Citrus Sinensis ID: 029720
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 189 | ||||||
| 255550574 | 342 | conserved hypothetical protein [Ricinus | 0.989 | 0.546 | 0.935 | 3e-98 | |
| 225459544 | 340 | PREDICTED: UDP-galactose transporter 1 i | 0.989 | 0.55 | 0.935 | 3e-97 | |
| 356552668 | 342 | PREDICTED: UDP-galactose transporter 1-l | 0.989 | 0.546 | 0.925 | 2e-96 | |
| 357438617 | 342 | Solute carrier family 35 member E3 [Medi | 0.989 | 0.546 | 0.919 | 2e-96 | |
| 356549087 | 342 | PREDICTED: UDP-galactose transporter 1-l | 0.989 | 0.546 | 0.925 | 2e-96 | |
| 224084874 | 342 | predicted protein [Populus trichocarpa] | 0.989 | 0.546 | 0.930 | 3e-96 | |
| 358248912 | 345 | uncharacterized protein LOC100778350 [Gl | 0.994 | 0.544 | 0.925 | 7e-96 | |
| 356509420 | 345 | PREDICTED: UDP-galactose transporter 1-l | 0.994 | 0.544 | 0.920 | 1e-95 | |
| 388508342 | 342 | unknown [Medicago truncatula] | 0.989 | 0.546 | 0.914 | 1e-95 | |
| 297789749 | 336 | hypothetical protein ARALYDRAFT_497286 [ | 0.952 | 0.535 | 0.961 | 2e-95 |
| >gi|255550574|ref|XP_002516337.1| conserved hypothetical protein [Ricinus communis] gi|223544567|gb|EEF46084.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 362 bits (930), Expect = 3e-98, Method: Compositional matrix adjust.
Identities = 175/187 (93%), Positives = 181/187 (96%)
Query: 2 EASLCTWSVFRSLLAILQWWVFNVTVIITNKWIFQKLDFKFPLSVSCIHFICSSIGAYLV 61
E+ LC WSVFRSLLAI+QWWVFNVTVII NKWIFQKLDFKFPL+VSC+HFICSSIGAYL
Sbjct: 3 ESVLCQWSVFRSLLAIIQWWVFNVTVIIMNKWIFQKLDFKFPLTVSCVHFICSSIGAYLA 62
Query: 62 IKVLKLKPLITVEPEDRWRRIFPMSFVFCINIVLGNVSLRYIPVSFMQTIKSFTPATTVV 121
IKVLKLKPLI V+PEDRWRRIFPMSFVFC+NIVLGNVSLRYIPVSFMQTIKSFTPATTVV
Sbjct: 63 IKVLKLKPLIVVDPEDRWRRIFPMSFVFCVNIVLGNVSLRYIPVSFMQTIKSFTPATTVV 122
Query: 122 LQWLVWRKYFDWRIWASLVPIVGGILLTSVTELSFNMFGFCAALFGCLATSTKTILAESL 181
LQWLVWRKYFDWRIWASLVPIVGGILLTSVTELSFNMFGFCAALFGCLATSTKTILAESL
Sbjct: 123 LQWLVWRKYFDWRIWASLVPIVGGILLTSVTELSFNMFGFCAALFGCLATSTKTILAESL 182
Query: 182 LHSYKFD 188
LH YKFD
Sbjct: 183 LHGYKFD 189
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|225459544|ref|XP_002285850.1| PREDICTED: UDP-galactose transporter 1 isoform 1 [Vitis vinifera] gi|225459546|ref|XP_002285851.1| PREDICTED: UDP-galactose transporter 1 isoform 2 [Vitis vinifera] gi|147794987|emb|CAN67423.1| hypothetical protein VITISV_006650 [Vitis vinifera] gi|302141824|emb|CBI19027.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356552668|ref|XP_003544685.1| PREDICTED: UDP-galactose transporter 1-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|357438617|ref|XP_003589584.1| Solute carrier family 35 member E3 [Medicago truncatula] gi|355478632|gb|AES59835.1| Solute carrier family 35 member E3 [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|356549087|ref|XP_003542929.1| PREDICTED: UDP-galactose transporter 1-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|224084874|ref|XP_002307432.1| predicted protein [Populus trichocarpa] gi|118483791|gb|ABK93788.1| unknown [Populus trichocarpa] gi|222856881|gb|EEE94428.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|358248912|ref|NP_001240217.1| uncharacterized protein LOC100778350 [Glycine max] gi|255644617|gb|ACU22811.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356509420|ref|XP_003523447.1| PREDICTED: UDP-galactose transporter 1-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|388508342|gb|AFK42237.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|297789749|ref|XP_002862808.1| hypothetical protein ARALYDRAFT_497286 [Arabidopsis lyrata subsp. lyrata] gi|297308543|gb|EFH39066.1| hypothetical protein ARALYDRAFT_497286 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 189 | ||||||
| TAIR|locus:2204690 | 336 | AT1G77610 [Arabidopsis thalian | 0.952 | 0.535 | 0.894 | 6.2e-85 | |
| TAIR|locus:2201138 | 341 | GONST5 "golgi nucleotide sugar | 0.989 | 0.548 | 0.845 | 2.7e-84 | |
| DICTYBASE|DDB_G0287319 | 348 | DDB_G0287319 "TPT transporter | 0.878 | 0.477 | 0.36 | 7.6e-25 | |
| TAIR|locus:2166384 | 309 | AT5G05820 [Arabidopsis thalian | 0.920 | 0.563 | 0.321 | 2e-24 | |
| TAIR|locus:2074713 | 308 | AT3G11320 [Arabidopsis thalian | 0.920 | 0.564 | 0.316 | 3.3e-24 | |
| TAIR|locus:2146683 | 309 | AT5G04160 "AT5G04160" [Arabido | 0.968 | 0.592 | 0.309 | 1.3e-22 | |
| TAIR|locus:2076239 | 355 | AT3G10290 [Arabidopsis thalian | 0.925 | 0.492 | 0.312 | 4.3e-22 | |
| TAIR|locus:2034730 | 361 | AT1G12500 [Arabidopsis thalian | 0.878 | 0.459 | 0.305 | 1.5e-19 | |
| UNIPROTKB|F1PZV1 | 405 | SLC35E2B "Uncharacterized prot | 0.973 | 0.454 | 0.282 | 1.5e-15 | |
| UNIPROTKB|P0CK96 | 405 | SLC35E2B "Solute carrier famil | 0.973 | 0.454 | 0.282 | 1.5e-15 |
| TAIR|locus:2204690 AT1G77610 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 850 (304.3 bits), Expect = 6.2e-85, P = 6.2e-85
Identities = 161/180 (89%), Positives = 164/180 (91%)
Query: 9 SVFRSLLAILQWWVFNVTVIITNKWIFQKLDFKFPLSVSCIHFICSSIGAYXXXXXXXXX 68
S+FRSLLAILQWW FNVTVII NKWIFQKLDFKFPLSVSC+HFICSSIGAY
Sbjct: 5 SMFRSLLAILQWWGFNVTVIIMNKWIFQKLDFKFPLSVSCVHFICSSIGAYIVIKVLKLK 64
Query: 69 XXXTVEPEDRWRRIFPMSFVFCINIVLGNVSLRYIPVSFMQTIKSFTPATTVVLQWLVWR 128
V+PEDRWRRIFPMSFVFCINIVLGNVSLRYIPVSFMQTIKSFTPATTVVLQWLVWR
Sbjct: 65 PLIVVDPEDRWRRIFPMSFVFCINIVLGNVSLRYIPVSFMQTIKSFTPATTVVLQWLVWR 124
Query: 129 KYFDWRIWASLVPIVGGILLTSVTELSFNMFGFCAALFGCLATSTKTILAESLLHSYKFD 188
KYFDWRIWASLVPIVGGILLTSVTELSFNMFGFCAALFGCLATSTKTILAESLLH YKFD
Sbjct: 125 KYFDWRIWASLVPIVGGILLTSVTELSFNMFGFCAALFGCLATSTKTILAESLLHGYKFD 184
|
|
| TAIR|locus:2201138 GONST5 "golgi nucleotide sugar transporter 5" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0287319 DDB_G0287319 "TPT transporter family protein" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2166384 AT5G05820 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2074713 AT3G11320 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2146683 AT5G04160 "AT5G04160" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2076239 AT3G10290 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2034730 AT1G12500 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PZV1 SLC35E2B "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P0CK96 SLC35E2B "Solute carrier family 35 member E2B" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00015381001 | SubName- Full=Putative uncharacterized protein (Chromosome chr18 scaffold_1, whole genome shotgun sequence); (340 aa) | |||||||
(Vitis vinifera) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 189 | |||
| TIGR00817 | 302 | TIGR00817, tpt, Tpt phosphate/phosphoenolpyruvate | 1e-16 | |
| PTZ00343 | 350 | PTZ00343, PTZ00343, triose or hexose phosphate/pho | 4e-13 | |
| pfam08449 | 303 | pfam08449, UAA, UAA transporter family | 3e-04 |
| >gnl|CDD|129898 TIGR00817, tpt, Tpt phosphate/phosphoenolpyruvate translocator | Back alignment and domain information |
|---|
Score = 75.5 bits (186), Expect = 1e-16
Identities = 53/170 (31%), Positives = 79/170 (46%), Gaps = 6/170 (3%)
Query: 20 WWVFNVTVIITNKWIFQKLDFKFPLSVSCIHFICSSIGAYLV-IKVLKLKPLITVEPEDR 78
W+ NV I NK + F +P + I S+ L L + I+
Sbjct: 10 WYFLNVYFNIYNKKLLNV--FPYPYFKTLISLAVGSLYCLLSWSSGLPKRLKISSA---L 64
Query: 79 WRRIFPMSFVFCINIVLGNVSLRYIPVSFMQTIKSFTPATTVVLQWLVWRKYFDWRIWAS 138
+ + P++ V I V NVSL + VSF TIK+ P +VVL + F +W S
Sbjct: 65 LKLLLPVAIVHTIGHVTSNVSLSKVAVSFTHTIKAMEPFFSVVLSAFFLGQEFPSTLWLS 124
Query: 139 LVPIVGGILLTSVTELSFNMFGFCAALFGCLATSTKTILAESLLHSYKFD 188
L+PIVGG+ L S TELSFN GF +A+ + ++ I ++ + D
Sbjct: 125 LLPIVGGVALASDTELSFNWAGFLSAMISNITFVSRNIFSKKAMTIKSLD 174
|
The 6-8 TMS Triose-phosphate Transporter (TPT) Family (TC 2.A.7.9)Functionally characterized members of the TPT family are derived from the inner envelope membranes of chloroplasts and nongreen plastids of plants. However,homologues are also present in yeast. Saccharomyces cerevisiae has three functionally uncharacterized TPT paralogues encoded within its genome. Under normal physiologicalconditions, chloroplast TPTs mediate a strict antiport of substrates, frequently exchanging an organic three carbon compound phosphate ester for inorganic phosphate (Pi).Normally, a triose-phosphate, 3-phosphoglycerate, or another phosphorylated C3 compound made in the chloroplast during photosynthesis, exits the organelle into thecytoplasm of the plant cell in exchange for Pi. However, experiments with reconstituted translocator in artificial membranes indicate that transport can also occur by achannel-like uniport mechanism with up to 10-fold higher transport rates. Channel opening may be induced by a membrane potential of large magnitude and/or by high substrateconcentrations. Nongreen plastid and chloroplast carriers, such as those from maize endosperm and root membranes, mediate transport of C3 compounds phosphorylated atcarbon atom 2, particularly phosphenolpyruvate, in exchange for Pi. These are the phosphoenolpyruvate:Pi antiporters (PPT). Glucose-6-P has also been shown to be asubstrate of some plastid translocators (GPT). The three types of proteins (TPT, PPT and GPT) are divergent in sequence as well as substrate specificity, but their substratespecificities overlap [Hypothetical proteins, Conserved]. Length = 302 |
| >gnl|CDD|240371 PTZ00343, PTZ00343, triose or hexose phosphate/phosphate translocator; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219846 pfam08449, UAA, UAA transporter family | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 189 | |||
| PTZ00343 | 350 | triose or hexose phosphate/phosphate translocator; | 99.96 | |
| TIGR00817 | 302 | tpt Tpt phosphate/phosphoenolpyruvate translocator | 99.96 | |
| KOG1441 | 316 | consensus Glucose-6-phosphate/phosphate and phosph | 99.95 | |
| KOG1444 | 314 | consensus Nucleotide-sugar transporter VRG4/SQV-7 | 99.89 | |
| KOG1443 | 349 | consensus Predicted integral membrane protein [Fun | 99.85 | |
| PF08449 | 303 | UAA: UAA transporter family; InterPro: IPR013657 T | 99.83 | |
| PLN00411 | 358 | nodulin MtN21 family protein; Provisional | 99.8 | |
| PF06027 | 334 | DUF914: Eukaryotic protein of unknown function (DU | 99.75 | |
| TIGR00688 | 256 | rarD rarD protein. This uncharacterized protein is | 99.74 | |
| KOG1442 | 347 | consensus GDP-fucose transporter [Carbohydrate tra | 99.74 | |
| PRK11272 | 292 | putative DMT superfamily transporter inner membran | 99.73 | |
| PRK11689 | 295 | aromatic amino acid exporter; Provisional | 99.72 | |
| TIGR00950 | 260 | 2A78 Carboxylate/Amino Acid/Amine Transporter. | 99.72 | |
| PRK11453 | 299 | O-acetylserine/cysteine export protein; Provisiona | 99.72 | |
| PRK15430 | 296 | putative chloramphenical resistance permease RarD; | 99.69 | |
| PRK10532 | 293 | threonine and homoserine efflux system; Provisiona | 99.61 | |
| COG5070 | 309 | VRG4 Nucleotide-sugar transporter [Carbohydrate tr | 99.57 | |
| TIGR03340 | 281 | phn_DUF6 phosphonate utilization associated putati | 99.54 | |
| KOG1582 | 367 | consensus UDP-galactose transporter related protei | 99.5 | |
| KOG1581 | 327 | consensus UDP-galactose transporter related protei | 99.47 | |
| PF00892 | 126 | EamA: EamA-like transporter family; InterPro: IPR0 | 99.45 | |
| COG0697 | 292 | RhaT Permeases of the drug/metabolite transporter | 99.45 | |
| PF04142 | 244 | Nuc_sug_transp: Nucleotide-sugar transporter; Inte | 99.41 | |
| KOG2765 | 416 | consensus Predicted membrane protein [Function unk | 99.39 | |
| KOG1580 | 337 | consensus UDP-galactose transporter related protei | 99.36 | |
| KOG3912 | 372 | consensus Predicted integral membrane protein [Gen | 99.27 | |
| PF13536 | 113 | EmrE: Multidrug resistance efflux transporter | 99.25 | |
| TIGR00776 | 290 | RhaT RhaT L-rhamnose-proton symporter family prote | 99.21 | |
| COG2510 | 140 | Predicted membrane protein [Function unknown] | 99.2 | |
| KOG2234 | 345 | consensus Predicted UDP-galactose transporter [Car | 99.18 | |
| TIGR00950 | 260 | 2A78 Carboxylate/Amino Acid/Amine Transporter. | 99.04 | |
| KOG1583 | 330 | consensus UDP-N-acetylglucosamine transporter [Car | 98.96 | |
| COG2962 | 293 | RarD Predicted permeases [General function predict | 98.92 | |
| COG5006 | 292 | rhtA Threonine/homoserine efflux transporter [Amin | 98.88 | |
| PLN00411 | 358 | nodulin MtN21 family protein; Provisional | 98.84 | |
| PRK11272 | 292 | putative DMT superfamily transporter inner membran | 98.77 | |
| KOG4510 | 346 | consensus Permease of the drug/metabolite transpor | 98.74 | |
| PF03151 | 153 | TPT: Triose-phosphate Transporter family; InterPro | 98.74 | |
| PRK10532 | 293 | threonine and homoserine efflux system; Provisiona | 98.65 | |
| PRK15051 | 111 | 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol fl | 98.63 | |
| TIGR00817 | 302 | tpt Tpt phosphate/phosphoenolpyruvate translocator | 98.61 | |
| PRK11689 | 295 | aromatic amino acid exporter; Provisional | 98.54 | |
| PRK11453 | 299 | O-acetylserine/cysteine export protein; Provisiona | 98.49 | |
| KOG2766 | 336 | consensus Predicted membrane protein [Function unk | 98.47 | |
| KOG4314 | 290 | consensus Predicted carbohydrate/phosphate translo | 98.47 | |
| PTZ00343 | 350 | triose or hexose phosphate/phosphate translocator; | 98.4 | |
| TIGR03340 | 281 | phn_DUF6 phosphonate utilization associated putati | 98.38 | |
| PRK15430 | 296 | putative chloramphenical resistance permease RarD; | 98.21 | |
| TIGR00776 | 290 | RhaT RhaT L-rhamnose-proton symporter family prote | 98.2 | |
| PRK02971 | 129 | 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol fl | 98.1 | |
| COG0697 | 292 | RhaT Permeases of the drug/metabolite transporter | 98.07 | |
| PRK10452 | 120 | multidrug efflux system protein MdtJ; Provisional | 97.92 | |
| PRK09541 | 110 | emrE multidrug efflux protein; Reviewed | 97.78 | |
| COG2076 | 106 | EmrE Membrane transporters of cations and cationic | 97.76 | |
| PRK11431 | 105 | multidrug efflux system protein; Provisional | 97.75 | |
| PF08449 | 303 | UAA: UAA transporter family; InterPro: IPR013657 T | 97.75 | |
| PRK10650 | 109 | multidrug efflux system protein MdtI; Provisional | 97.7 | |
| PF06800 | 269 | Sugar_transport: Sugar transport protein; InterPro | 97.68 | |
| COG5006 | 292 | rhtA Threonine/homoserine efflux transporter [Amin | 97.66 | |
| TIGR00803 | 222 | nst UDP-galactose transporter. NSTs generally appe | 97.45 | |
| PF06027 | 334 | DUF914: Eukaryotic protein of unknown function (DU | 97.31 | |
| PF06800 | 269 | Sugar_transport: Sugar transport protein; InterPro | 97.26 | |
| PF04657 | 138 | DUF606: Protein of unknown function, DUF606; Inter | 97.22 | |
| PF00893 | 93 | Multi_Drug_Res: Small Multidrug Resistance protein | 97.21 | |
| COG2962 | 293 | RarD Predicted permeases [General function predict | 97.13 | |
| KOG1441 | 316 | consensus Glucose-6-phosphate/phosphate and phosph | 96.98 | |
| PF05653 | 300 | Mg_trans_NIPA: Magnesium transporter NIPA; InterPr | 96.68 | |
| TIGR00803 | 222 | nst UDP-galactose transporter. NSTs generally appe | 96.64 | |
| PF10639 | 113 | UPF0546: Uncharacterised protein family UPF0546; I | 96.51 | |
| PRK13499 | 345 | rhamnose-proton symporter; Provisional | 96.38 | |
| TIGR00688 | 256 | rarD rarD protein. This uncharacterized protein is | 95.29 | |
| KOG2765 | 416 | consensus Predicted membrane protein [Function unk | 95.03 | |
| KOG2922 | 335 | consensus Uncharacterized conserved protein [Funct | 94.84 | |
| COG3238 | 150 | Uncharacterized protein conserved in bacteria [Fun | 94.62 | |
| KOG4510 | 346 | consensus Permease of the drug/metabolite transpor | 94.03 | |
| KOG1581 | 327 | consensus UDP-galactose transporter related protei | 92.97 | |
| PF04142 | 244 | Nuc_sug_transp: Nucleotide-sugar transporter; Inte | 92.47 | |
| PRK13499 | 345 | rhamnose-proton symporter; Provisional | 91.68 | |
| KOG1444 | 314 | consensus Nucleotide-sugar transporter VRG4/SQV-7 | 90.83 | |
| KOG1580 | 337 | consensus UDP-galactose transporter related protei | 90.05 | |
| PF06379 | 344 | RhaT: L-rhamnose-proton symport protein (RhaT); In | 89.17 | |
| COG4975 | 288 | GlcU Putative glucose uptake permease [Carbohydrat | 85.69 | |
| COG5070 | 309 | VRG4 Nucleotide-sugar transporter [Carbohydrate tr | 85.26 | |
| KOG3912 | 372 | consensus Predicted integral membrane protein [Gen | 84.8 |
| >PTZ00343 triose or hexose phosphate/phosphate translocator; Provisional | Back alignment and domain information |
|---|
Probab=99.96 E-value=2.2e-27 Score=197.01 Aligned_cols=174 Identities=23% Similarity=0.418 Sum_probs=155.4
Q ss_pred hhHHHHHHHHHHHHHHHHHHHHHHHHhhcCCCCchhHHHHHHHHHHHHHHHHHHHHHhcCCCccCC-hhHHHHHHHHHHH
Q 029720 9 SVFRSLLAILQWWVFNVTVIITNKWIFQKLDFKFPLSVSCIHFICSSIGAYLVIKVLKLKPLITVE-PEDRWRRIFPMSF 87 (189)
Q Consensus 9 ~~~~~~~~~~~~~~~s~~~~~~nK~~~~~~~f~~p~~l~~~r~~~~~~~l~~~~~~~~~~~~~~~~-~~~~~~~~l~~~~ 87 (189)
.+++..+.|..|+.+|+..++.||+++++ +|+|++++++|++++.+.+.+.+. .+.++.++.+ ++++++.++|+|+
T Consensus 46 ~~~~~~~~~~~wy~~s~~~~~~nK~vl~~--~~~P~~l~~~~~~~~~l~~~~~~~-~~~~~~~~~~~~~~~~~~llp~gl 122 (350)
T PTZ00343 46 FKWKLALLFLTWYALNVLYVVDNKLALNM--LPLPWTISSLQLFVGWLFALLYWA-TGFRKIPRIKSLKLFLKNFLPQGL 122 (350)
T ss_pred ccHHHHHHHHHHHHHHHHHHHHHHHHHHh--CChhHHHHHHHHHHHHHHHHHHHH-hCCCCCCCCCCHHHHHHHHHHHHH
Confidence 47899999999999999999999999997 889999999999999887766543 2333333343 4567889999999
Q ss_pred HHHHHHHHhhhhhccccHhHHHHHhhhhHHHHHHHHHHHhhcccChhHHHHHHHHHHhhhhhccccccchHHHHHHHHHH
Q 029720 88 VFCINIVLGNVSLRYIPVSFMQTIKSFTPATTVVLQWLVWRKYFDWRIWASLVPIVGGILLTSVTELSFNMFGFCAALFG 167 (189)
Q Consensus 88 ~~~~~~~~~~~sl~~~~v~~~~il~~~~pi~~~il~~~~~~e~~s~~~~~~~~l~~~Gv~l~~~~~~~~~~~G~~~~l~s 167 (189)
++.......+.|+++++++++++++++.|+++++++++++|||++++++++++++++|+.+++.+|.++++.|++++++|
T Consensus 123 ~~~~~~~~~~~sl~~~svs~~~iika~~Pvft~lls~~~l~ek~s~~~~l~l~l~v~Gv~l~~~~~~~~~~~G~~~~l~s 202 (350)
T PTZ00343 123 CHLFVHFGAVISMGLGAVSFTHVVKAAEPVFTALLSILFLKQFLNLYAYLSLIPIVGGVALASVKELHFTWLAFWCAMLS 202 (350)
T ss_pred HHHHHHHHHHHHHhhccHHHHHHHHHhhHHHHHHHHHHHhCCCccHHHHHHHHHHHHHHHheecccchhHHHHHHHHHHH
Confidence 98777777889999999999999999999999999999999999999999999999999999888888899999999999
Q ss_pred HHHHHHHHHHHHHhhccC
Q 029720 168 CLATSTKTILAESLLHSY 185 (189)
Q Consensus 168 ~~~~a~~~v~~~~l~~~~ 185 (189)
++++++|+++.|+..+++
T Consensus 203 ~~~~a~~~i~~k~~~~~~ 220 (350)
T PTZ00343 203 NLGSSLRSIFAKKTMKNK 220 (350)
T ss_pred HHHHHHHHHHHHHHhccc
Confidence 999999999999998764
|
|
| >TIGR00817 tpt Tpt phosphate/phosphoenolpyruvate translocator | Back alignment and domain information |
|---|
| >KOG1441 consensus Glucose-6-phosphate/phosphate and phosphoenolpyruvate/phosphate antiporter [Carbohydrate transport and metabolism; Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1444 consensus Nucleotide-sugar transporter VRG4/SQV-7 [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG1443 consensus Predicted integral membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >PF08449 UAA: UAA transporter family; InterPro: IPR013657 This family includes transporters with a specificity for UDP-N-acetylglucosamine [] | Back alignment and domain information |
|---|
| >PLN00411 nodulin MtN21 family protein; Provisional | Back alignment and domain information |
|---|
| >PF06027 DUF914: Eukaryotic protein of unknown function (DUF914); InterPro: IPR009262 This family consists of several hypothetical proteins of unknown function | Back alignment and domain information |
|---|
| >TIGR00688 rarD rarD protein | Back alignment and domain information |
|---|
| >KOG1442 consensus GDP-fucose transporter [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PRK11272 putative DMT superfamily transporter inner membrane protein; Provisional | Back alignment and domain information |
|---|
| >PRK11689 aromatic amino acid exporter; Provisional | Back alignment and domain information |
|---|
| >TIGR00950 2A78 Carboxylate/Amino Acid/Amine Transporter | Back alignment and domain information |
|---|
| >PRK11453 O-acetylserine/cysteine export protein; Provisional | Back alignment and domain information |
|---|
| >PRK15430 putative chloramphenical resistance permease RarD; Provisional | Back alignment and domain information |
|---|
| >PRK10532 threonine and homoserine efflux system; Provisional | Back alignment and domain information |
|---|
| >COG5070 VRG4 Nucleotide-sugar transporter [Carbohydrate transport and metabolism / Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >TIGR03340 phn_DUF6 phosphonate utilization associated putative membrane protein | Back alignment and domain information |
|---|
| >KOG1582 consensus UDP-galactose transporter related protein [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1581 consensus UDP-galactose transporter related protein [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PF00892 EamA: EamA-like transporter family; InterPro: IPR000620 This domain is found in proteins including the Erwinia chrysanthemi PecM protein, which is involved in pectinase, cellulase and blue pigment regulation; and the Salmonella typhimurium PagO protein, the function of which is unknown | Back alignment and domain information |
|---|
| >COG0697 RhaT Permeases of the drug/metabolite transporter (DMT) superfamily [Carbohydrate transport and metabolism / Amino acid transport and metabolism / General function prediction only] | Back alignment and domain information |
|---|
| >PF04142 Nuc_sug_transp: Nucleotide-sugar transporter; InterPro: IPR007271 This family of membrane proteins transport nucleotide sugars from the cytoplasm into golgi vesicles | Back alignment and domain information |
|---|
| >KOG2765 consensus Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1580 consensus UDP-galactose transporter related protein [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >KOG3912 consensus Predicted integral membrane protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF13536 EmrE: Multidrug resistance efflux transporter | Back alignment and domain information |
|---|
| >TIGR00776 RhaT RhaT L-rhamnose-proton symporter family protein | Back alignment and domain information |
|---|
| >COG2510 Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2234 consensus Predicted UDP-galactose transporter [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00950 2A78 Carboxylate/Amino Acid/Amine Transporter | Back alignment and domain information |
|---|
| >KOG1583 consensus UDP-N-acetylglucosamine transporter [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >COG2962 RarD Predicted permeases [General function prediction only] | Back alignment and domain information |
|---|
| >COG5006 rhtA Threonine/homoserine efflux transporter [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PLN00411 nodulin MtN21 family protein; Provisional | Back alignment and domain information |
|---|
| >PRK11272 putative DMT superfamily transporter inner membrane protein; Provisional | Back alignment and domain information |
|---|
| >KOG4510 consensus Permease of the drug/metabolite transporter (DMT) superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >PF03151 TPT: Triose-phosphate Transporter family; InterPro: IPR004853 This family consists entirely of aligned regions from Drosophila melanogaster proteins | Back alignment and domain information |
|---|
| >PRK10532 threonine and homoserine efflux system; Provisional | Back alignment and domain information |
|---|
| >PRK15051 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE; Provisional | Back alignment and domain information |
|---|
| >TIGR00817 tpt Tpt phosphate/phosphoenolpyruvate translocator | Back alignment and domain information |
|---|
| >PRK11689 aromatic amino acid exporter; Provisional | Back alignment and domain information |
|---|
| >PRK11453 O-acetylserine/cysteine export protein; Provisional | Back alignment and domain information |
|---|
| >KOG2766 consensus Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4314 consensus Predicted carbohydrate/phosphate translocator [General function prediction only] | Back alignment and domain information |
|---|
| >PTZ00343 triose or hexose phosphate/phosphate translocator; Provisional | Back alignment and domain information |
|---|
| >TIGR03340 phn_DUF6 phosphonate utilization associated putative membrane protein | Back alignment and domain information |
|---|
| >PRK15430 putative chloramphenical resistance permease RarD; Provisional | Back alignment and domain information |
|---|
| >TIGR00776 RhaT RhaT L-rhamnose-proton symporter family protein | Back alignment and domain information |
|---|
| >PRK02971 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF; Provisional | Back alignment and domain information |
|---|
| >COG0697 RhaT Permeases of the drug/metabolite transporter (DMT) superfamily [Carbohydrate transport and metabolism / Amino acid transport and metabolism / General function prediction only] | Back alignment and domain information |
|---|
| >PRK10452 multidrug efflux system protein MdtJ; Provisional | Back alignment and domain information |
|---|
| >PRK09541 emrE multidrug efflux protein; Reviewed | Back alignment and domain information |
|---|
| >COG2076 EmrE Membrane transporters of cations and cationic drugs [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK11431 multidrug efflux system protein; Provisional | Back alignment and domain information |
|---|
| >PF08449 UAA: UAA transporter family; InterPro: IPR013657 This family includes transporters with a specificity for UDP-N-acetylglucosamine [] | Back alignment and domain information |
|---|
| >PRK10650 multidrug efflux system protein MdtI; Provisional | Back alignment and domain information |
|---|
| >PF06800 Sugar_transport: Sugar transport protein; InterPro: IPR010651 This is a family of bacterial sugar transporters approximately 300 residues long | Back alignment and domain information |
|---|
| >COG5006 rhtA Threonine/homoserine efflux transporter [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00803 nst UDP-galactose transporter | Back alignment and domain information |
|---|
| >PF06027 DUF914: Eukaryotic protein of unknown function (DUF914); InterPro: IPR009262 This family consists of several hypothetical proteins of unknown function | Back alignment and domain information |
|---|
| >PF06800 Sugar_transport: Sugar transport protein; InterPro: IPR010651 This is a family of bacterial sugar transporters approximately 300 residues long | Back alignment and domain information |
|---|
| >PF04657 DUF606: Protein of unknown function, DUF606; InterPro: IPR006750 This family contains uncharacterised bacterial proteins | Back alignment and domain information |
|---|
| >PF00893 Multi_Drug_Res: Small Multidrug Resistance protein; InterPro: IPR000390 Members of this family which have been characterised, belong to the small multidrug resistance (Smr) protein family and are integral membrane proteins | Back alignment and domain information |
|---|
| >COG2962 RarD Predicted permeases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1441 consensus Glucose-6-phosphate/phosphate and phosphoenolpyruvate/phosphate antiporter [Carbohydrate transport and metabolism; Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF05653 Mg_trans_NIPA: Magnesium transporter NIPA; InterPro: IPR008521 This family consists of several eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >TIGR00803 nst UDP-galactose transporter | Back alignment and domain information |
|---|
| >PF10639 UPF0546: Uncharacterised protein family UPF0546; InterPro: IPR018908 This family of proteins has no known function | Back alignment and domain information |
|---|
| >PRK13499 rhamnose-proton symporter; Provisional | Back alignment and domain information |
|---|
| >TIGR00688 rarD rarD protein | Back alignment and domain information |
|---|
| >KOG2765 consensus Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2922 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >COG3238 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >KOG4510 consensus Permease of the drug/metabolite transporter (DMT) superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1581 consensus UDP-galactose transporter related protein [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PF04142 Nuc_sug_transp: Nucleotide-sugar transporter; InterPro: IPR007271 This family of membrane proteins transport nucleotide sugars from the cytoplasm into golgi vesicles | Back alignment and domain information |
|---|
| >PRK13499 rhamnose-proton symporter; Provisional | Back alignment and domain information |
|---|
| >KOG1444 consensus Nucleotide-sugar transporter VRG4/SQV-7 [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG1580 consensus UDP-galactose transporter related protein [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PF06379 RhaT: L-rhamnose-proton symport protein (RhaT); InterPro: IPR004673 These proteins are members of the L-Rhamnose Symporter (RhaT) family | Back alignment and domain information |
|---|
| >COG4975 GlcU Putative glucose uptake permease [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >COG5070 VRG4 Nucleotide-sugar transporter [Carbohydrate transport and metabolism / Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >KOG3912 consensus Predicted integral membrane protein [General function prediction only] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
No hit with e-value below 0.005
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 189 | |||
| 3b5d_A | 110 | Multidrug transporter EMRE; helical membrane prote | 98.61 | |
| 2i68_A | 137 | Protein EMRE; transmembrane protein, small-multidr | 98.51 |
| >3b5d_A Multidrug transporter EMRE; helical membrane protein, multidrug resistance transporter, SMR, antiport, inner membrane, transmembrane; HET: P4P; 3.80A {Escherichia coli K12} PDB: 3b61_A 3b62_A* | Back alignment and structure |
|---|
Probab=98.61 E-value=2.4e-07 Score=63.59 Aligned_cols=69 Identities=19% Similarity=0.378 Sum_probs=62.5
Q ss_pred HHHHHHHHHHHhhhhhccccHhHHHHH-hhhhHHHHHHHHHHHhhcccChhHHHHHHHHHHhhhhhcccc
Q 029720 85 MSFVFCINIVLGNVSLRYIPVSFMQTI-KSFTPATTVVLQWLVWRKYFDWRIWASLVPIVGGILLTSVTE 153 (189)
Q Consensus 85 ~~~~~~~~~~~~~~sl~~~~v~~~~il-~~~~pi~~~il~~~~~~e~~s~~~~~~~~l~~~Gv~l~~~~~ 153 (189)
..+.+..+..+...++++.|++....+ ....|+++++.+++++||++++.+++++.++++|+.+....+
T Consensus 36 ~~~~~~~~~~~~~~al~~~p~s~ay~i~~g~~~v~~~l~~~~~~~E~~s~~~~~Gi~lIi~Gv~~l~~~~ 105 (110)
T 3b5d_A 36 TIICYCASFWLLAQTLAYIPTGIAYAIWSGVGIVLISLLSWGFFGQRLDLPAIIGMMLICAGVLIINLLS 105 (110)
T ss_pred HHHHHHHHHHHHHHHHHhCChhhHHHHHhhHHHHHHHHHHHHHhCCCCCHHHHHHHHHHHHHHHHHhcCC
Confidence 345678889999999999999999888 899999999999999999999999999999999999876543
|
| >2i68_A Protein EMRE; transmembrane protein, small-multidrug resistance, transporter, homodimer, dual topology, transport protein; NMR {Escherichia coli} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
No hit with probability above 80.00