Citrus Sinensis ID: 029744

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------19
MALCLSRSFSSYSQLHLSSLLSRCKPNFTSPNYPHKLPKSTNLPLVHHQNQICSSSYSMDAPPEGYRRNVGICLINSSKKIFAASRLDIPDSWQMPQVPYWLTYDFPPEVREKLKHQWGGDWKGQAQKWFLLKFTGKEEEINLLGDKSEKPEFGEWKWMSPEQILERAVDFKKPVYKEVFTVFTPHLQ
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEccccEEEEEEcccccccccccccccccccccHHHHHHccccccccEEEEEccEEEEEEccccccEEEccccccccccccEEEEcHHHHHcccccccHHHHHHHHHHHHHccc
ccHHHHHHHHccccccccHHcccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEcccccEEEEEEccccccccccccccEEEEcccHHHHHHHHHHccccEccccEEEEEEEEcccccHcccccccccccccccccEccccccHHHEHHccHHHHHHHHHHHHHHHc
malclsrsfssySQLHLSSLLsrckpnftspnyphklpkstnlplvhhqnqicsssysmdappegyrrnvgicliNSSKkifaasrldipdswqmpqvpywltydfppevREKLkhqwggdwkgQAQKWFLLKFTGkeeeinllgdksekpefgewkwmspeQILERAVdfkkpvykEVFTVFTPHLQ
MALCLSRSFSSYSQLHLSSLLSRCKPNFTSPNYPHKLPKSTNLPLVHHQNQICSSSYSMDAPPEGYRRNVGICLINSSKKIFAASRldipdswqmpqVPYWLTYDFPPEVREKLKHQWGGDWKGQAQKWFLLKFTGKEeeinllgdksekpefgewkwmSPEQILERAVDFKKPVYKEVFTVFTPHLQ
MAlclsrsfssysqlhlssllsRCKPNFTSPNYPHKLPKSTNLPLVHHQNQICSSSYSMDAPPEGYRRNVGICLINSSKKIFAASRLDIPDSWQMPQVPYWLTYDFPPEVREKLKHQWGGDWKGQAQKWFLLKFTGKEEEINLLGDKSEKPEFGEWKWMSPEQILERAVDFKKPVYKEVFTVFTPHLQ
****************************************************************GYRRNVGICLINSSKKIFAASRLDIPDSWQMPQVPYWLTYDFPPEVREKLKHQWGGDWKGQAQKWFLLKFTGKEEEINLLGD****PEFGEWKWMSPEQILERAVDFKKPVYKEVFTVFT****
*******SFSSY****************************TNLPLVH*****************GYRRNVGICLINSSKKIFAASRLDIPDSWQMPQVPYWLTYDFPPEVREKLKHQWGGDWKGQAQKWFLLKFTGKEEEINLLGDKSEKPEFGEWKWMSPEQILERAVDFKKPVYKEVFTVFTPHLQ
MALCLSRSFSSYSQLHLSSLLSRCKPNFTSPNYPHKLPKSTNLPLVHHQNQICSSSYSMDAPPEGYRRNVGICLINSSKKIFAASRLDIPDSWQMPQVPYWLTYDFPPEVREKLKHQWGGDWKGQAQKWFLLKFTGKEEEINLLGDKSEKPEFGEWKWMSPEQILERAVDFKKPVYKEVFTVFTPHLQ
*ALCLSRSFSSYSQLHLSSLLSRCKPNFTSPNYPHKLPKSTNLPLVHHQNQICSSSYSMDAPPEGYRRNVGICLINSSKKIFAASRLDIPDSWQMPQVPYWLTYDFPPEVREKLKHQWGGDWKGQAQKWFLLKFTGKEEEINLLGDKSEKPEFGEWKWMSPEQILERAVDFKKPVYKEVFTVFTPHLQ
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MALCLSRSFSSYSQLHLSSLLSRCKPNFTSPNYPHKLPKSTNLPLVHHQNQICSSSYSMDAPPEGYRRNVGICLINSSKKIFAASRLDIPDSWQMPQVPYWLTYDFPPEVREKLKHQWGGDWKGQAQKWFLLKFTGKEEEINLLGDKSEKPEFGEWKWMSPEQILERAVDFKKPVYKEVFTVFTPHLQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query188 2.2.26 [Sep-21-2011]
Q9CAF2216 Nudix hydrolase 26, chlor yes no 0.835 0.726 0.567 1e-56
Q9FNH4227 Nudix hydrolase 27, chlor no no 0.765 0.634 0.485 5e-43
Q9C6Z2175 Nudix hydrolase 25 OS=Ara no no 0.686 0.737 0.435 8e-34
Q2RV14165 RNA pyrophosphohydrolase yes no 0.585 0.666 0.367 1e-21
B9KN59162 RNA pyrophosphohydrolase yes no 0.617 0.716 0.371 5e-21
Q3IZC1162 RNA pyrophosphohydrolase yes no 0.617 0.716 0.371 5e-21
A3PMX6162 RNA pyrophosphohydrolase yes no 0.617 0.716 0.365 1e-20
A4WWV6162 RNA pyrophosphohydrolase yes no 0.617 0.716 0.365 2e-20
A8LKJ8160 RNA pyrophosphohydrolase yes no 0.611 0.718 0.331 6e-19
Q9RH11155 RNA pyrophosphohydrolase yes no 0.617 0.748 0.326 1e-17
>sp|Q9CAF2|NUD26_ARATH Nudix hydrolase 26, chloroplastic OS=Arabidopsis thaliana GN=NUDT26 PE=1 SV=1 Back     alignment and function desciption
 Score =  219 bits (557), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 110/194 (56%), Positives = 130/194 (67%), Gaps = 37/194 (19%)

Query: 32  NYPHKLPKSTNLPLVHHQNQ------ICSSSYSMDAPPEGYRRNVGICLINSSKKIFAAS 85
           NYP K  K ++LP +H   +            SM++PPEGYRRNVG+CL+NSSKKIF AS
Sbjct: 23  NYPSKPIKFSSLPFLHRCRKSRVSSSSARCCSSMESPPEGYRRNVGVCLMNSSKKIFTAS 82

Query: 86  RLDIPDSWQMPQ-------------------------------VPYWLTYDFPPEVREKL 114
           RLDIP +WQMPQ                                P+W+TYDFPP+VREKL
Sbjct: 83  RLDIPSAWQMPQGGIDEGEDPRVAVMRELKEETGVHSAEILAEAPHWITYDFPPDVREKL 142

Query: 115 KHQWGGDWKGQAQKWFLLKFTGKEEEINLLGDKSEKPEFGEWKWMSPEQILERAVDFKKP 174
           K +WG DWKGQAQKWFLLKFTGK+EEINLLGD +EKPEFGEW W SP+Q++E AV+FKKP
Sbjct: 143 KVRWGSDWKGQAQKWFLLKFTGKDEEINLLGDGTEKPEFGEWSWTSPDQVVENAVEFKKP 202

Query: 175 VYKEVFTVFTPHLQ 188
           VYKEV + F  HLQ
Sbjct: 203 VYKEVMSAFASHLQ 216
Mediates the hydrolysis of some nucleoside diphosphate derivatives. Can use diadenosine 5',5'''-P(1)P(5) pentaphosphate (Ap(5)A), diadenosine 5',5'''-P(1)P(4) tetraphosphate (Ap(4)A) and diadenosine 5',5'''-P(1)P(3) triphosphate (Ap(3)A) as substrates.
Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 6EC: .EC: 1EC: .EC: 1EC: 7
>sp|Q9FNH4|NUD27_ARATH Nudix hydrolase 27, chloroplastic OS=Arabidopsis thaliana GN=NUDT27 PE=1 SV=1 Back     alignment and function description
>sp|Q9C6Z2|NUD25_ARATH Nudix hydrolase 25 OS=Arabidopsis thaliana GN=NUDT25 PE=1 SV=1 Back     alignment and function description
>sp|Q2RV14|RPPH_RHORT RNA pyrophosphohydrolase OS=Rhodospirillum rubrum (strain ATCC 11170 / NCIB 8255) GN=rppH PE=3 SV=1 Back     alignment and function description
>sp|B9KN59|RPPH_RHOSK RNA pyrophosphohydrolase OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=rppH PE=3 SV=1 Back     alignment and function description
>sp|Q3IZC1|RPPH_RHOS4 RNA pyrophosphohydrolase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=rppH PE=3 SV=1 Back     alignment and function description
>sp|A3PMX6|RPPH_RHOS1 RNA pyrophosphohydrolase OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=rppH PE=3 SV=1 Back     alignment and function description
>sp|A4WWV6|RPPH_RHOS5 RNA pyrophosphohydrolase OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=rppH PE=3 SV=1 Back     alignment and function description
>sp|A8LKJ8|RPPH_DINSH RNA pyrophosphohydrolase OS=Dinoroseobacter shibae (strain DFL 12) GN=rppH PE=3 SV=1 Back     alignment and function description
>sp|Q9RH11|RPPH_ZYMMO RNA pyrophosphohydrolase OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=rppH PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query188
351723651201 uncharacterized protein LOC100499956 [Gl 0.904 0.845 0.561 1e-57
225439029228 PREDICTED: nudix hydrolase 26, chloropla 0.994 0.820 0.581 3e-57
296085800247 unnamed protein product [Vitis vinifera] 0.914 0.696 0.602 4e-57
1888557199 diadenosine 5',5'''-P1,P4-tetraphosphate 0.893 0.844 0.568 1e-56
449434516196 PREDICTED: nudix hydrolase 26, chloropla 0.691 0.663 0.664 6e-56
388520281202 unknown [Lotus japonicus] 0.845 0.787 0.590 7e-56
224113401163 predicted protein [Populus trichocarpa] 0.696 0.803 0.666 1e-55
356576388199 PREDICTED: nudix hydrolase 26, chloropla 0.808 0.763 0.588 2e-55
297829614222 hypothetical protein ARALYDRAFT_317863 [ 0.835 0.707 0.572 4e-55
15228345216 nudix hydrolase 26 [Arabidopsis thaliana 0.835 0.726 0.567 6e-55
>gi|351723651|ref|NP_001238566.1| uncharacterized protein LOC100499956 [Glycine max] gi|255627971|gb|ACU14330.1| unknown [Glycine max] Back     alignment and taxonomy information
 Score =  227 bits (579), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 123/219 (56%), Positives = 140/219 (63%), Gaps = 49/219 (22%)

Query: 1   MALCLSRSFSSYSQLHLSSLLSRCKPNFTSPNYPHKLPKSTNLPLVHHQNQICSSSYSMD 60
           MALC  R   SYS    S++       F  P YP K  K + LPL         S  +M+
Sbjct: 1   MALC--RFAYSYSPASASTI-------FRFPKYPSKHTKFSLLPL---------SFSTME 42

Query: 61  APPEGYRRNVGICLINSSKKIFAASRLDIPDSWQMPQ----------------------- 97
           APPEGYRRNVGICL+N+ KKIFAASRLDIP++WQMPQ                       
Sbjct: 43  APPEGYRRNVGICLMNNHKKIFAASRLDIPNAWQMPQGGIDEGEDPRNAAIRELREETGV 102

Query: 98  --------VPYWLTYDFPPEVREKLKHQWGGDWKGQAQKWFLLKFTGKEEEINLLGDKSE 149
                   VPYWLTYDFPP+VREKL  QWG DWKGQAQKWFL KFTG+++EINLLGD +E
Sbjct: 103 NSVEVIAEVPYWLTYDFPPKVREKLNIQWGSDWKGQAQKWFLFKFTGQDQEINLLGDGTE 162

Query: 150 KPEFGEWKWMSPEQILERAVDFKKPVYKEVFTVFTPHLQ 188
           K EFGEW W+SPEQ++E AVDFKKPVYKEV  VF PH Q
Sbjct: 163 KAEFGEWSWISPEQVIELAVDFKKPVYKEVLAVFAPHFQ 201

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225439029|ref|XP_002263671.1| PREDICTED: nudix hydrolase 26, chloroplastic isoform 2 [Vitis vinifera] Back     alignment and taxonomy information
>gi|296085800|emb|CBI31124.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|1888557|gb|AAC49902.1| diadenosine 5',5'''-P1,P4-tetraphosphate hydrolase [Lupinus angustifolius] Back     alignment and taxonomy information
>gi|449434516|ref|XP_004135042.1| PREDICTED: nudix hydrolase 26, chloroplastic-like [Cucumis sativus] gi|449531509|ref|XP_004172728.1| PREDICTED: nudix hydrolase 26, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|388520281|gb|AFK48202.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|224113401|ref|XP_002316484.1| predicted protein [Populus trichocarpa] gi|222865524|gb|EEF02655.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356576388|ref|XP_003556314.1| PREDICTED: nudix hydrolase 26, chloroplastic-like [Glycine max] Back     alignment and taxonomy information
>gi|297829614|ref|XP_002882689.1| hypothetical protein ARALYDRAFT_317863 [Arabidopsis lyrata subsp. lyrata] gi|297328529|gb|EFH58948.1| hypothetical protein ARALYDRAFT_317863 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|15228345|ref|NP_187673.1| nudix hydrolase 26 [Arabidopsis thaliana] gi|75308944|sp|Q9CAF2.1|NUD26_ARATH RecName: Full=Nudix hydrolase 26, chloroplastic; Short=AtNUDT26; AltName: Full=Bis(5'-nucleosyl)-tetraphosphatase (asymmetrical); Flags: Precursor gi|12322789|gb|AAG51386.1|AC011560_18 putative diadenosine 5',5'''-P1,P4-tetraphosphate hydrolase; 27094-25792 [Arabidopsis thaliana] gi|13877849|gb|AAK44002.1|AF370187_1 putative diadenosine 5',5'''-P1,P4-tetraphosphate hydrolase [Arabidopsis thaliana] gi|16323514|gb|AAL15251.1| putative diadenosine 5',5'''-P1,P4-tetraphosphate hydrolase [Arabidopsis thaliana] gi|332641414|gb|AEE74935.1| nudix hydrolase 26 [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query188
TAIR|locus:2075840216 NUDX26 "AT3G10620" [Arabidopsi 0.5 0.435 0.734 6.1e-39
TAIR|locus:2202487175 NUDX25 "AT1G30110" [Arabidopsi 0.457 0.491 0.516 1.9e-37
TAIR|locus:2164220227 NUDX27 "AT5G06340" [Arabidopsi 0.478 0.396 0.633 6.2e-30
TIGR_CMR|SPO_3585161 SPO_3585 "hydrolase, NUDIX fam 0.430 0.503 0.390 8.8e-23
TIGR_CMR|CBU_1551228 CBU_1551 "MutT/nudix family pr 0.446 0.368 0.386 3.1e-19
UNIPROTKB|Q47Y27171 rppH "RNA pyrophosphohydrolase 0.420 0.461 0.380 5.5e-18
TIGR_CMR|CPS_3625171 CPS_3625 "(di)nucleoside polyp 0.420 0.461 0.380 5.5e-18
UNIPROTKB|Q9KU53172 rppH "RNA pyrophosphohydrolase 0.409 0.447 0.337 9.2e-15
TIGR_CMR|VC_0671172 VC_0671 "MutT/nudix family pro 0.409 0.447 0.337 9.2e-15
TIGR_CMR|SO_1331174 SO_1331 "MutT/nudix family pro 0.409 0.442 0.380 1.9e-14
TAIR|locus:2075840 NUDX26 "AT3G10620" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 416 (151.5 bits), Expect = 6.1e-39, P = 6.1e-39
 Identities = 69/94 (73%), Positives = 82/94 (87%)

Query:    95 MPQVPYWLTYDFPPEVREKLKHQWGGDWKGQAQKWFLLKFTGKEEEINLLGDKSEKPEFG 154
             + + P+W+TYDFPP+VREKLK +WG DWKGQAQKWFLLKFTGK+EEINLLGD +EKPEFG
Sbjct:   123 LAEAPHWITYDFPPDVREKLKVRWGSDWKGQAQKWFLLKFTGKDEEINLLGDGTEKPEFG 182

Query:   155 EWKWMSPEQILERAVDFKKPVYKEVFTVFTPHLQ 188
             EW W SP+Q++E AV+FKKPVYKEV + F  HLQ
Sbjct:   183 EWSWTSPDQVVENAVEFKKPVYKEVMSAFASHLQ 216
GO:0004081 "bis(5'-nucleosyl)-tetraphosphatase (asymmetrical) activity" evidence=ISS
GO:0009507 "chloroplast" evidence=ISM;IDA
GO:0034432 "bis(5'-adenosyl)-pentaphosphatase activity" evidence=IDA
GO:0019243 "methylglyoxal catabolic process to D-lactate" evidence=RCA
GO:0006753 "nucleoside phosphate metabolic process" evidence=IDA
GO:0008893 "guanosine-3',5'-bis(diphosphate) 3'-diphosphatase activity" evidence=IDA
TAIR|locus:2202487 NUDX25 "AT1G30110" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2164220 NUDX27 "AT5G06340" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TIGR_CMR|SPO_3585 SPO_3585 "hydrolase, NUDIX family, NudH subfamily" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
TIGR_CMR|CBU_1551 CBU_1551 "MutT/nudix family protein" [Coxiella burnetii RSA 493 (taxid:227377)] Back     alignment and assigned GO terms
UNIPROTKB|Q47Y27 rppH "RNA pyrophosphohydrolase" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
TIGR_CMR|CPS_3625 CPS_3625 "(di)nucleoside polyphosphate hydrolase" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
UNIPROTKB|Q9KU53 rppH "RNA pyrophosphohydrolase" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] Back     alignment and assigned GO terms
TIGR_CMR|VC_0671 VC_0671 "MutT/nudix family protein" [Vibrio cholerae O1 biovar El Tor (taxid:686)] Back     alignment and assigned GO terms
TIGR_CMR|SO_1331 SO_1331 "MutT/nudix family protein" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9CAF2NUD26_ARATH3, ., 6, ., 1, ., 1, 70.56700.83510.7268yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.6.10.963
3rd Layer3.6.1.170.946

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00033605001
SubName- Full=Chromosome chr8 scaffold_68, whole genome shotgun sequence; (228 aa)
(Vitis vinifera)
Predicted Functional Partners:
GSVIVG00016858001
SubName- Full=Chromosome chr11 scaffold_13, whole genome shotgun sequence; (405 aa)
      • 0.402
GSVIVG00030263001
SubName- Full=Chromosome chr1 scaffold_5, whole genome shotgun sequence; (142 aa)
      • 0.400

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query188
cd03671147 cd03671, Ap4A_hydrolase_plant_like, Diadenosine te 2e-51
PRK00714156 PRK00714, PRK00714, RNA pyrophosphohydrolase; Revi 1e-44
pfam00293133 pfam00293, NUDIX, NUDIX domain 1e-05
COG0494161 COG0494, MutT, NTP pyrophosphohydrolases including 3e-04
>gnl|CDD|239643 cd03671, Ap4A_hydrolase_plant_like, Diadenosine tetraphosphate (Ap4A) hydrolase is a member of the Nudix hydrolase superfamily Back     alignment and domain information 
 Score =  161 bits (410), Expect = 2e-51
 Identities = 57/152 (37%), Positives = 77/152 (50%), Gaps = 38/152 (25%)

Query: 65  GYRRNVGICLINSSKKIFAASRLDIPDSWQMPQ--------------------------- 97
            YR NVG+ L N   K+F   R+D P +WQ PQ                           
Sbjct: 1   PYRPNVGVVLFNEDGKVFVGRRIDTPGAWQFPQGGIDEGEDPEQAALRELEEETGLDPDS 60

Query: 98  ------VPYWLTYDFPPEVREKLKHQWGGDWKGQAQKWFLLKFTGKEEEINLLGDKSEKP 151
                 +P WL YD PPE++ K+   WGG ++GQ QKWFL +FTG + EI+L     E P
Sbjct: 61  VEIIAEIPDWLRYDLPPELKLKI---WGGRYRGQEQKWFLFRFTGDDSEIDLNAP--EHP 115

Query: 152 EFGEWKWMSPEQILERAVDFKKPVYKEVFTVF 183
           EF EW+W+  E++ +  V FK+PVY+ V   F
Sbjct: 116 EFDEWRWVPLEELPDLIVPFKRPVYEAVLKEF 147

Members of this family are well represented in a variety of prokaryotic and eukaryotic organisms. Phylogenetic analysis reveals two distinct subgroups where plant enzymes fall into one group (represented by this subfamily) and fungi/animals/archaea enzymes fall into another. Bacterial enzymes are found in both subfamilies. Ap4A is a potential by-product of aminoacyl tRNA synthesis, and accumulation of Ap4A has been implicated in a range of biological events, such as DNA replication, cellular differentiation, heat shock, metabolic stress, and apoptosis. Ap4A hydrolase cleaves Ap4A asymmetrically into ATP and AMP. It is important in the invasive properties of bacteria and thus presents a potential target for the inhibition of such invasive bacteria. Besides the signature nudix motif (G[X5]E[X7]REUXEEXGU where U is Ile, Leu, or Val), Ap4A hydrolase is structurally similar to the other members of the nudix superfamily with some degree of variations. Several regions in the sequences are poorly defined and substrate and metal binding sites are only predicted based on kinetic studies. Length = 147
>gnl|CDD|234820 PRK00714, PRK00714, RNA pyrophosphohydrolase; Reviewed Back     alignment and domain information
>gnl|CDD|215841 pfam00293, NUDIX, NUDIX domain Back     alignment and domain information
>gnl|CDD|223568 COG0494, MutT, NTP pyrophosphohydrolases including oxidative damage repair enzymes [DNA replication, recombination, and repair / General function prediction only] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 188
PRK00714156 RNA pyrophosphohydrolase; Reviewed 99.85
cd03671147 Ap4A_hydrolase_plant_like Diadenosine tetraphospha 99.8
PRK09438148 nudB dihydroneopterin triphosphate pyrophosphatase 98.66
PF00293134 NUDIX: NUDIX domain; InterPro: IPR000086 The gener 98.63
cd04677132 Nudix_Hydrolase_18 Members of the Nudix hydrolase 98.5
cd04679125 Nudix_Hydrolase_20 Members of the Nudix hydrolase 98.22
cd03673131 Ap6A_hydrolase Diadenosine hexaphosphate (Ap6A) hy 98.17
cd04670127 Nudix_Hydrolase_12 Members of the Nudix hydrolase 98.1
cd03672145 Dcp2p mRNA decapping enzyme 2 (Dcp2p), the catalyt 98.02
cd04676129 Nudix_Hydrolase_17 Members of the Nudix hydrolase 97.98
cd03424137 ADPRase_NUDT5 ADP-ribose pyrophosphatase (ADPRase) 97.88
cd04681130 Nudix_Hydrolase_22 Members of the Nudix hydrolase 97.83
cd03430144 GDPMH GDP-mannose glycosyl hydrolase (AKA GDP-mann 97.81
cd04678129 Nudix_Hydrolase_19 Members of the Nudix hydrolase 97.74
cd04680120 Nudix_Hydrolase_21 Members of the Nudix hydrolase 97.71
cd04700142 DR1025_like DR1025 from Deinococcus radiodurans, a 97.51
cd04673122 Nudix_Hydrolase_15 Members of the Nudix hydrolase 97.44
cd04664129 Nudix_Hydrolase_7 Members of the Nudix hydrolase s 97.44
cd04699129 Nudix_Hydrolase_39 Members of the Nudix hydrolase 97.42
cd03428130 Ap4A_hydrolase_human_like Diadenosine tetraphospha 97.4
cd04696125 Nudix_Hydrolase_37 Members of the Nudix hydrolase 97.37
cd04661132 MRP_L46 Mitochondrial ribosomal protein L46 (MRP L 97.27
cd02885165 IPP_Isomerase Isopentenyl diphosphate (IPP) isomer 97.22
cd04685133 Nudix_Hydrolase_26 Members of the Nudix hydrolase 97.2
PRK15472141 nucleoside triphosphatase NudI; Provisional 97.12
TIGR00586128 mutt mutator mutT protein. All proteins in this fa 97.1
cd04672123 Nudix_Hydrolase_14 Members of the Nudix hydrolase 97.09
cd03675134 Nudix_Hydrolase_2 Contains a crystal structure of 97.03
cd04682122 Nudix_Hydrolase_23 Members of the Nudix hydrolase 97.01
cd04683120 Nudix_Hydrolase_24 Members of the Nudix hydrolase 96.98
cd04695131 Nudix_Hydrolase_36 Members of the Nudix hydrolase 96.98
cd04693127 Nudix_Hydrolase_34 Members of the Nudix hydrolase 96.96
PLN02325144 nudix hydrolase 96.9
PRK10776129 nucleoside triphosphate pyrophosphohydrolase; Prov 96.89
cd03429131 NADH_pyrophosphatase NADH pyrophosphatase, a membe 96.84
cd02883123 Nudix_Hydrolase Nudix hydrolase is a superfamily o 96.79
cd04687128 Nudix_Hydrolase_28 Members of the Nudix hydrolase 96.77
PRK03759184 isopentenyl-diphosphate delta-isomerase; Provision 96.76
cd04684128 Nudix_Hydrolase_25 Contains a crystal structure of 96.69
cd04690118 Nudix_Hydrolase_31 Members of the Nudix hydrolase 96.68
PRK15434159 GDP-mannose mannosyl hydrolase NudD; Provisional 96.57
cd04692144 Nudix_Hydrolase_33 Members of the Nudix hydrolase 96.49
PRK15393180 NUDIX hydrolase YfcD; Provisional 96.44
TIGR02150158 IPP_isom_1 isopentenyl-diphosphate delta-isomerase 96.22
cd04669121 Nudix_Hydrolase_11 Members of the Nudix hydrolase 96.06
cd03431118 DNA_Glycosylase_C DNA glycosylase (MutY in bacteri 96.03
cd04671123 Nudix_Hydrolase_13 Members of the Nudix hydrolase 95.76
PRK10546135 pyrimidine (deoxy)nucleoside triphosphate pyrophos 95.74
cd04697126 Nudix_Hydrolase_38 Members of the Nudix hydrolase 95.73
cd03425124 MutT_pyrophosphohydrolase The MutT pyrophosphohydr 95.68
cd04511130 Nudix_Hydrolase_4 Members of the Nudix hydrolase s 95.56
cd04688126 Nudix_Hydrolase_29 Members of the Nudix hydrolase 95.51
cd04686131 Nudix_Hydrolase_27 Members of the Nudix hydrolase 95.4
cd03426157 CoAse Coenzyme A pyrophosphatase (CoAse), a member 95.33
PRK08999 312 hypothetical protein; Provisional 94.8
cd04691117 Nudix_Hydrolase_32 Members of the Nudix hydrolase 94.73
cd04667112 Nudix_Hydrolase_10 Members of the Nudix hydrolase 93.98
PRK00241256 nudC NADH pyrophosphatase; Reviewed 93.87
COG0494161 MutT NTP pyrophosphohydrolases including oxidative 93.25
cd04689125 Nudix_Hydrolase_30 Members of the Nudix hydrolase 93.11
cd03674138 Nudix_Hydrolase_1 Members of the Nudix hydrolase s 92.92
PRK05379340 bifunctional nicotinamide mononucleotide adenylylt 92.13
cd03427137 MTH1 MutT homolog-1 (MTH1) is a member of the Nudi 91.63
cd04694143 Nudix_Hydrolase_35 Members of the Nudix hydrolase 91.6
cd04666122 Nudix_Hydrolase_9 Members of the Nudix hydrolase s 91.42
PF14815114 NUDIX_4: NUDIX domain; PDB: 1VRL_A 1RRQ_A 3G0Q_A 3 90.52
cd03676180 Nudix_hydrolase_3 Members of the Nudix hydrolase s 87.41
TIGR00052185 nudix-type nucleoside diphosphatase, YffH/AdpP fam 86.28
PLN02791 770 Nudix hydrolase homolog 84.98
PRK11762185 nudE adenosine nucleotide hydrolase NudE; Provisio 81.44
>PRK00714 RNA pyrophosphohydrolase; Reviewed Back     alignment and domain information 
Probab=99.85  E-value=6.7e-21  Score=151.52  Aligned_cols=119  Identities=43%  Similarity=0.839  Sum_probs=104.1

Q ss_pred             CCCCCcceEEEEEcCCCcEEEEEeCCCCCCccCCC---------------------------------CCCceeecCChh
Q 029744           63 PEGYRRNVGICLINSSKKIFAASRLDIPDSWQMPQ---------------------------------VPYWLTYDFPPE  109 (188)
Q Consensus        63 ~~~YR~NVGivl~N~~g~Vfvg~R~d~~~aWQfPQ---------------------------------t~~WL~YDlP~~  109 (188)
                      .+.||++|+++|+|++|+||+.+|.+.++.|++|+                                 .+.|++|++|..
T Consensus         4 ~~~~~~~v~~~i~~~~g~vLL~~r~~~~~~w~~P~G~~~~gE~~~~aa~REl~EEtG~~~~~~~~~~~~~~~~~y~~~~~   83 (156)
T PRK00714          4 DDGYRPNVGIILLNRQGQVFWGRRIGQGHSWQFPQGGIDPGETPEQAMYRELYEEVGLRPEDVEILAETRDWLRYDLPKR   83 (156)
T ss_pred             CCCCCCeEEEEEEecCCEEEEEEEcCCCCeEECCcccCCCCcCHHHHHHHHHHHHhCCCccceEEEEEcCCeEEecCcHH
Confidence            44799999999999999999999987668999999                                 347999999988


Q ss_pred             hHHhhhhccCCCcccccceEEEEEEcCCCCeeeecCCCCCCCCcCceEeeChhhHhhcCCCCCHHHHHHHHHHhhhcc
Q 029744          110 VREKLKHQWGGDWKGQAQKWFLLKFTGKEEEINLLGDKSEKPEFGEWKWMSPEQILERAVDFKKPVYKEVFTVFTPHL  187 (188)
Q Consensus       110 ~~~~~~~~~~~~y~GQkQkWFL~rf~G~ds~InL~~~~~~~PEFd~WrWv~~~ell~~VV~FKR~VY~~vl~eF~p~i  187 (188)
                      ...   . ....|.||.+.|||++..+.+.+++++.  ++++|+++++|++++++++.+.+|||++++++++.|+.++
T Consensus        84 ~~~---~-~~~~~~~~~~~~fl~~~~~~~~~~~l~~--~~~~E~~~~~W~~~del~~~~~~~~r~~~~~~~~~~~~~~  155 (156)
T PRK00714         84 LVR---R-SKGVYRGQKQKWFLLRLTGDDSEINLNT--TSHPEFDAWRWVSYWYPLDQVVPFKRDVYRRVLKEFARLL  155 (156)
T ss_pred             Hhh---c-cCCcccCcEEEEEEEEecCCCccccCCC--CCCCCeeeeEeCCHHHHHHhchhhhHHHHHHHHHHHHHhh
Confidence            742   2 3678999999999999988778888852  3567999999999999999999999999999999998764

>cd03671 Ap4A_hydrolase_plant_like Diadenosine tetraphosphate (Ap4A) hydrolase is a member of the Nudix hydrolase superfamily Back     alignment and domain information
>PRK09438 nudB dihydroneopterin triphosphate pyrophosphatase; Provisional Back     alignment and domain information
>PF00293 NUDIX: NUDIX domain; InterPro: IPR000086 The generic name 'NUDIX hydrolases' (NUcleoside DIphosphate linked to some other moiety X) has been coined for this domain family [] Back     alignment and domain information
>cd04677 Nudix_Hydrolase_18 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04679 Nudix_Hydrolase_20 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd03673 Ap6A_hydrolase Diadenosine hexaphosphate (Ap6A) hydrolase is a member of the Nudix hydrolase superfamily Back     alignment and domain information
>cd04670 Nudix_Hydrolase_12 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd03672 Dcp2p mRNA decapping enzyme 2 (Dcp2p), the catalytic subunit, and Dcp1p are the two components of the decapping enzyme complex Back     alignment and domain information
>cd04676 Nudix_Hydrolase_17 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd03424 ADPRase_NUDT5 ADP-ribose pyrophosphatase (ADPRase) catalyzes the hydrolysis of ADP-ribose and a variety of additional ADP-sugar conjugates to AMP and ribose-5-phosphate Back     alignment and domain information
>cd04681 Nudix_Hydrolase_22 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd03430 GDPMH GDP-mannose glycosyl hydrolase (AKA GDP-mannose mannosyl hydrolase (GDPMH)) is a member of the Nudix hydrolase superfamily Back     alignment and domain information
>cd04678 Nudix_Hydrolase_19 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04680 Nudix_Hydrolase_21 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04700 DR1025_like DR1025 from Deinococcus radiodurans, a member of the Nudix hydrolase superfamily, show nucleoside triphosphatase and dinucleoside polyphosphate pyrophosphatase activities Back     alignment and domain information
>cd04673 Nudix_Hydrolase_15 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04664 Nudix_Hydrolase_7 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04699 Nudix_Hydrolase_39 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd03428 Ap4A_hydrolase_human_like Diadenosine tetraphosphate (Ap4A) hydrolase is a member of the Nudix hydrolase superfamily Back     alignment and domain information
>cd04696 Nudix_Hydrolase_37 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04661 MRP_L46 Mitochondrial ribosomal protein L46 (MRP L46) is a component of the large subunit (39S) of the mammalian mitochondrial ribosome and a member of the Nudix hydrolase superfamily Back     alignment and domain information
>cd02885 IPP_Isomerase Isopentenyl diphosphate (IPP) isomerase, a member of the Nudix hydrolase superfamily, is a key enzyme in the isoprenoid biosynthetic pathway Back     alignment and domain information
>cd04685 Nudix_Hydrolase_26 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PRK15472 nucleoside triphosphatase NudI; Provisional Back     alignment and domain information
>TIGR00586 mutt mutator mutT protein Back     alignment and domain information
>cd04672 Nudix_Hydrolase_14 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd03675 Nudix_Hydrolase_2 Contains a crystal structure of the Nudix hydrolase from Nitrosomonas europaea, which has an unknown function Back     alignment and domain information
>cd04682 Nudix_Hydrolase_23 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04683 Nudix_Hydrolase_24 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04695 Nudix_Hydrolase_36 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04693 Nudix_Hydrolase_34 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PLN02325 nudix hydrolase Back     alignment and domain information
>PRK10776 nucleoside triphosphate pyrophosphohydrolase; Provisional Back     alignment and domain information
>cd03429 NADH_pyrophosphatase NADH pyrophosphatase, a member of the Nudix hydrolase superfamily, catalyzes the cleavage of NADH into reduced nicotinamide mononucleotide (NMNH) and AMP Back     alignment and domain information
>cd02883 Nudix_Hydrolase Nudix hydrolase is a superfamily of enzymes found in all three kingdoms of life, and it catalyzes the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04687 Nudix_Hydrolase_28 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PRK03759 isopentenyl-diphosphate delta-isomerase; Provisional Back     alignment and domain information
>cd04684 Nudix_Hydrolase_25 Contains a crystal structure of the Nudix hydrolase from Enterococcus faecalis, which has an unknown function Back     alignment and domain information
>cd04690 Nudix_Hydrolase_31 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PRK15434 GDP-mannose mannosyl hydrolase NudD; Provisional Back     alignment and domain information
>cd04692 Nudix_Hydrolase_33 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PRK15393 NUDIX hydrolase YfcD; Provisional Back     alignment and domain information
>TIGR02150 IPP_isom_1 isopentenyl-diphosphate delta-isomerase, type 1 Back     alignment and domain information
>cd04669 Nudix_Hydrolase_11 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd03431 DNA_Glycosylase_C DNA glycosylase (MutY in bacteria and hMYH in humans) is responsible for repairing misread A*oxoG residues to C*G by removing the inappropriately paired adenine base from the DNA backbone Back     alignment and domain information
>cd04671 Nudix_Hydrolase_13 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PRK10546 pyrimidine (deoxy)nucleoside triphosphate pyrophosphohydrolase; Provisional Back     alignment and domain information
>cd04697 Nudix_Hydrolase_38 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd03425 MutT_pyrophosphohydrolase The MutT pyrophosphohydrolase is a prototypical Nudix hydrolase that catalyzes the hydrolysis of nucleoside and deoxynucleoside triphosphates (NTPs and dNTPs) by substitution at a beta-phosphorus to yield a nucleotide monophosphate (NMP) and inorganic pyrophosphate (PPi) Back     alignment and domain information
>cd04511 Nudix_Hydrolase_4 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04688 Nudix_Hydrolase_29 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04686 Nudix_Hydrolase_27 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd03426 CoAse Coenzyme A pyrophosphatase (CoAse), a member of the Nudix hydrolase superfamily, functions to catalyze the elimination of oxidized inactive CoA, which can inhibit CoA-utilizing enzymes Back     alignment and domain information
>PRK08999 hypothetical protein; Provisional Back     alignment and domain information
>cd04691 Nudix_Hydrolase_32 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04667 Nudix_Hydrolase_10 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PRK00241 nudC NADH pyrophosphatase; Reviewed Back     alignment and domain information
>COG0494 MutT NTP pyrophosphohydrolases including oxidative damage repair enzymes [DNA replication, recombination, and repair / General function prediction only] Back     alignment and domain information
>cd04689 Nudix_Hydrolase_30 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd03674 Nudix_Hydrolase_1 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PRK05379 bifunctional nicotinamide mononucleotide adenylyltransferase/ADP-ribose pyrophosphatase; Provisional Back     alignment and domain information
>cd03427 MTH1 MutT homolog-1 (MTH1) is a member of the Nudix hydrolase superfamily Back     alignment and domain information
>cd04694 Nudix_Hydrolase_35 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04666 Nudix_Hydrolase_9 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PF14815 NUDIX_4: NUDIX domain; PDB: 1VRL_A 1RRQ_A 3G0Q_A 3FSQ_A 1RRS_A 3FSP_A Back     alignment and domain information
>cd03676 Nudix_hydrolase_3 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>TIGR00052 nudix-type nucleoside diphosphatase, YffH/AdpP family Back     alignment and domain information
>PLN02791 Nudix hydrolase homolog Back     alignment and domain information
>PRK11762 nudE adenosine nucleotide hydrolase NudE; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query188
1f3y_A165 Solution Structure Of The Nudix Enzyme Diadenosine 1e-56
2kdw_A164 Solution Structure Of Rpph Mutant E53a From Escheri 1e-08
2kdv_A164 Solution Structure Of Rna Pyrophosphohydrolase Rpph 1e-08
>pdb|1F3Y|A Chain A, Solution Structure Of The Nudix Enzyme Diadenosine Tetraphosphate Hydrolase From Lupinus Angustifolius L. Length = 165 Back     alignment and structure 
Iteration: 1

 Score =  215 bits (548), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 104/161 (64%), Positives = 119/161 (73%), Gaps = 31/161 (19%)
Query: 58  SMDAPPEGYRRNVGICLINSSKKIFAASRLDIPDSWQMPQ-------------------- 97
           SMD+PPEGYRRNVGICL+N+ KKIFAASRLDIPD+WQMPQ                    
Sbjct: 5   SMDSPPEGYRRNVGICLMNNDKKIFAASRLDIPDAWQMPQGGIDEGEDPRNAAIRELREE 64
Query: 98  -----------VPYWLTYDFPPEVREKLKHQWGGDWKGQAQKWFLLKFTGKEEEINLLGD 146
                      VPYWLTYDFPP+VREKL  QWG DWKGQAQKWFL KFTG+++EINLLGD
Sbjct: 65  TGVTSAEVIAEVPYWLTYDFPPKVREKLNIQWGSDWKGQAQKWFLFKFTGQDQEINLLGD 124
Query: 147 KSEKPEFGEWKWMSPEQILERAVDFKKPVYKEVFTVFTPHL 187
            SEKPEFGEW W++PEQ+++  V+FKKPVYKEV +VF PHL
Sbjct: 125 GSEKPEFGEWSWVTPEQLIDLTVEFKKPVYKEVLSVFAPHL 165
>pdb|2KDW|A Chain A, Solution Structure Of Rpph Mutant E53a From Escherichia Coli Length = 164 Back     alignment and structure
>pdb|2KDV|A Chain A, Solution Structure Of Rna Pyrophosphohydrolase Rpph From Escherichia Coli Length = 164 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query188
1f3y_A165 Diadenosine 5',5'''-P1,P4-tetraphosphate hydrolase 5e-65
2kdv_A164 RNA pyrophosphohydrolase; nudix family, magnesium, 1e-53
2o1c_A150 DATP pyrophosphohydrolase; nudix NTP hydrolase NTP 6e-21
1xsa_A153 BIS(5'-nucleosyl)-tetraphosphatase; nudix enzyme, 4e-09
3son_A149 Hypothetical nudix hydrolase; structural genomics, 3e-08
1ktg_A138 Diadenosine tetraphosphate hydrolase; nudix, AMP, 1e-06
>1f3y_A Diadenosine 5',5'''-P1,P4-tetraphosphate hydrolase; enzyme,mixed 4-stranded beta sheet, 2-stranded antiparallel sheet; NMR {Lupinus angustifolius} SCOP: d.113.1.1 PDB: 1jkn_A* Length = 165 Back     alignment and structure
 Score =  196 bits (500), Expect = 5e-65
 Identities = 104/161 (64%), Positives = 119/161 (73%), Gaps = 31/161 (19%)

Query: 58  SMDAPPEGYRRNVGICLINSSKKIFAASRLDIPDSWQMPQ-------------------- 97
           SMD+PPEGYRRNVGICL+N+ KKIFAASRLDIPD+WQMPQ                    
Sbjct: 5   SMDSPPEGYRRNVGICLMNNDKKIFAASRLDIPDAWQMPQGGIDEGEDPRNAAIRELREE 64

Query: 98  -----------VPYWLTYDFPPEVREKLKHQWGGDWKGQAQKWFLLKFTGKEEEINLLGD 146
                      VPYWLTYDFPP+VREKL  QWG DWKGQAQKWFL KFTG+++EINLLGD
Sbjct: 65  TGVTSAEVIAEVPYWLTYDFPPKVREKLNIQWGSDWKGQAQKWFLFKFTGQDQEINLLGD 124

Query: 147 KSEKPEFGEWKWMSPEQILERAVDFKKPVYKEVFTVFTPHL 187
            SEKPEFGEW W++PEQ+++  V+FKKPVYKEV +VF PHL
Sbjct: 125 GSEKPEFGEWSWVTPEQLIDLTVEFKKPVYKEVLSVFAPHL 165
>2kdv_A RNA pyrophosphohydrolase; nudix family, magnesium, manganese, zinc; NMR {Escherichia coli} PDB: 2kdw_A Length = 164 Back     alignment and structure
>2o1c_A DATP pyrophosphohydrolase; nudix NTP hydrolase NTP pyrophosphohydrolase MUTT dihydroneo triphosphate pyrophosphohydrolase folate biosynthesis; 1.80A {Escherichia coli} PDB: 2o5w_A Length = 150 Back     alignment and structure
>1xsa_A BIS(5'-nucleosyl)-tetraphosphatase; nudix enzyme, human AP4A hydrolase, alpha-beta; NMR {Homo sapiens} SCOP: d.113.1.1 PDB: 1xsb_A 1xsc_A* Length = 153 Back     alignment and structure
>3son_A Hypothetical nudix hydrolase; structural genomics, joint center for structural GENO JCSG, protein structure initiative, PSI-biology; HET: MSE; 1.71A {Listeria monocytogenes} Length = 149 Back     alignment and structure
>1ktg_A Diadenosine tetraphosphate hydrolase; nudix, AMP, magnesium cluster; HET: AMP; 1.80A {Caenorhabditis elegans} SCOP: d.113.1.1 PDB: 1kt9_A* Length = 138 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query188
1f3y_A165 Diadenosine 5',5'''-P1,P4-tetraphosphate hydrolase 99.81
2kdv_A164 RNA pyrophosphohydrolase; nudix family, magnesium, 99.74
3u53_A155 BIS(5'-nucleosyl)-tetraphosphatase [asymmetrical]; 98.32
2o1c_A150 DATP pyrophosphohydrolase; nudix NTP hydrolase NTP 98.23
3grn_A153 MUTT related protein; structural genomics, hydrola 98.16
3eds_A153 MUTT/nudix family protein; MUT/nudix protein, prot 98.04
2jvb_A146 Protein PSU1, mRNA-decapping enzyme subunit 2; DCP 97.99
3son_A149 Hypothetical nudix hydrolase; structural genomics, 97.93
4dyw_A157 MUTT/nudix family protein; structural genomics, ni 97.84
3gg6_A156 Nudix motif 18, nucleoside diphosphate-linked moie 97.83
1sjy_A159 MUTT/nudix family protein; nudix fold, alpha-beta- 97.83
3h95_A199 Nucleoside diphosphate-linked moiety X motif 6; NU 97.83
3id9_A171 MUTT/nudix family protein; hydrolase, protein stru 97.81
2fkb_A180 Putative nudix hydrolase YFCD; putative protein, M 97.81
1ktg_A138 Diadenosine tetraphosphate hydrolase; nudix, AMP, 97.75
3shd_A153 Phosphatase NUDJ; nudix fold, nudix motif, hydrola 97.74
3i7u_A134 AP4A hydrolase; nudix protein, diadenosine polypho 97.74
1hzt_A190 Isopentenyl diphosphate delta-isomerase; dimethyla 97.68
1q27_A171 Putative nudix hydrolase DR0079; radiation resista 97.68
1vcd_A126 NDX1; nudix protein, diadenosine polyphosphate, AP 97.65
1rya_A160 GDP-mannose mannosyl hydrolase; GDP-glucose, nudix 97.64
3r03_A144 Nudix hydrolase; structural genomics, PSI2, protei 97.49
3f6a_A159 Hydrolase, nudix family; protein structure initiat 97.49
2pbt_A134 AP4A hydrolase; nudix protein, diadenosine polypho 97.47
2b0v_A153 Nudix hydrolase; structural genomics, PSI, protein 97.41
2yyh_A139 MUTT domain, 8-OXO-DGTPase domain; nudix family pr 97.37
3oga_A165 Nucleoside triphosphatase NUDI; salmonella enteric 97.36
3hhj_A158 Mutator MUTT protein; niaid, ssgcid, decode, UW, S 97.33
3ees_A153 Probable pyrophosphohydrolase; nudix, RNA pyrophos 97.32
3fcm_A197 Hydrolase, nudix family; protein structure initiat 97.29
2yvp_A182 NDX2, MUTT/nudix family protein; nudix protein, AD 97.29
2a6t_A271 SPAC19A8.12; alpha/beta/alpha, RNA binding protein 97.23
3gwy_A140 Putative CTP pyrophosphohydrolase; structural geno 97.2
2azw_A148 MUTT/nudix family protein; MUTT/nudix ,enterococcu 97.03
1nqz_A194 COA pyrophosphatase (MUTT/nudix family protein); D 97.03
3exq_A161 Nudix family hydrolase; protein structure initiati 96.96
2qjt_B352 Nicotinamide-nucleotide adenylyltransferase; two i 96.95
3q1p_A205 Phosphohydrolase (MUTT/nudix family protein); asym 96.95
1v8y_A170 ADP-ribose pyrophosphatase; nudix motif, loop-heli 96.94
2w4e_A145 MUTT/nudix family protein; ADP-ribose pyrophosphat 96.85
2pqv_A154 MUTT/nudix family protein; structu genomics, PSI-2 96.78
3cng_A189 Nudix hydrolase; structural genomics, APC7497, PSI 96.76
2rrk_A140 ORF135, CTP pyrophosphohydrolase; NMR {Escherichia 96.75
1mut_A129 MUTT, nucleoside triphosphate pyrophosphohydrolase 96.62
2qjo_A341 Bifunctional NMN adenylyltransferase/nudix hydrol; 96.53
3o8s_A206 Nudix hydrolase, ADP-ribose pyrophosphatase; struc 96.5
3q93_A176 7,8-dihydro-8-oxoguanine triphosphatase; structura 96.43
3fsp_A369 A/G-specific adenine glycosylase; protein-DNA comp 96.39
3f13_A163 Putative nudix hydrolase family member; structural 96.31
1vk6_A269 NADH pyrophosphatase; 1790429, structural genomics 96.25
3fjy_A 364 Probable MUTT1 protein; dimer, protein structure i 96.06
1x51_A155 A/G-specific adenine DNA glycosylase; nudix domain 95.75
1mk1_A207 ADPR pyrophosphatase; nudix hydrolase, adprase, ad 95.68
2b06_A155 MUTT/nudix family protein; structural genomics, P 95.59
2fb1_A226 Conserved hypothetical protein; structural genomic 95.43
3fk9_A188 Mutator MUTT protein; structural genomics, hydrola 95.41
3i9x_A187 MUTT/nudix family protein; structural genomics, hy 94.99
3dup_A300 MUTT/nudix family protein; nudix superfamily hydro 94.69
2fvv_A194 Diphosphoinositol polyphosphate phosphohydrolase 1 94.6
3o6z_A191 GDP-mannose pyrophosphatase NUDK; nudix, hydrolase 94.25
1g0s_A209 Hypothetical 23.7 kDa protein in ICC-TOLC intergen 93.56
1k2e_A156 Nudix homolog; nudix/MUTT-like fold, mixed alpha/b 93.56
1vhz_A198 ADP compounds hydrolase NUDE; structural genomics; 93.05
2dsc_A212 ADP-sugar pyrophosphatase; nudix domain, ADPR, ADP 92.65
2pny_A246 Isopentenyl-diphosphate delta-isomerase 2; caroten 92.11
2dho_A235 Isopentenyl-diphosphate delta-isomerase 1; alpha/b 92.07
3e57_A211 Uncharacterized protein TM1382; structural genomic 91.38
3q91_A218 Uridine diphosphate glucose pyrophosphatase; struc 90.32
3qsj_A232 Nudix hydrolase; structural genomics, PSI-biology, 83.89
3gz5_A240 MUTT/nudix family protein; DNA binding protein, nu 81.53
1u20_A212 U8 snoRNA-binding protein X29; modified nudix hydr 80.05
>1f3y_A Diadenosine 5',5'''-P1,P4-tetraphosphate hydrolase; enzyme,mixed 4-stranded beta sheet, 2-stranded antiparallel sheet; NMR {Lupinus angustifolius} SCOP: d.113.1.1 PDB: 1jkn_A* Back     alignment and structure
Probab=99.81  E-value=1.6e-19  Score=135.70  Aligned_cols=131  Identities=79%  Similarity=1.492  Sum_probs=112.3

Q ss_pred             cccCCCCCCCCcceEEEEEcCCCcEEEEEeCCCCCCccCCC-------------------------------CCCceeec
Q 029744           57 YSMDAPPEGYRRNVGICLINSSKKIFAASRLDIPDSWQMPQ-------------------------------VPYWLTYD  105 (188)
Q Consensus        57 ~~~~~~~~~YR~NVGivl~N~~g~Vfvg~R~d~~~aWQfPQ-------------------------------t~~WL~YD  105 (188)
                      .+|+.++..||.+|+++|+|.+|+||+.+|...+|.|++|.                               ...|++|.
T Consensus         4 ~~~~~~~~~~~~~v~~~i~~~~~~vLl~~r~~~~g~w~~PgG~ve~gE~~~~aa~RE~~EEtGl~~~~~~~~~~~~~~~~   83 (165)
T 1f3y_A            4 GSMDSPPEGYRRNVGICLMNNDKKIFAASRLDIPDAWQMPQGGIDEGEDPRNAAIRELREETGVTSAEVIAEVPYWLTYD   83 (165)
T ss_dssp             CCCSSCCSSCCCEEEEEEECTTSCEEEEEETTEEEEEECCEEECCTTCCHHHHHHHHHHHHHCCCSEEEEEECSSCCBCC
T ss_pred             ccccCCccceeeeEEEEEECCCCcEEEEecCCCCCcEECCeeccCCCCCHHHHHHHHHHHhhCCChhhhhcccccceeee
Confidence            45778888999999999999999999999986568999999                               23467889


Q ss_pred             CChhhHHhhhhccCCCcccccceEEEEEEcCCCCeeeecCCCCCCCCcCceEeeChhhHhhcCCCCCHHHHHHHHHHhhh
Q 029744          106 FPPEVREKLKHQWGGDWKGQAQKWFLLKFTGKEEEINLLGDKSEKPEFGEWKWMSPEQILERAVDFKKPVYKEVFTVFTP  185 (188)
Q Consensus       106 lP~~~~~~~~~~~~~~y~GQkQkWFL~rf~G~ds~InL~~~~~~~PEFd~WrWv~~~ell~~VV~FKR~VY~~vl~eF~p  185 (188)
                      +|......+...+...+.|+.+.+|+++..+.+.++++.++..+..|.++++|++++++.+.+.+|++++|+++++.|++
T Consensus        84 ~~~~~~~~~~~~~~~~~~~~~~~~f~~~~~~~~~~~~~~~~~~~~~E~~~~~W~~~~el~~~~~~~~~~~~~~~~~~l~~  163 (165)
T 1f3y_A           84 FPPKVREKLNIQWGSDWKGQAQKWFLFKFTGQDQEINLLGDGSEKPEFGEWSWVTPEQLIDLTVEFKKPVYKEVLSVFAP  163 (165)
T ss_dssp             CCHHHHHHHGGGSCSSCCSCBEEEEEEEECSCGGGCCCCCCSSSCCSEEEEEEECHHHHHHHBCGGGHHHHHHHHHHHGG
T ss_pred             cCccccccccccccccccCceEEEEEEEecCCcccccccCCCCCCChhheeEEecHHHHHHHhhhhhHHHHHHHHHHhhh
Confidence            99876554555667788999999999999987778887644446779999999999999999999999999999999998


Q ss_pred             cc
Q 029744          186 HL  187 (188)
Q Consensus       186 ~i  187 (188)
                      ++
T Consensus       164 ~~  165 (165)
T 1f3y_A          164 HL  165 (165)
T ss_dssp             GC
T ss_pred             cC
Confidence            75
>2kdv_A RNA pyrophosphohydrolase; nudix family, magnesium, manganese, zinc; NMR {Escherichia coli} PDB: 2kdw_A Back     alignment and structure
>3u53_A BIS(5'-nucleosyl)-tetraphosphatase [asymmetrical]; hydrolase; 2.71A {Homo sapiens} PDB: 1xsa_A 1xsb_A 1xsc_A* Back     alignment and structure
>2o1c_A DATP pyrophosphohydrolase; nudix NTP hydrolase NTP pyrophosphohydrolase MUTT dihydroneo triphosphate pyrophosphohydrolase folate biosynthesis; 1.80A {Escherichia coli} PDB: 2o5w_A Back     alignment and structure
>3grn_A MUTT related protein; structural genomics, hydrolase, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics; 1.70A {Methanosarcina mazei} Back     alignment and structure
>2jvb_A Protein PSU1, mRNA-decapping enzyme subunit 2; DCP2, mRNA decay, cytoplasm, hydrolase, manganese, metal-binding, mRNA processing; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3son_A Hypothetical nudix hydrolase; structural genomics, joint center for structural GENO JCSG, protein structure initiative, PSI-biology; HET: MSE; 1.71A {Listeria monocytogenes} Back     alignment and structure
>4dyw_A MUTT/nudix family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.50A {Burkholderia pseudomallei} Back     alignment and structure
>3gg6_A Nudix motif 18, nucleoside diphosphate-linked moiety X motif 18; NUDT18, NXR1, nucleotide hydrolase, hydrolase, structural genomics; 2.10A {Homo sapiens} Back     alignment and structure
>1sjy_A MUTT/nudix family protein; nudix fold, alpha-beta-alpha sandwich, structural genomics, BSGC structure funded by NIH; 1.39A {Deinococcus radiodurans} SCOP: d.113.1.1 PDB: 1soi_A 1su2_A* 1sz3_A* Back     alignment and structure
>3h95_A Nucleoside diphosphate-linked moiety X motif 6; NUDT6, nudix, hydrolase, GFG, GFG-1, FGF2AS, structural GENO structural genomics consortium, SGC; HET: FLC; 1.70A {Homo sapiens} Back     alignment and structure
>3id9_A MUTT/nudix family protein; hydrolase, protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.55A {Bacillus thuringiensis str} Back     alignment and structure
>2fkb_A Putative nudix hydrolase YFCD; putative protein, MAD, structural genomics, escherichia coli putative nudix hydrolase, PSI; HET: MSE; 2.00A {Escherichia coli K12} SCOP: d.113.1.2 Back     alignment and structure
>1ktg_A Diadenosine tetraphosphate hydrolase; nudix, AMP, magnesium cluster; HET: AMP; 1.80A {Caenorhabditis elegans} SCOP: d.113.1.1 PDB: 1kt9_A* Back     alignment and structure
>3shd_A Phosphatase NUDJ; nudix fold, nudix motif, hydrolase, (D)NDP/(D)NTP binding, dephosphorylation; 2.50A {Escherichia coli} PDB: 3dku_A Back     alignment and structure
>3i7u_A AP4A hydrolase; nudix protein, diadenosine polyphosphate, S genomics, NPPSFA, national project on protein structural AN functional analyses; HET: PGE PG4; 1.80A {Aquifex aeolicus} PDB: 3i7v_A* Back     alignment and structure
>1hzt_A Isopentenyl diphosphate delta-isomerase; dimethylallyl, isoprenoids; 1.45A {Escherichia coli} SCOP: d.113.1.2 PDB: 1hx3_A 1r67_A 1x84_A* 1x83_A* 1ppv_A* 1nfz_A* 1nfs_A* 1ppw_A* 1pvf_A 2veh_A* 2vej_A 2vnp_A* 2vnq_A 2g74_A 2g73_A* 2b2k_A 1i9a_A 1q54_A* 1ow2_A* 3hyq_A* Back     alignment and structure
>1q27_A Putative nudix hydrolase DR0079; radiation resistance; NMR {Deinococcus radiodurans} SCOP: d.113.1.2 PDB: 2o5f_A Back     alignment and structure
>1vcd_A NDX1; nudix protein, diadenosine polyphosphate, AP6A, thermus THER HB8, hydrolase, riken structural genomics/proteomics initia RSGI; 1.70A {Thermus thermophilus} SCOP: d.113.1.1 PDB: 1vc8_A 1vc9_A* Back     alignment and structure
>1rya_A GDP-mannose mannosyl hydrolase; GDP-glucose, nudix, nudix Mg-complex; HET: GDP; 1.30A {Escherichia coli} SCOP: d.113.1.5 PDB: 2gt2_A 2gt4_A* 2i8t_A* 2i8u_A* Back     alignment and structure
>3r03_A Nudix hydrolase; structural genomics, PSI2, protein structure INIT NEW YORK SGX research center for structural genomics, nysgx; HET: ADP; 2.49A {Rhodospirillum rubrum} SCOP: d.113.1.0 Back     alignment and structure
>3f6a_A Hydrolase, nudix family; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.02A {Clostridium perfringens atcc 13124} Back     alignment and structure
>2b0v_A Nudix hydrolase; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG, U function; 1.55A {Nitrosomonas europaea} SCOP: d.113.1.1 Back     alignment and structure
>2yyh_A MUTT domain, 8-OXO-DGTPase domain; nudix family protein, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.80A {Aquifex aeolicus} Back     alignment and structure
>3oga_A Nucleoside triphosphatase NUDI; salmonella enterica subsp. enterica serovar typhimurium STR. unknown function; HET: PO4; 1.75A {Salmonella enterica subsp} PDB: 3n77_A Back     alignment and structure
>3hhj_A Mutator MUTT protein; niaid, ssgcid, decode, UW, SBRI, infectious diseases, hydrol structural genomics; 2.10A {Bartonella henselae} Back     alignment and structure
>3ees_A Probable pyrophosphohydrolase; nudix, RNA pyrophosphohydrolase; 1.90A {Bdellovibrio bacteriovorus} PDB: 3eeu_A 3ef5_A* 3ffu_A* Back     alignment and structure
>3fcm_A Hydrolase, nudix family; protein structure initiative II(PSI II), NYSGXRC, 11180J, structural genomics; 2.20A {Clostridium perfringens atcc 13124} Back     alignment and structure
>2yvp_A NDX2, MUTT/nudix family protein; nudix protein, ADP-ribose, FAD, hydrol structural genomics, NPPSFA; HET: RBY; 1.66A {Thermus thermophilus} PDB: 2yvn_A 2yvm_A* 2yvo_A* Back     alignment and structure
>2a6t_A SPAC19A8.12; alpha/beta/alpha, RNA binding protein,hydrolase; 2.50A {Schizosaccharomyces pombe} SCOP: a.242.1.1 d.113.1.7 PDB: 2qkm_B* Back     alignment and structure
>3gwy_A Putative CTP pyrophosphohydrolase; structural genomics, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics; 2.00A {Bacteroides fragilis} SCOP: d.113.1.0 Back     alignment and structure
>2azw_A MUTT/nudix family protein; MUTT/nudix ,enterococcus faecalis, structural genomics, PSI, structure initiative; HET: 1PE; 1.90A {Enterococcus faecalis} SCOP: d.113.1.1 Back     alignment and structure
>1nqz_A COA pyrophosphatase (MUTT/nudix family protein); D.radiodurans, hydrolase; 1.70A {Deinococcus radiodurans} SCOP: d.113.1.1 PDB: 1nqy_A Back     alignment and structure
>3exq_A Nudix family hydrolase; protein structure initiative II(PSI II), NYSGXRC, 11180K, structural genomics; 2.00A {Lactobacillus brevis atcc 367} Back     alignment and structure
>2qjt_B Nicotinamide-nucleotide adenylyltransferase; two individual domains, hydrolase; HET: AMP; 2.30A {Francisella tularensis} PDB: 2r5w_B Back     alignment and structure
>3q1p_A Phosphohydrolase (MUTT/nudix family protein); asymmetric dimer, RNA exonuclease, CDP-CHO pyrophosphatase; 1.80A {Bacillus cereus} PDB: 3q4i_A Back     alignment and structure
>1v8y_A ADP-ribose pyrophosphatase; nudix motif, loop-helix-loop, MUTT family, riken structural genomics/proteomics initiative, RSGI; HET: APR; 1.65A {Thermus thermophilus} SCOP: d.113.1.1 PDB: 1v8v_A* 1v8n_A 1v8l_A* 1v8m_A* 1v8i_A 1v8r_A* 1v8s_A* 1v8t_A* 1v8w_A 1v8u_A Back     alignment and structure
>2w4e_A MUTT/nudix family protein; ADP-ribose pyrophosphatase, hydrolase; 2.00A {Deinococcus radiodurans} Back     alignment and structure
>2pqv_A MUTT/nudix family protein; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; 1.63A {Streptococcus pneumoniae} Back     alignment and structure
>3cng_A Nudix hydrolase; structural genomics, APC7497, PSI-2, protei structure initiative; 2.00A {Nitrosomonas europaea atcc 19718} Back     alignment and structure
>2rrk_A ORF135, CTP pyrophosphohydrolase; NMR {Escherichia coli} Back     alignment and structure
>1mut_A MUTT, nucleoside triphosphate pyrophosphohydrolase; DNA repair; NMR {Escherichia coli} SCOP: d.113.1.1 PDB: 1ppx_A* 1pun_A* 1puq_A* 1pus_A* 1tum_A* 3a6s_A* 3a6t_A* 3a6u_A* 3a6v_A* Back     alignment and structure
>2qjo_A Bifunctional NMN adenylyltransferase/nudix hydrol; two individual domains, hydrolase; HET: APR NAD; 2.60A {Synechocystis SP} Back     alignment and structure
>3o8s_A Nudix hydrolase, ADP-ribose pyrophosphatase; structural genomics, joint center for structural genomics, J protein structure initiative; 2.27A {Streptococcus suis} Back     alignment and structure
>3q93_A 7,8-dihydro-8-oxoguanine triphosphatase; structural genomics, structural genomics consortium, SGC, NU MUTT-like, hydrolase, magnesium binding; 1.80A {Homo sapiens} PDB: 1iry_A 3zr0_A* 3zr1_A Back     alignment and structure
>3fsp_A A/G-specific adenine glycosylase; protein-DNA complex, DNA glycosylase, transition state analog, DNA repair; HET: NRI; 2.20A {Geobacillus stearothermophilus} PDB: 3fsq_A* 1rrs_A* 1vrl_A* 1rrq_A* 3g0q_A* Back     alignment and structure
>3f13_A Putative nudix hydrolase family member; structural genomics, PSI-2, protein structure initiative; 1.70A {Chromobacterium violaceum} Back     alignment and structure
>1vk6_A NADH pyrophosphatase; 1790429, structural genomics, JCSG, PS protein structure initiative, joint center for structural G hydrolase; HET: MSE; 2.20A {Escherichia coli} SCOP: d.113.1.4 d.113.1.4 g.41.14.1 PDB: 2gb5_A Back     alignment and structure
>3fjy_A Probable MUTT1 protein; dimer, protein structure initiative II), NYSGXRC, 11181H, structural genomics; 2.15A {Bifidobacterium adolescentis atcc 1570ORGANISM_TAXID} Back     alignment and structure
>1x51_A A/G-specific adenine DNA glycosylase; nudix domain, DNA repair, alpha-3 isoform, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.113.1.3 Back     alignment and structure
>1mk1_A ADPR pyrophosphatase; nudix hydrolase, adprase, adenosine DI ribose, RV1700, hydrolase; HET: APR; 2.00A {Mycobacterium tuberculosis} SCOP: d.113.1.1 PDB: 1mp2_A 1mqe_A* 1mqw_A* 1mr2_A* Back     alignment and structure
>2b06_A MUTT/nudix family protein; structural genomics, P protein structure initiative, midwest center for structural genomics, MCSG; 1.40A {Streptococcus pneumoniae} SCOP: d.113.1.1 Back     alignment and structure
>2fb1_A Conserved hypothetical protein; structural genomics, PSI, protein STRU initiative, midwest center for structural genomics, MCSG; 2.50A {Bacteroides thetaiotaomicron} SCOP: a.4.5.68 d.113.1.6 Back     alignment and structure
>3fk9_A Mutator MUTT protein; structural genomics, hydrolase, PSI-2, protein structure initiative; 2.50A {Bacillus halodurans} Back     alignment and structure
>3i9x_A MUTT/nudix family protein; structural genomics, hydrolase, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics; 2.20A {Listeria innocua} Back     alignment and structure
>3dup_A MUTT/nudix family protein; nudix superfamily hydrolase, hydrolase 3 family, structural protein structure initiative, PSI; HET: MSE; 1.80A {Rhodospirillum rubrum atcc 11170} Back     alignment and structure
>2fvv_A Diphosphoinositol polyphosphate phosphohydrolase 1; nudix, inositol polyphosphate metabolism, structural genomics, structural genomics consortium; HET: IHP; 1.25A {Homo sapiens} SCOP: d.113.1.1 PDB: 2q9p_A* 2duk_A 3mcf_A* Back     alignment and structure
>3o6z_A GDP-mannose pyrophosphatase NUDK; nudix, hydrolase, biofilm; 2.05A {Escherichia coli} SCOP: d.113.1.1 PDB: 3o52_A* 1viu_A 3o69_A 3o61_A Back     alignment and structure
>1g0s_A Hypothetical 23.7 kDa protein in ICC-TOLC intergenic region; nudix fold, hydrolase; 1.90A {Escherichia coli} SCOP: d.113.1.1 PDB: 1g9q_A* 1ga7_A 1khz_A* 1viq_A Back     alignment and structure
>1k2e_A Nudix homolog; nudix/MUTT-like fold, mixed alpha/beta, dimer, putative NUDI hydrolase, structural genomics, unknown function; 1.80A {Pyrobaculum aerophilum} SCOP: d.113.1.1 PDB: 1jrk_A 1k26_A Back     alignment and structure
>1vhz_A ADP compounds hydrolase NUDE; structural genomics; HET: APR; 2.32A {Escherichia coli} SCOP: d.113.1.1 PDB: 1vhg_A* Back     alignment and structure
>2dsc_A ADP-sugar pyrophosphatase; nudix domain, ADPR, ADP-ribose pyrophosphatase, NUDT5, hydrolase; HET: APR; 2.00A {Homo sapiens} PDB: 2dsd_A* 3bm4_A* 2dsb_A 3aca_A* 3ac9_A* 3l85_A* Back     alignment and structure
>2pny_A Isopentenyl-diphosphate delta-isomerase 2; carotenoid biosynthesis, cholesterol biosynthesis, isomerase isoprene biosynthesis, lipid synthesis; HET: GOL; 1.81A {Homo sapiens} Back     alignment and structure
>2dho_A Isopentenyl-diphosphate delta-isomerase 1; alpha/beta protein; 1.60A {Homo sapiens} PDB: 2i6k_A* 2icj_A 2ick_A* Back     alignment and structure
>3e57_A Uncharacterized protein TM1382; structural genomics, nudix hydrolase, PSI-2, protein structure initiative; 1.89A {Thermotoga maritima} Back     alignment and structure
>3q91_A Uridine diphosphate glucose pyrophosphatase; structural genomics, structural genomics consortium, SGC, NU MUTT-like, hydrolase, magnesium binding; 2.70A {Homo sapiens} Back     alignment and structure
>3qsj_A Nudix hydrolase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE; 1.70A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>3gz5_A MUTT/nudix family protein; DNA binding protein, nudix domain, WHTH domain; 2.20A {Shewanella oneidensis} PDB: 3gz6_A* 3gz8_A* Back     alignment and structure
>1u20_A U8 snoRNA-binding protein X29; modified nudix hydrolase fold, hydrolase; 2.10A {Xenopus laevis} SCOP: d.113.1.1 PDB: 2a8t_A* 2a8q_A* 2a8p_A* 2a8r_A* 2a8s_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 188
d1jkna_165 d.113.1.1 (A:) Diadenosine tetraphosphate hydrolas 6e-38
d2fvva1135 d.113.1.1 (A:8-142) Diphosphoinositol polyphosphat 2e-05
d2fkba1161 d.113.1.2 (A:8-168) Hypothetical protein YfcD {Esc 2e-04
d2o5fa1162 d.113.1.2 (A:7-168) Hypothetical protein DR0079 {D 6e-04
d1ktga_137 d.113.1.1 (A:) Diadenosine tetraphosphate hydrolas 0.004
>d1jkna_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Narrow-leaved blue lupine (Lupinus angustifolius) [TaxId: 3871]} Length = 165 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Nudix
superfamily: Nudix
family: MutT-like
domain: Diadenosine tetraphosphate hydrolase (Ap4A hydrolase)
species: Narrow-leaved blue lupine (Lupinus angustifolius) [TaxId: 3871]

 Score =  126 bits (317), Expect = 6e-38
 Identities = 104/161 (64%), Positives = 119/161 (73%), Gaps = 31/161 (19%)

Query: 58  SMDAPPEGYRRNVGICLINSSKKIFAASRLDIPDSWQMPQ-------------------- 97
           SMD+PPEGYRRNVGICL+N+ KKIFAASRLDIPD+WQMPQ                    
Sbjct: 5   SMDSPPEGYRRNVGICLMNNDKKIFAASRLDIPDAWQMPQGGIDEGEDPRNAAIRELREE 64

Query: 98  -----------VPYWLTYDFPPEVREKLKHQWGGDWKGQAQKWFLLKFTGKEEEINLLGD 146
                      VPYWLTYDFPP+VREKL  QWG DWKGQAQKWFL KFTG+++EINLLGD
Sbjct: 65  TGVTSAEVIAEVPYWLTYDFPPKVREKLNIQWGSDWKGQAQKWFLFKFTGQDQEINLLGD 124

Query: 147 KSEKPEFGEWKWMSPEQILERAVDFKKPVYKEVFTVFTPHL 187
            SEKPEFGEW W++PEQ+++  V+FKKPVYKEV +VF PHL
Sbjct: 125 GSEKPEFGEWSWVTPEQLIDLTVEFKKPVYKEVLSVFAPHL 165
>d2fvva1 d.113.1.1 (A:8-142) Diphosphoinositol polyphosphate phosphohydrolase {Human (Homo sapiens) [TaxId: 9606]} Length = 135 Back     information, alignment and structure
>d2fkba1 d.113.1.2 (A:8-168) Hypothetical protein YfcD {Escherichia coli [TaxId: 562]} Length = 161 Back     information, alignment and structure
>d2o5fa1 d.113.1.2 (A:7-168) Hypothetical protein DR0079 {Deinococcus radiodurans str. R1 (Deinococcus radiodurans R1) [TaxId: 243230]} Length = 162 Back     information, alignment and structure
>d1ktga_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Caenorhabditis elegans [TaxId: 6239]} Length = 137 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query188
d1jkna_165 Diadenosine tetraphosphate hydrolase (Ap4A hydrola 100.0
d1xsba_153 Diadenosine tetraphosphate hydrolase (Ap4A hydrola 98.56
d1ryaa_160 GDP-mannose mannosyl hydrolase NudD {Escherichia c 98.51
d1ktga_137 Diadenosine tetraphosphate hydrolase (Ap4A hydrola 98.48
d2a6ta2151 mRNA decapping enzyme Dcp2p catalytic domain {Schi 98.39
d2fvva1135 Diphosphoinositol polyphosphate phosphohydrolase { 98.35
d2b0va1146 Hypothetical protein NE0184 {Nitrosomonas europaea 98.3
d1sjya_158 Hypothetical protein DR1025 {Deinococcus radiodura 98.21
d1vcda1126 AP6A hydrolase Ndx1 {Thermus thermophilus [TaxId: 98.17
d2fkba1161 Hypothetical protein YfcD {Escherichia coli [TaxId 98.16
d1rrqa2127 Adenine glycosylase MutY, C-terminal domain {Bacil 98.02
d1hzta_153 Isopentenyl diphosphate isomerase {Escherichia col 98.0
d2o5fa1162 Hypothetical protein DR0079 {Deinococcus radiodura 97.92
d1vk6a2131 NADH pyrophosphatase {Escherichia coli [TaxId: 562 97.76
d2azwa1147 Hypothetical protein EF1141 {Enterococcus faecalis 97.65
d1puna_129 Nucleoside triphosphate pyrophosphorylase (MutT) { 97.51
d1k2ea_152 Hypothetical protein PAE3301 {Archaeon Pyrobaculum 97.44
d1x51a1142 A/G-specific adenine DNA glycosylase {Human (Homo 97.01
d2fb1a2147 Hypothetical protein BT0354, N-terminal domain {Ba 96.17
d1mqea_202 ADP-ribose pyrophosphatase {Mycobacterium tubercul 95.93
d1irya_156 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 {Hum 95.19
d2b06a1155 Hypothetical protein SP1235 (spr1115) {Streptococc 94.66
d1v8ya_158 ADP-ribose pyrophosphatase {Thermus thermophilus [ 94.21
d1q33a_292 NUDT9 (mitochondrial ADP-ribose pyrophosphatase) { 92.09
d2fmla2202 Hypothetical protein EF2700, N-terminal domain {En 91.0
d1nqza_187 Coenzyme A pyrophosphatase {Deinococcus radioduran 86.93
d1u20a1196 U8 snorna-binding protein x29 {African clawed frog 84.59
>d1jkna_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Narrow-leaved blue lupine (Lupinus angustifolius) [TaxId: 3871]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Nudix
superfamily: Nudix
family: MutT-like
domain: Diadenosine tetraphosphate hydrolase (Ap4A hydrolase)
species: Narrow-leaved blue lupine (Lupinus angustifolius) [TaxId: 3871]

Probab=100.00  E-value=5.1e-34  Score=222.20  Aligned_cols=131  Identities=79%  Similarity=1.492  Sum_probs=120.3

Q ss_pred             cccCCCCCCCCcceEEEEEcCCCcEEEEEeCCCCCCccCCC-------------------------------CCCceeec
Q 029744           57 YSMDAPPEGYRRNVGICLINSSKKIFAASRLDIPDSWQMPQ-------------------------------VPYWLTYD  105 (188)
Q Consensus        57 ~~~~~~~~~YR~NVGivl~N~~g~Vfvg~R~d~~~aWQfPQ-------------------------------t~~WL~YD  105 (188)
                      .||+.+|++||+||||||+|++|+||+++|.+.+|.|||||                               ....+.+.
T Consensus         4 ~~~~~~~~~yR~~Vg~vI~n~~~~vLL~kR~~~~g~W~~PgG~ve~gEt~~~Aa~REl~EEtGl~~~~~~~~~~~~~~~~   83 (165)
T d1jkna_           4 GSMDSPPEGYRRNVGICLMNNDKKIFAASRLDIPDAWQMPQGGIDEGEDPRNAAIRELREETGVTSAEVIAEVPYWLTYD   83 (165)
T ss_dssp             CCCSSCCSSEEEEEEEEEECTTSCEEEEEESSSTTCEECCEECCCTTCCHHHHHHHHHHHHTCCCSEEEEEECSSCEEEE
T ss_pred             CccCCCCCCccccEEEEEEeCCCEEEEEEEcCCCCcccCccceEcCCCChhHHHHHHHHHhhcccccccccccccccccc
Confidence            58999999999999999999999999999998889999999                               24567778


Q ss_pred             CChhhHHhhhhccCCCcccccceEEEEEEcCCCCeeeecCCCCCCCCcCceEeeChhhHhhcCCCCCHHHHHHHHHHhhh
Q 029744          106 FPPEVREKLKHQWGGDWKGQAQKWFLLKFTGKEEEINLLGDKSEKPEFGEWKWMSPEQILERAVDFKKPVYKEVFTVFTP  185 (188)
Q Consensus       106 lP~~~~~~~~~~~~~~y~GQkQkWFL~rf~G~ds~InL~~~~~~~PEFd~WrWv~~~ell~~VV~FKR~VY~~vl~eF~p  185 (188)
                      .|..+.......+.+.+.+|.++||++++.|.+.+|+|..+.++++||++|+|++++++++.+++|||+||++++++|+|
T Consensus        84 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~E~~~~~W~~~~el~~~i~~fk~~v~~~~l~~f~p  163 (165)
T d1jkna_          84 FPPKVREKLNIQWGSDWKGQAQKWFLFKFTGQDQEINLLGDGSEKPEFGEWSWVTPEQLIDLTVEFKKPVYKEVLSVFAP  163 (165)
T ss_dssp             CCHHHHHHHHHHTCCCCSEEEECCEEEEECSCTTTCCSSCSSSSCCCEEEEEEECTTHHHHHSCGGGHHHHHHHHHHTGG
T ss_pred             ccceeeceeeeeecCCccceeeEEEEEEEeCCCceeecCCCCCCCCeeEEeEECCHHHHHHhcchhhHHHHHHHHHHHHh
Confidence            88888766666788999999999999999999999999866678999999999999999999999999999999999999


Q ss_pred             cc
Q 029744          186 HL  187 (188)
Q Consensus       186 ~i  187 (188)
                      +|
T Consensus       164 ~~  165 (165)
T d1jkna_         164 HL  165 (165)
T ss_dssp             GC
T ss_pred             hC
Confidence            86
>d1xsba_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ryaa_ d.113.1.5 (A:) GDP-mannose mannosyl hydrolase NudD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ktga_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2a6ta2 d.113.1.7 (A:95-245) mRNA decapping enzyme Dcp2p catalytic domain {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d2fvva1 d.113.1.1 (A:8-142) Diphosphoinositol polyphosphate phosphohydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b0va1 d.113.1.1 (A:4-149) Hypothetical protein NE0184 {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d1sjya_ d.113.1.1 (A:) Hypothetical protein DR1025 {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1vcda1 d.113.1.1 (A:1-126) AP6A hydrolase Ndx1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2fkba1 d.113.1.2 (A:8-168) Hypothetical protein YfcD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rrqa2 d.113.1.3 (A:234-360) Adenine glycosylase MutY, C-terminal domain {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1hzta_ d.113.1.2 (A:) Isopentenyl diphosphate isomerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2o5fa1 d.113.1.2 (A:7-168) Hypothetical protein DR0079 {Deinococcus radiodurans str. R1 (Deinococcus radiodurans R1) [TaxId: 243230]} Back     information, alignment and structure
>d1vk6a2 d.113.1.4 (A:126-256) NADH pyrophosphatase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2azwa1 d.113.1.1 (A:2-148) Hypothetical protein EF1141 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1puna_ d.113.1.1 (A:) Nucleoside triphosphate pyrophosphorylase (MutT) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1k2ea_ d.113.1.1 (A:) Hypothetical protein PAE3301 {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1x51a1 d.113.1.3 (A:8-149) A/G-specific adenine DNA glycosylase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fb1a2 d.113.1.6 (A:3-149) Hypothetical protein BT0354, N-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1mqea_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1irya_ d.113.1.1 (A:) 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b06a1 d.113.1.1 (A:1-155) Hypothetical protein SP1235 (spr1115) {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1v8ya_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1q33a_ d.113.1.1 (A:) NUDT9 (mitochondrial ADP-ribose pyrophosphatase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fmla2 d.113.1.6 (A:3-204) Hypothetical protein EF2700, N-terminal domain {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1nqza_ d.113.1.1 (A:) Coenzyme A pyrophosphatase {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1u20a1 d.113.1.1 (A:14-209) U8 snorna-binding protein x29 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure