 160 Back     information, alignment and structure
>d1o73a_ c.47.1.10 (A:) Tryparedoxin I {Trypanosoma brucei brucei [TaxId: 5702]} Length = 144 Back     information, alignment and structure
>d1zzoa1 c.47.1.10 (A:45-178) Lipoprotein DsbF {Mycobacterium tuberculosis [TaxId: 1773]} Length = 134 Back     information, alignment and structure
>d2cvba1 c.47.1.10 (A:2-188) Probable thiol-disulfide isomerase/thioredoxin TTHA0593 {Thermus thermophilus [TaxId: 274]} Length = 187 Back     information, alignment and structure
>d2b7ka1 c.47.1.10 (A:111-279) Thioredoxin-like protein Sco1 (YpmQ), soluble domain {Baker's yeast(Saccharomyces cerevisiae) [TaxId: 4932]} Length = 169 Back     information, alignment and structure
>d1i5ga_ c.47.1.10 (A:) Tryparedoxin II {Crithidia fasciculata [TaxId: 5656]} Length = 144 Back     information, alignment and structure
>d1lu4a_ c.47.1.10 (A:) Soluble secreted antigen MPT53 {Mycobacterium tuberculosis [TaxId: 1773]} Length = 134 Back     information, alignment and structure
>d1jfua_ c.47.1.10 (A:) Membrane-anchored thioredoxin-like protein TlpA, soluble domain {Bradyrhizobium japonicum [TaxId: 375]} Length = 176 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query189
d2cvba1187 Probable thiol-disulfide isomerase/thioredoxin TTH 99.92
d2f8aa1184 Glutathione peroxidase {Human (Homo sapiens) [TaxI 99.92
d1st9a_137 Thiol-disulfide oxidoreductase ResA {Bacillus subt 99.86
d1jfua_176 Membrane-anchored thioredoxin-like protein TlpA, s 99.85
d1xvwa1153 Putative peroxiredoxin Rv2238c/MT2298 {Mycobacteri 99.85
d1lu4a_134 Soluble secreted antigen MPT53 {Mycobacterium tube 99.84
d1we0a1166 Alkyl hydroperoxide reductase AhpC {Amphibacillus 99.84
d2a4va1156 Peroxiredoxin dot5 {Baker's yeast (Saccharomyces c 99.82
d1e2ya_167 Tryparedoxin peroxidase (thioredoxin peroxidase ho 99.82
d1uula_194 Tryparedoxin peroxidase (thioredoxin peroxidase ho 99.82
d1xzoa1172 Thioredoxin-like protein Sco1 (YpmQ), soluble doma 99.82
d2bmxa1169 Alkyl hydroperoxide reductase AhpC {Mycobacterium 99.81
d2cx4a1160 Bacterioferritin comigratory protein {Archaeon Aer 99.81
d1o73a_144 Tryparedoxin I {Trypanosoma brucei brucei [TaxId: 99.81
d1qxha_164 Thiol peroxidase Tpx {Escherichia coli [TaxId: 562 99.8
d2b5xa1143 thiol:disulfide oxidoreductase YkuV {Bacillus subt 99.8
d1i5ga_144 Tryparedoxin II {Crithidia fasciculata [TaxId: 565 99.79
d1qmva_197 Thioredoxin peroxidase 2 (thioredoxin peroxidase B 99.78
d1zzoa1134 Lipoprotein DsbF {Mycobacterium tuberculosis [TaxI 99.78
d1zyea1158 Peroxiredoxin-3 (AOP-1, SP-22) {Cow (Bos taurus) [ 99.78
d1zofa1170 Thioredoxin reductase TsaA {Helicobacter pylori [T 99.77
d2fy6a1143 Peptide methionine sulfoxide reductase MsrA/MsrB, 99.76
d1o8xa_144 Tryparedoxin I {Crithidia fasciculata [TaxId: 5656 99.76
d1psqa_163 Probable thiol peroxidase PsaD {Streptococcus pneu 99.74
d1n8ja_186 Alkyl hydroperoxide reductase AhpC {Salmonella typ 99.74
d1q98a_164 Thiol peroxidase Tpx {Haemophilus influenzae [TaxI 99.74
d1xvqa_166 Thiol peroxidase Tpx {Mycobacterium tuberculosis [ 99.74
d2zcta1 237 Peroxiredoxin {Aeropyrum pernix [TaxId: 56636]} 99.73
d1prxa_220 1-Cys peroxiredoxin {Human (Homo sapiens) [TaxId: 99.73
d1xcca_219 1-Cys peroxiredoxin {Plasmodium yoelii yoelii [Tax 99.69
d1knga_144 Thioredoxin-like protein CcmG (CycY, DsbE) {Bradyr 99.69
d2h01a1170 Thioredoxin peroxidase 2 (thioredoxin peroxidase B 99.67
d1z5ye1136 Thioredoxin-like protein CcmG (CycY, DsbE) {Escher 99.62
d1wp0a1160 Thioredoxin-like protein Sco1 (YpmQ), soluble doma 99.59
d2b7ka1169 Thioredoxin-like protein Sco1 (YpmQ), soluble doma 99.41
d1z6na1166 Hypothetical protein PA1234 {Pseudomonas aeruginos 99.24
d1hd2a_161 Peroxiredoxin 5 {Human (Homo sapiens) [TaxId: 9606 99.22
d1xwaa_111 Thioredoxin {Fruit fly (Drosophila melanogaster) [ 99.15
d1tp9a1162 Plant peroxiredoxin {Western balsam poplar(Populus 99.12
d1woua_119 Putative 42-9-9 protein (thioredoxin containing pr 98.96
d1nw2a_105 Thioredoxin {Alicyclobacillus acidocaldarius, form 98.95
d1dbya_107 Thioredoxin {Chlamydomonas reinhardtii [TaxId: 305 98.95
d1ep7a_112 Thioredoxin {Chlamydomonas reinhardtii [TaxId: 305 98.9
d1thxa_108 Thioredoxin {Anabaena sp., pcc 7120 [TaxId: 1167]} 98.9
d2trxa_108 Thioredoxin {Escherichia coli [TaxId: 562]} 98.89
d1nm3a2163 N-terminal, Prx domain of Hybrid-Prx5 {Haemophilus 98.88
d1ti3a_113 Thioredoxin {European aspen (Populus tremula), thi 98.88
d2fwha1117 Thiol:disulfide interchange protein DsbD, C-termin 98.86
d1fb6a_104 Thioredoxin {Spinach (Spinacia oleracea), thioredo 98.85
d1gh2a_107 Thioredoxin-like protein, N-terminal domain {Human 98.84
d1qgva_137 spliceosomal protein U5-15Kd {Human (Homo sapiens) 98.84
d2ifqa1105 Thioredoxin {Human (Homo sapiens) [TaxId: 9606]} 98.84
d1xfla_114 Thioredoxin {Thale cress (Arabidopsis thaliana) [T 98.83
d1r26a_113 Thioredoxin {Trypanosoma brucei [TaxId: 5691]} 98.83
d2b5ea4119 Protein disulfide isomerase, PDI {Baker's yeast (S 98.75
d1zmaa1115 Bacterocin transport accessory protein Bta {Strept 98.73
d1f9ma_112 Thioredoxin {Spinach (Spinacia oleracea), thioredo 98.72
d1syra_103 Thioredoxin {Malarial parasite (Plasmodium falcipa 98.66
d2es7a1119 Hydrogenase-1 operon protein HyaE {Salmonella typh 98.65
d2hfda1132 Hydrogenase-1 operon protein HyaE {Escherichia col 98.64
d1meka_120 Protein disulfide isomerase, PDI {Human (Homo sapi 98.62
d1a8la2107 Protein disulfide isomerase, PDI {Archaeon Pyrococ 98.6
d1fo5a_85 MJ0307, thioredoxin/glutaredoxin-like protein {Arc 98.55
d1sena_135 Thioredoxin-like protein p19, TLP19 {Human (Homo s 98.53
d1nhoa_85 MTH807, thioredoxin/glutaredoxin-like protein {Arc 98.37
d2b5ea1140 Protein disulfide isomerase, PDI {Baker's yeast (S 98.37
d1xiya1179 1-Cys peroxiredoxin {Malaria parasite (Plasmodium 98.36
d1hyua496 Alkyl hydroperoxide reductase subunit F (AhpF), N- 98.36
d2djja1116 Protein disulfide isomerase, PDI {Fungi (Humicola 98.31
d2c0ga2122 Windbeutel, N-terminal domain {Fruit fly (Drosophi 98.29
d2dlxa1147 UBX domain-containing protein 7 {Human (Homo sapie 98.16
d2trcp_217 Phosducin {Rat (Rattus norvegicus) [TaxId: 10116]} 98.07
d1a8ya1124 Calsequestrin {Rabbit (Oryctolagus cuniculus) [Tax 97.85
d1wjka_100 Thioredoxin-like structure containing protein C330 97.59
d1g7ea_122 Endoplasmic reticulum protein ERP29, N-terminal do 96.44
d1z6ma1172 Hypothetical protein EF0770 {Enterococcus faecalis 95.01
d1v58a1169 Thiol:disulfide interchange protein DsbG, C-termin 94.69
d1ktea_105 Glutaredoxin (Grx, thioltransferase) {Pig (Sus scr 94.23
d1egoa_85 Glutaredoxin (Grx, thioltransferase) {Escherichia 94.12
d1beda_181 Disulfide-bond formation facilitator (DsbA) {Vibri 93.37
d1eeja1156 Disulfide bond isomerase, DsbC, C-terminal domain 93.23
d1r7ha_74 Glutaredoxin-like NRDH-redoxin {Corynebacterium am 91.98
d1t3ba1150 Disulfide bond isomerase, DsbC, C-terminal domain 91.97
d1h75a_76 Glutaredoxin-like NRDH-redoxin {Escherichia coli [ 91.43
d1un2a_195 Disulfide-bond formation facilitator (DsbA) {Esche 90.07
d2axoa1 225 Hypothetical protein Atu2684 {Agrobacterium tumefa 89.48
d1nm3a174 C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus 88.77
d1fova_82 Glutaredoxin (Grx, thioltransferase) {Escherichia 88.55
d1fvka_188 Disulfide-bond formation facilitator (DsbA) {Esche 87.34
>d2cvba1 c.47.1.10 (A:2-188) Probable thiol-disulfide isomerase/thioredoxin TTHA0593 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Thioredoxin fold
superfamily: Thioredoxin-like
family: Glutathione peroxidase-like
domain: Probable thiol-disulfide isomerase/thioredoxin TTHA0593
species: Thermus thermophilus [TaxId: 274]

Probab=99.92  E-value=2.5e-25  Score=153.10  Aligned_cols=122  Identities=18%  Similarity=0.289  Sum_probs=100.0

Q ss_pred             CCCCCCCCCEEEECCCCCEEECCCCCCCEEEEEEECCCCCCCHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCCCCCHH
Q ss_conf             13798214818867999956468669988999986378946489799999999986029809999846999999999988
Q 029690           63 SQSKTSVHDFSVKDAKGQDVDLSIYKGKLLLIVNVASQCGLTNSNYTELSQLYDKYKNQGLEILAFPCNQFGAQEPGDNE  142 (189)
Q Consensus        63 ~~~g~~~p~f~l~d~~g~~~~l~~~~gk~vli~F~a~wC~~C~~~~~~l~~l~~~~~~~~v~vi~is~d~~~~~e~~~~~  142 (189)
                      ..+|+++|+|++.|.+|+.++|++++||++||+||++|||+|+.++|.|++++++|+++ +.+++|++++......++.+
T Consensus         6 l~vG~~aPdF~l~d~~G~~~~Lsd~kGk~vvl~FwatwCp~C~~~~p~l~~l~~~y~~~-v~~v~i~snd~~~~~~~~~e   84 (187)
T d2cvba1           6 LPLESPLIDAELPDPRGGRYRLSQFHEPLLAVVFMCNHCPYVKGSIGELVALAERYRGK-VAFVGINANDYEKYPEDAPE   84 (187)
T ss_dssp             CCTTCBCCCCEEECTTSCEEEGGGCCSSEEEEEEECSSCHHHHTTHHHHHHHHHHTTTT-EEEEEEECCCTTTCGGGSHH
T ss_pred             CCCCCCCCCCEEECCCCCEEEHHHHCCCEEEEEEECCCCCCCHHHHHHHHHHHHHCCCC-CEEEEEECCCCCCCCCCCHH
T ss_conf             88999367608466999998789958983999984777764013432220012220343-13554201123332222147


Q ss_pred             HHHHHHHHHCCCCCCEECCCCCHHHHHHHHHCCCC--CCCCCCCEEE
Q ss_conf             99999976379643201165305999998850799--8201243276
Q 029690          143 QIQEFACTRFKAEFPIFDKVLALQLYKFYKQKIHS--HGFAYACRIL  187 (189)
Q Consensus       143 ~~~~~~~~~~~~~fp~~~D~~~~~~~~~l~~~~~~--~g~~~~~~~~  187 (189)
                      .++++. ++++++||++.|.+ ..+.+.+.-...+  ..+|..++++
T Consensus        85 ~~~~~~-~~~~~~~p~l~D~~-~~~~~~~~v~~~P~~~liD~~G~i~  129 (187)
T d2cvba1          85 KMAAFA-EEHGIFFPYLLDET-QEVAKAYRALRTPEVFLFDERRLLR  129 (187)
T ss_dssp             HHHHHH-HHHTCCSCEEECSS-SHHHHHTTCCEESEEEEECTTCBEE
T ss_pred             HHHHHH-HHHCCCCEEEECHH-HHHCCCCCCCCEEEEEEECCCCEEE
T ss_conf             788889-87098632565405-5420024643102579986898299
>d2f8aa1 c.47.1.10 (A:12-195) Glutathione peroxidase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1st9a_ c.47.1.10 (A:) Thiol-disulfide oxidoreductase ResA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1jfua_ c.47.1.10 (A:) Membrane-anchored thioredoxin-like protein TlpA, soluble domain {Bradyrhizobium japonicum [TaxId: 375]} Back     information, alignment and structure
>d1xvwa1 c.47.1.10 (A:1-153) Putative peroxiredoxin Rv2238c/MT2298 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1lu4a_ c.47.1.10 (A:) Soluble secreted antigen MPT53 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1we0a1 c.47.1.10 (A:1-166) Alkyl hydroperoxide reductase AhpC {Amphibacillus xylanus [TaxId: 1449]} Back     information, alignment and structure
>d2a4va1 c.47.1.10 (A:59-214) Peroxiredoxin dot5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e2ya_ c.47.1.10 (A:) Tryparedoxin peroxidase (thioredoxin peroxidase homologue) {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1uula_ c.47.1.10 (A:) Tryparedoxin peroxidase (thioredoxin peroxidase homologue) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1xzoa1 c.47.1.10 (A:3-174) Thioredoxin-like protein Sco1 (YpmQ), soluble domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2bmxa1 c.47.1.10 (A:2-170) Alkyl hydroperoxide reductase AhpC {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2cx4a1 c.47.1.10 (A:4-163) Bacterioferritin comigratory protein {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1o73a_ c.47.1.10 (A:) Tryparedoxin I {Trypanosoma brucei brucei [TaxId: 5702]} Back     information, alignment and structure
>d1qxha_ c.47.1.10 (A:) Thiol peroxidase Tpx {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2b5xa1 c.47.1.10 (A:1-143) thiol:disulfide oxidoreductase YkuV {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1i5ga_ c.47.1.10 (A:) Tryparedoxin II {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1qmva_ c.47.1.10 (A:) Thioredoxin peroxidase 2 (thioredoxin peroxidase B, 2-cys peroxiredoxin) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zzoa1 c.47.1.10 (A:45-178) Lipoprotein DsbF {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zyea1 c.47.1.10 (A:6-163) Peroxiredoxin-3 (AOP-1, SP-22) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1zofa1 c.47.1.10 (A:1-170) Thioredoxin reductase TsaA {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2fy6a1 c.47.1.10 (A:33-175) Peptide methionine sulfoxide reductase MsrA/MsrB, N-terminal domain {Neisseria meningitidis serogroup A [TaxId: 65699]} Back     information, alignment and structure
>d1o8xa_ c.47.1.10 (A:) Tryparedoxin I {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1psqa_ c.47.1.10 (A:) Probable thiol peroxidase PsaD {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1n8ja_ c.47.1.10 (A:) Alkyl hydroperoxide reductase AhpC {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1q98a_ c.47.1.10 (A:) Thiol peroxidase Tpx {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1xvqa_ c.47.1.10 (A:) Thiol peroxidase Tpx {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2zcta1 c.47.1.10 (A:6-242) Peroxiredoxin {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1prxa_ c.47.1.10 (A:) 1-Cys peroxiredoxin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xcca_ c.47.1.10 (A:) 1-Cys peroxiredoxin {Plasmodium yoelii yoelii [TaxId: 73239]} Back     information, alignment and structure
>d1knga_ c.47.1.10 (A:) Thioredoxin-like protein CcmG (CycY, DsbE) {Bradyrhizobium japonicum [TaxId: 375]} Back     information, alignment and structure
>d2h01a1 c.47.1.10 (A:2-171) Thioredoxin peroxidase 2 (thioredoxin peroxidase B, 2-cys peroxiredoxin) {Plasmodium yoelii [TaxId: 5861]} Back     information, alignment and structure
>d1z5ye1 c.47.1.10 (E:49-184) Thioredoxin-like protein CcmG (CycY, DsbE) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wp0a1 c.47.1.10 (A:138-297) Thioredoxin-like protein Sco1 (YpmQ), soluble domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b7ka1 c.47.1.10 (A:111-279) Thioredoxin-like protein Sco1 (YpmQ), soluble domain {Baker's yeast(Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1z6na1 c.47.1.1 (A:1-166) Hypothetical protein PA1234 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1hd2a_ c.47.1.10 (A:) Peroxiredoxin 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwaa_ c.47.1.1 (A:) Thioredoxin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1tp9a1 c.47.1.10 (A:1-162) Plant peroxiredoxin {Western balsam poplar(Populus trichocarpa) [TaxId: 3694]} Back     information, alignment and structure
>d1woua_ c.47.1.16 (A:) Putative 42-9-9 protein (thioredoxin containing protein Txnl5) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nw2a_ c.47.1.1 (A:) Thioredoxin {Alicyclobacillus acidocaldarius, formerly Bacillus acidocaldarius [TaxId: 405212]} Back     information, alignment and structure
>d1dbya_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii [TaxId: 3055]} Back     information, alignment and structure
>d1ep7a_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii [TaxId: 3055]} Back     information, alignment and structure
>d1thxa_ c.47.1.1 (A:) Thioredoxin {Anabaena sp., pcc 7120 [TaxId: 1167]} Back     information, alignment and structure
>d2trxa_ c.47.1.1 (A:) Thioredoxin {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nm3a2 c.47.1.10 (A:3-165) N-terminal, Prx domain of Hybrid-Prx5 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ti3a_ c.47.1.1 (A:) Thioredoxin {European aspen (Populus tremula), thioredoxin H [TaxId: 113636]} Back     information, alignment and structure
>d2fwha1 c.47.1.1 (A:428-544) Thiol:disulfide interchange protein DsbD, C-terminal domain (DsbD-gamma) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fb6a_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin M [TaxId: 3562]} Back     information, alignment and structure
>d1gh2a_ c.47.1.1 (A:) Thioredoxin-like protein, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qgva_ c.47.1.8 (A:) spliceosomal protein U5-15Kd {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifqa1 c.47.1.1 (A:1-105) Thioredoxin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xfla_ c.47.1.1 (A:) Thioredoxin {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1r26a_ c.47.1.1 (A:) Thioredoxin {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2b5ea4 c.47.1.2 (A:23-141) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zmaa1 c.47.1.1 (A:1-115) Bacterocin transport accessory protein Bta {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1f9ma_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin F [TaxId: 3562]} Back     information, alignment and structure
>d1syra_ c.47.1.1 (A:) Thioredoxin {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d2es7a1 c.47.1.20 (A:7-125) Hydrogenase-1 operon protein HyaE {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2hfda1 c.47.1.20 (A:1-132) Hydrogenase-1 operon protein HyaE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1meka_ c.47.1.2 (A:) Protein disulfide isomerase, PDI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a8la2 c.47.1.2 (A:120-226) Protein disulfide isomerase, PDI {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1fo5a_ c.47.1.1 (A:) MJ0307, thioredoxin/glutaredoxin-like protein {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1sena_ c.47.1.1 (A:) Thioredoxin-like protein p19, TLP19 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nhoa_ c.47.1.1 (A:) MTH807, thioredoxin/glutaredoxin-like protein {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2b5ea1 c.47.1.2 (A:365-504) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xiya1 c.47.1.10 (A:2-180) 1-Cys peroxiredoxin {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1hyua4 c.47.1.2 (A:103-198) Alkyl hydroperoxide reductase subunit F (AhpF), N-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2djja1 c.47.1.2 (A:6-121) Protein disulfide isomerase, PDI {Fungi (Humicola insolens) [TaxId: 34413]} Back     information, alignment and structure
>d2c0ga2 c.47.1.7 (A:1024-1145) Windbeutel, N-terminal domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2dlxa1 c.47.1.24 (A:1-147) UBX domain-containing protein 7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2trcp_ c.47.1.6 (P:) Phosducin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a8ya1 c.47.1.3 (A:3-126) Calsequestrin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1wjka_ c.47.1.1 (A:) Thioredoxin-like structure containing protein C330018D20Rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g7ea_ c.47.1.7 (A:) Endoplasmic reticulum protein ERP29, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1z6ma1 c.47.1.13 (A:1-172) Hypothetical protein EF0770 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1v58a1 c.47.1.9 (A:62-230) Thiol:disulfide interchange protein DsbG, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ktea_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1egoa_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1beda_ c.47.1.13 (A:) Disulfide-bond formation facilitator (DsbA) {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1eeja1 c.47.1.9 (A:61-216) Disulfide bond isomerase, DsbC, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r7ha_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Corynebacterium ammoniagenes [TaxId: 1697]} Back     information, alignment and structure
>d1t3ba1 c.47.1.9 (A:61-210) Disulfide bond isomerase, DsbC, C-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1h75a_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1un2a_ c.47.1.13 (A:) Disulfide-bond formation facilitator (DsbA) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2axoa1 c.47.1.19 (A:38-262) Hypothetical protein Atu2684 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1nm3a1 c.47.1.1 (A:166-239) C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1fova_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli, Grx3 [TaxId: 562]} Back     information, alignment and structure
>d1fvka_ c.47.1.13 (A:) Disulfide-bond formation facilitator (DsbA) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure