Citrus Sinensis ID: 029774

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------19
MALLLPGKVDLGSARRCFTMRTSVLRMQFCEFKFFVTSCLIEPRQKKFVEGKVRMLNNSRRSNSVRTVSQGTIPVLASSNGSATSTRKDYSSVREPSTVFEEENANGDSTGKNDTPIVGIIMESDSDLPVMNDAARTLSDFGVPYEIKILSPHQNRKGALSYALSAKERGIKIIIVGDGVEAHLSGTL
ccccccccccccccccEEEEEccEEEEEcccEEccccccccccccccccccccHHHcccccccccccccccccccccccHHHHHHHHHHcccccccccccccccccccccccccccEEEEEEcccccHHHHHHHHHHHHHHccccccEEEcccccHHHHHHHHHHHHHcccEEEEEcccccccccccc
ccEEcccccccccHHHHHcHHHHHHHHHHHEEEEEEEcccccccHHcccccEEEEEcccccccccccccEEEEEEEcccHHHHHHHHHHHHccccccccHHcccccccccccccccEEEEEEccHHHHHHHHHHHHHHHHcccEEEEEEccccccHHHHHHHHHHcccccccEEEEEEEccccHHHcc
malllpgkvdlgsarrcfTMRTSVLRMQFCEFKFFVtsclieprqkKFVEGKVRMlnnsrrsnsvrtvsqgtipvlassngsatstrkdyssvrepstvfeeenangdstgkndtpiVGIImesdsdlpvmndaartlsdfgvpyeikilsphqnrkGALSYALSAKERGIKIIIVGDGVEAHLSGTL
malllpgkvdlgsarrCFTMRTSVLRMQFCEFKFFVTSCLIEPRQKkfvegkvrmlnnsrrsnsvrtvsqgtipvlassngsatstrkdyssvrepstvfeeenangdstgkndtpiVGIIMESDSDLPVMNDAARTLSDFGVPYEIKilsphqnrKGALSYALSAKERGIKIIIVGDGVEAHLSGTL
MALLLPGKVDLGSARRCFTMRTSVLRMQFCEFKFFVTSCLIEPRQKKFVEGKvrmlnnsrrsnsvrtvsQGTIPVLASSNGSATSTRKDYSSVREPSTVFEEENANGDSTGKNDTPIVGIIMESDSDLPVMNDAARTLSDFGVPYEIKILSPHQNRKGALSYALSAKERGIKIIIVGDGVEAHLSGTL
******GKVDLGSARRCFTMRTSVLRMQFCEFKFFVTSCLIEPRQKKFVEG*****************************************************************IVGIIM*****LPVMNDAARTLSDFGVPYEIKILSPHQNRKGALSYALSAKERGIKIIIVGDGVE*******
*A*LLPGKVDLGSARRCFTMRTSVLRMQFCEFKFFVTSCLIEPRQKKFVEGKVRM**************QGTIPVLASSNGSAT*********************************VGIIMESDSDLPVMNDAARTLSDFGVPYEIKILSPHQNRKGALSYALSAKERGIKIIIVGDGVEAHLSGTL
MALLLPGKVDLGSARRCFTMRTSVLRMQFCEFKFFVTSCLIEPRQKKFVEGKVRMLNNSR********SQGTIPVLA********************************TGKNDTPIVGIIMESDSDLPVMNDAARTLSDFGVPYEIKILSPHQNRKGALSYALSAKERGIKIIIVGDGVEAHLSGTL
*ALLLPGKVDLGSARRCFTMRTSVLRMQFCEFKFFVTSCLIEPRQKKFVEGKVRMLNNSRRSNSVRTVSQGTIPVLASSNGSATSTRKDYSSVR*******************DTPIVGIIMESDSDLPVMNDAARTLSDFGVPYEIKILSPHQNRKGALSYALSAKERGIKIIIVGDGVEAHL****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MALLLPGKVDLGSARRCFTMRTSVLRMQFCEFKFFVTSCLIEPRQKKFVEGKVRMLNNSRRSNSVRTVSQGTIPVLASSNGSATSTRKDYSSVREPSTVFEEENANGDSTGKNDTPIVGIIMESDSDLPVMNDAARTLSDFGVPYEIKILSPHQNRKGALSYALSAKERGIKIIIVGDGVEAHLSGTL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query188 2.2.26 [Sep-21-2011]
O58058177 N5-carboxyaminoimidazole yes no 0.409 0.435 0.584 2e-19
P21264571 Phosphoribosylaminoimidaz yes no 0.388 0.127 0.561 5e-16
Q9UY68174 N5-carboxyaminoimidazole yes no 0.409 0.442 0.545 8e-16
Q9WYS7171 N5-carboxyaminoimidazole yes no 0.388 0.426 0.547 6e-15
Q92210568 Phosphoribosylaminoimidaz N/A no 0.398 0.132 0.52 8e-15
Q01930543 Phosphoribosylaminoimidaz N/A no 0.489 0.169 0.423 4e-14
P15567552 Phosphoribosylaminoimidaz yes no 0.398 0.135 0.493 6e-14
P50504557 Phosphoribosylaminoimidaz N/A no 0.398 0.134 0.493 9e-14
P55195557 Phosphoribosylaminoimidaz N/A no 0.515 0.174 0.428 9e-14
Q87KE1161 N5-carboxyaminoimidazole yes no 0.367 0.428 0.565 4e-13
>sp|O58058|PURE_PYRHO N5-carboxyaminoimidazole ribonucleotide mutase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=purE PE=3 SV=1 Back     alignment and function desciption
 Score = 95.5 bits (236), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 45/77 (58%), Positives = 57/77 (74%)

Query: 112 KNDTPIVGIIMESDSDLPVMNDAARTLSDFGVPYEIKILSPHQNRKGALSYALSAKERGI 171
           K++ P+VGIIM SDSDLPVM +AAR L +FGVPYEI I+S H+  + A  YA  A+ERGI
Sbjct: 6   KSEKPLVGIIMGSDSDLPVMKEAARILEEFGVPYEITIISAHRTPERAYEYAKKAEERGI 65

Query: 172 KIIIVGDGVEAHLSGTL 188
           ++II G G  AHL G +
Sbjct: 66  EVIIAGAGGAAHLPGII 82
Catalyzes the conversion of N5-carboxyaminoimidazole ribonucleotide (N5-CAIR) to 4-carboxy-5-aminoimidazole ribonucleotide (CAIR).
Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) (taxid: 70601)
EC: 5EC: .EC: 4EC: .EC: 9EC: 9EC: .EC: 1EC: 8
>sp|P21264|PUR6_YEAST Phosphoribosylaminoimidazole carboxylase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADE2 PE=1 SV=1 Back     alignment and function description
>sp|Q9UY68|PURE_PYRAB N5-carboxyaminoimidazole ribonucleotide mutase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=purE PE=3 SV=1 Back     alignment and function description
>sp|Q9WYS7|PURE_THEMA N5-carboxyaminoimidazole ribonucleotide mutase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=purE PE=1 SV=1 Back     alignment and function description
>sp|Q92210|PUR6_CANAL Phosphoribosylaminoimidazole carboxylase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ADE2 PE=3 SV=2 Back     alignment and function description
>sp|Q01930|PUR6_OGAME Phosphoribosylaminoimidazole carboxylase OS=Ogataea methanolica GN=ADE1 PE=3 SV=1 Back     alignment and function description
>sp|P15567|PUR6_SCHPO Phosphoribosylaminoimidazole carboxylase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ade6 PE=3 SV=1 Back     alignment and function description
>sp|P50504|PUR6_SCHOC Phosphoribosylaminoimidazole carboxylase OS=Schwanniomyces occidentalis GN=ADE2 PE=3 SV=1 Back     alignment and function description
>sp|P55195|PUR6_VIGAC Phosphoribosylaminoimidazole carboxylase, chloroplastic (Fragment) OS=Vigna aconitifolia GN=PURKE PE=2 SV=1 Back     alignment and function description
>sp|Q87KE1|PURE_VIBPA N5-carboxyaminoimidazole ribonucleotide mutase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=purE PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query188
14590237177 phosphoribosylaminoimidazole carboxylase 0.409 0.435 0.584 8e-18
13173434 623 phosphoribosylaminoimidazole carboxylase 0.468 0.141 0.527 4e-17
37983592 621 phosphoribosylaminoimidazole carboxylase 0.468 0.141 0.527 4e-17
410667200164 phosphoribosylaminoimidazole carboxylase 0.398 0.457 0.56 1e-16
449490248 586 PREDICTED: phosphoribosylaminoimidazole 0.377 0.121 0.619 2e-16
449442114 586 PREDICTED: phosphoribosylaminoimidazole 0.377 0.121 0.619 2e-16
268316597171 phosphoribosylaminoimidazole carboxylase 0.404 0.444 0.552 2e-16
154249773178 phosphoribosylaminoimidazole carboxylase 0.388 0.410 0.575 8e-16
345303692171 phosphoribosylaminoimidazole carboxylase 0.404 0.444 0.539 1e-15
383786998177 5-(carboxyamino)imidazole ribonucleotide 0.393 0.418 0.581 2e-15
>gi|14590237|ref|NP_142303.1| phosphoribosylaminoimidazole carboxylase catalytic subunit [Pyrococcus horikoshii OT3] gi|3914493|sp|O58058.1|PURE_PYRHO RecName: Full=N5-carboxyaminoimidazole ribonucleotide mutase; Short=N5-CAIR mutase; AltName: Full=5-(carboxyamino)imidazole ribonucleotide mutase gi|3256711|dbj|BAA29394.1| 177aa long hypothetical phosphoribosylaminoimidazole carboxylase catalytic subunit [Pyrococcus horikoshii OT3] Back     alignment and taxonomy information
 Score = 95.5 bits (236), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 45/77 (58%), Positives = 57/77 (74%)

Query: 112 KNDTPIVGIIMESDSDLPVMNDAARTLSDFGVPYEIKILSPHQNRKGALSYALSAKERGI 171
           K++ P+VGIIM SDSDLPVM +AAR L +FGVPYEI I+S H+  + A  YA  A+ERGI
Sbjct: 6   KSEKPLVGIIMGSDSDLPVMKEAARILEEFGVPYEITIISAHRTPERAYEYAKKAEERGI 65

Query: 172 KIIIVGDGVEAHLSGTL 188
           ++II G G  AHL G +
Sbjct: 66  EVIIAGAGGAAHLPGII 82

Source: Pyrococcus horikoshii OT3

Species: Pyrococcus horikoshii

Genus: Pyrococcus

Family: Thermococcaceae

Order: Thermococcales

Class: Thermococci

Phylum: Euryarchaeota

Superkingdom: Archaea
>gi|13173434|gb|AAK14408.1| phosphoribosylaminoimidazole carboxylase [Nicotiana tabacum] Back     alignment and taxonomy information
>gi|37983592|gb|AAR06291.1| phosphoribosylaminoimidazole carboxylase, partial [Nicotiana tabacum] Back     alignment and taxonomy information
>gi|410667200|ref|YP_006919571.1| phosphoribosylaminoimidazole carboxylase catalytic subunit PurE [Thermacetogenium phaeum DSM 12270] gi|409104947|gb|AFV11072.1| phosphoribosylaminoimidazole carboxylase catalytic subunit PurE [Thermacetogenium phaeum DSM 12270] Back     alignment and taxonomy information
>gi|449490248|ref|XP_004158550.1| PREDICTED: phosphoribosylaminoimidazole carboxylase, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449442114|ref|XP_004138827.1| PREDICTED: phosphoribosylaminoimidazole carboxylase, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|268316597|ref|YP_003290316.1| phosphoribosylaminoimidazole carboxylase catalytic subunit [Rhodothermus marinus DSM 4252] gi|262334131|gb|ACY47928.1| phosphoribosylaminoimidazole carboxylase, catalytic subunit [Rhodothermus marinus DSM 4252] Back     alignment and taxonomy information
>gi|154249773|ref|YP_001410598.1| phosphoribosylaminoimidazole carboxylase, catalytic subunit [Fervidobacterium nodosum Rt17-B1] gi|154153709|gb|ABS60941.1| phosphoribosylaminoimidazole carboxylase, catalytic subunit [Fervidobacterium nodosum Rt17-B1] Back     alignment and taxonomy information
>gi|345303692|ref|YP_004825594.1| phosphoribosylaminoimidazole carboxylase, catalytic subunit [Rhodothermus marinus SG0.5JP17-172] gi|345112925|gb|AEN73757.1| phosphoribosylaminoimidazole carboxylase, catalytic subunit [Rhodothermus marinus SG0.5JP17-172] Back     alignment and taxonomy information
>gi|383786998|ref|YP_005471567.1| 5-(carboxyamino)imidazole ribonucleotide mutase [Fervidobacterium pennivorans DSM 9078] gi|383109845|gb|AFG35448.1| 5-(carboxyamino)imidazole ribonucleotide mutase [Fervidobacterium pennivorans DSM 9078] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query188
SGD|S000005654571 ADE2 "Phosphoribosylaminoimida 0.595 0.196 0.432 2e-15
UNIPROTKB|P96880174 purE "N5-carboxyaminoimidazole 0.409 0.442 0.480 6.9e-15
TIGR_CMR|GSU_0611169 GSU_0611 "phosphoribosylaminoi 0.398 0.443 0.506 3.8e-14
CGD|CAL0003241568 ADE2 [Candida albicans (taxid: 0.409 0.135 0.525 3.9e-14
UNIPROTKB|Q92210568 ADE2 "Phosphoribosylaminoimida 0.409 0.135 0.525 3.9e-14
TAIR|locus:2040771642 AT2G37690 [Arabidopsis thalian 0.393 0.115 0.527 4.9e-14
POMBASE|SPCC1322.13552 ade6 "phosphoribosylaminoimida 0.388 0.132 0.506 2.7e-13
UNIPROTKB|Q9KVT7161 purE "N5-carboxyaminoimidazole 0.367 0.428 0.536 5.6e-13
TIGR_CMR|VC_0052161 VC_0052 "phosphoribosylaminoim 0.367 0.428 0.536 5.6e-13
DICTYBASE|DDB_G0283987 997 purC/E "PAICS" [Dictyostelium 0.611 0.115 0.373 6.7e-13
SGD|S000005654 ADE2 "Phosphoribosylaminoimidazole carboxylase" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
 Score = 203 (76.5 bits), Expect = 2.0e-15, P = 2.0e-15
 Identities = 51/118 (43%), Positives = 69/118 (58%)

Query:    71 GTIPVLASSNGSATSTRKDYSSVRE--PSTVFEEENANGDSTGKNDTPIVGIIMESDSDL 128
             G I ++ASS       R +Y + R   P  +   +  + ++  K   P+VGIIM SDSDL
Sbjct:   360 GHINIIASSMAECEQ-RLNYITGRTDIPIKISVAQKLDLEAMVK---PLVGIIMGSDSDL 415

Query:   129 PVMNDAARTLSDFGVPYEIKILSPHQNRKGALSYALSAKERGIKIIIVGDGVEAHLSG 186
             PVM+ A   L DFGVP+E+ I+S H+      +YA+SA +RGIK II G G  AHL G
Sbjct:   416 PVMSAACAVLKDFGVPFEVTIVSAHRTPHRMSAYAISASKRGIKTIIAGAGGAAHLPG 473
GO:0006189 "'de novo' IMP biosynthetic process" evidence=IEA;TAS
GO:0006164 "purine nucleotide biosynthetic process" evidence=IEA;TAS
GO:0005524 "ATP binding" evidence=IEA
GO:0034023 "5-(carboxyamino)imidazole ribonucleotide mutase activity" evidence=IEA
GO:0003824 "catalytic activity" evidence=IEA
GO:0004638 "phosphoribosylaminoimidazole carboxylase activity" evidence=IEA;IMP
GO:0046872 "metal ion binding" evidence=IEA
GO:0006144 "purine nucleobase metabolic process" evidence=IMP;TAS
GO:0005737 "cytoplasm" evidence=IDA
GO:0016829 "lyase activity" evidence=IEA
GO:0016831 "carboxy-lyase activity" evidence=IEA
GO:0000166 "nucleotide binding" evidence=IEA
UNIPROTKB|P96880 purE "N5-carboxyaminoimidazole ribonucleotide mutase" [Mycobacterium tuberculosis (taxid:1773)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_0611 GSU_0611 "phosphoribosylaminoimidazole carboxylase, catalytic subunit" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
CGD|CAL0003241 ADE2 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
UNIPROTKB|Q92210 ADE2 "Phosphoribosylaminoimidazole carboxylase" [Candida albicans SC5314 (taxid:237561)] Back     alignment and assigned GO terms
TAIR|locus:2040771 AT2G37690 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
POMBASE|SPCC1322.13 ade6 "phosphoribosylaminoimidazole carboxylase Ade6" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
UNIPROTKB|Q9KVT7 purE "N5-carboxyaminoimidazole ribonucleotide mutase" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] Back     alignment and assigned GO terms
TIGR_CMR|VC_0052 VC_0052 "phosphoribosylaminoimidazole carboxylase, catalytic subunit" [Vibrio cholerae O1 biovar El Tor (taxid:686)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0283987 purC/E "PAICS" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer5.4.99LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
purE
phosphoribosylaminoimidazole carboxylase catalytic subunit; This subunit can alone transform AIR to CAIR, but in association with purK, which possesses an ATPase activity, an enzyme complex is produced which is capable of converting AIR to CAIR efficiently under physiological condition (By similarity) (177 aa)
(Pyrococcus horikoshii)
Predicted Functional Partners:
purC
phosphoribosylaminoimidazole-succinocarboxamide synthase (238 aa)
•• • •• 0.999
purD
phosphoribosylamine--glycine ligase (438 aa)
••••••• 0.999
purT
phosphoribosylglycinamide formyltransferase 2; Catalyzes two reactions- the first one is the pr [...] (433 aa)
•• • •• 0.999
purF
amidophosphoribosyltransferase (449 aa)
• ••••• 0.998
purM
phosphoribosylaminoimidazole synthetase (334 aa)
• ••••• 0.997
purB
adenylosuccinate lyase (450 aa)
•  •••• 0.996
purQ
phosphoribosylformylglycinamidine synthase I (227 aa)
•  • •• 0.982
glnA
glutamine synthetase (443 aa)
•     • 0.976
purL
phosphoribosylformylglycinamidine synthase II (705 aa)
•    •• 0.964
purA
adenylosuccinate synthetase; Plays an important role in the de novo pathway of purine nucleotid [...] (339 aa)
•  •  • 0.961

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query188
PLN02948577 PLN02948, PLN02948, phosphoribosylaminoimidazole c 5e-27
pfam00731150 pfam00731, AIRC, AIR carboxylase 5e-25
smart01001152 smart01001, AIRC, AIR carboxylase 8e-25
COG0041162 COG0041, PurE, Phosphoribosylcarboxyaminoimidazole 2e-24
TIGR01162156 TIGR01162, purE, phosphoribosylaminoimidazole carb 4e-22
>gnl|CDD|178534 PLN02948, PLN02948, phosphoribosylaminoimidazole carboxylase Back     alignment and domain information 
 Score =  106 bits (266), Expect = 5e-27
 Identities = 42/79 (53%), Positives = 50/79 (63%)

Query: 108 DSTGKNDTPIVGIIMESDSDLPVMNDAARTLSDFGVPYEIKILSPHQNRKGALSYALSAK 167
                  TP+VGIIM SDSDLP M DAA  L  FGVPYE+ I+S H+  +   SYA SA 
Sbjct: 403 PDALPKGTPLVGIIMGSDSDLPTMKDAAEILDSFGVPYEVTIVSAHRTPERMFSYARSAH 462

Query: 168 ERGIKIIIVGDGVEAHLSG 186
            RG+++II G G  AHL G
Sbjct: 463 SRGLQVIIAGAGGAAHLPG 481

Length = 577
>gnl|CDD|144362 pfam00731, AIRC, AIR carboxylase Back     alignment and domain information
>gnl|CDD|214965 smart01001, AIRC, AIR carboxylase Back     alignment and domain information
>gnl|CDD|223119 COG0041, PurE, Phosphoribosylcarboxyaminoimidazole (NCAIR) mutase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|130230 TIGR01162, purE, phosphoribosylaminoimidazole carboxylase, PurE protein Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 188
COG0041162 PurE Phosphoribosylcarboxyaminoimidazole (NCAIR) m 99.97
TIGR01162156 purE phosphoribosylaminoimidazole carboxylase, Pur 99.94
PF00731150 AIRC: AIR carboxylase; InterPro: IPR000031 Phospho 99.93
PLN02948577 phosphoribosylaminoimidazole carboxylase 99.93
COG1691254 NCAIR mutase (PurE)-related proteins [General func 99.28
KOG2835373 consensus Phosphoribosylamidoimidazole-succinocarb 99.02
cd08170 351 GlyDH Glycerol dehydrogenases (GlyDH) catalyzes ox 95.79
cd08550 349 GlyDH-like Glycerol_dehydrogenase-like. Families o 95.71
cd08185 380 Fe-ADH1 Iron-containing alcohol dehydrogenases-lik 95.25
cd08183 374 Fe-ADH2 Iron-containing alcohol dehydrogenases-lik 95.05
cd08551 370 Fe-ADH iron-containing alcohol dehydrogenases (Fe- 94.65
PRK09423 366 gldA glycerol dehydrogenase; Provisional 94.42
cd08171 345 GlyDH-like2 Glycerol dehydrogenase-like. Glycerol 94.37
cd08195 345 DHQS Dehydroquinate synthase (DHQS) catalyzes the 94.12
cd08175 348 G1PDH Glycerol-1-phosphate dehydrogenase (G1PDH) c 93.99
cd08182 367 HEPD Hydroxyethylphosphoate dehydrogenase (HEPD) c 93.96
TIGR01357 344 aroB 3-dehydroquinate synthase. This model represe 93.86
cd08194 375 Fe-ADH6 Iron-containing alcohol dehydrogenases-lik 93.85
cd08186 383 Fe-ADH8 Iron-containing alcohol dehydrogenase. Typ 93.85
PRK00843 350 egsA NAD(P)-dependent glycerol-1-phosphate dehydro 93.76
cd08176 377 LPO Lactadehyde:propanediol oxidoreductase (LPO) c 93.69
cd08187 382 BDH Butanol dehydrogenase catalyzes the conversion 93.6
PF00465 366 Fe-ADH: Iron-containing alcohol dehydrogenase ; In 93.56
cd08178 398 AAD_C C-terminal alcohol dehydrogenase domain of t 93.44
cd08181 357 PPD-like 1,3-propanediol dehydrogenase-like (PPD). 93.16
TIGR02638 379 lactal_redase lactaldehyde reductase. This clade o 93.07
cd08192 370 Fe-ADH7 Iron-containing alcohol dehydrogenases-lik 93.03
PRK00002 358 aroB 3-dehydroquinate synthase; Reviewed 92.99
cd08193 376 HVD 5-hydroxyvalerate dehydrogenase (HVD) catalyze 92.68
cd08188 377 Fe-ADH4 Iron-containing alcohol dehydrogenases-lik 92.67
cd08173 339 Gro1PDH Sn-glycerol-1-phosphate dehydrogenase (Gro 92.66
cd08179 375 NADPH_BDH NADPH-dependent butanol dehydrogenase in 92.65
PRK10624 382 L-1,2-propanediol oxidoreductase; Provisional 92.61
cd08197 355 DOIS 2-deoxy-scyllo-inosose synthase (DOIS) cataly 92.6
cd08189 374 Fe-ADH5 Iron-containing alcohol dehydrogenases-lik 92.47
PRK15454 395 ethanol dehydrogenase EutG; Provisional 92.23
cd07766 332 DHQ_Fe-ADH Dehydroquinate synthase-like (DHQ-like) 92.04
cd08190 414 HOT Hydroxyacid-oxoacid transhydrogenase (HOT) inv 91.84
PRK09860 383 putative alcohol dehydrogenase; Provisional 91.42
PF04392 294 ABC_sub_bind: ABC transporter substrate binding pr 91.14
cd08199 354 EEVS 2-epi-5-epi-valiolone synthase (EEVS). 2-epi- 90.87
cd08549 332 G1PDH_related Glycerol-1-phosphate_dehydrogenase a 90.5
PRK15138 387 aldehyde reductase; Provisional 90.39
PRK01372 304 ddl D-alanine--D-alanine ligase; Reviewed 89.82
cd08191 386 HHD 6-hydroxyhexanoate dehydrogenase (HHD) catalyz 89.36
cd03786 363 GT1_UDP-GlcNAc_2-Epimerase Bacterial members of th 89.25
PRK13055 334 putative lipid kinase; Reviewed 88.88
PF10096 243 DUF2334: Uncharacterized protein conserved in bact 88.82
PRK11914 306 diacylglycerol kinase; Reviewed 88.62
cd0302890 GRX_PICOT_like Glutaredoxin (GRX) family, PKC-inte 88.54
PLN02834 433 3-dehydroquinate synthase 88.12
PRK00861 300 putative lipid kinase; Reviewed 87.99
cd08180 332 PDD 1,3-propanediol dehydrogenase (PPD) catalyzes 87.9
TIGR03702 293 lip_kinase_YegS lipid kinase YegS. Members of this 87.71
cd08177 337 MAR Maleylacetate reductase is involved in many ar 87.56
PRK13337 304 putative lipid kinase; Reviewed 87.33
PRK13054 300 lipid kinase; Reviewed 87.06
TIGR0036597 monothiol glutaredoxin, Grx4 family. The gene for 86.1
PF13407 257 Peripla_BP_4: Periplasmic binding protein domain; 84.92
cd01391 269 Periplasmic_Binding_Protein_Type_1 Type 1 periplas 84.55
PRK10653 295 D-ribose transporter subunit RbsB; Provisional 84.37
TIGR00147 293 lipid kinase, YegS/Rv2252/BmrU family. The E. coli 84.08
COG1454 377 EutG Alcohol dehydrogenase, class IV [Energy produ 83.97
cd0086091 ThrRS_anticodon ThrRS Threonyl-anticodon binding d 83.65
cd08172 347 GlyDH-like1 Glycerol dehydrogenases-like. Glycerol 83.59
COG2984 322 ABC-type uncharacterized transport system, peripla 83.53
cd01988132 Na_H_Antiporter_C The C-terminal domain of a subfa 83.08
cd06318 282 PBP1_ABC_sugar_binding_like_9 Periplasmic sugar-bi 83.08
cd01542 259 PBP1_TreR_like Ligand-binding domain of DNA transc 83.08
PRK13805 862 bifunctional acetaldehyde-CoA/alcohol dehydrogenas 82.37
PRK10586 362 putative oxidoreductase; Provisional 82.12
cd06305 273 PBP1_methylthioribose_binding_like Methylthioribos 82.12
cd06273 268 PBP1_GntR_like_1 This group includes the ligand-bi 82.07
cd08169 344 DHQ-like Dehydroquinate synthase-like which includ 82.03
cd01539 303 PBP1_GGBP Periplasmic glucose/galactose-binding pr 81.91
cd01452187 VWA_26S_proteasome_subunit 26S proteasome plays a 81.86
PF00763117 THF_DHG_CYH: Tetrahydrofolate dehydrogenase/cycloh 81.66
cd06321 271 PBP1_ABC_sugar_binding_like_11 Periplasmic sugar-b 81.41
PRK08862 227 short chain dehydrogenase; Provisional 81.39
cd08184 347 Fe-ADH3 Iron-containing alcohol dehydrogenases-lik 81.34
PRK10076213 pyruvate formate lyase II activase; Provisional 81.33
COG1597 301 LCB5 Sphingosine kinase and enzymes related to euk 81.33
cd01537 264 PBP1_Repressors_Sugar_Binding_like Ligand-binding 80.89
>COG0041 PurE Phosphoribosylcarboxyaminoimidazole (NCAIR) mutase [Nucleotide transport and metabolism] Back     alignment and domain information 
Probab=99.97  E-value=2.5e-31  Score=218.48  Aligned_cols=73  Identities=49%  Similarity=0.840  Sum_probs=71.6

Q ss_pred             CeEEEEeccCCCHHHHHHHHHHHHHhCCCeeEEEEcCCCChhHHHHHHHHHhhCCCeEEEEecCccCcCcCCC
Q 029774          116 PIVGIIMESDSDLPVMNDAARTLSDFGVPYEIKILSPHQNRKGALSYALSAKERGIKIIIVGDGVEAHLSGTL  188 (188)
Q Consensus       116 pkVaIIMGS~SDlpimekA~~vLeefGIpyDVrVaSAHRtP~~l~eyak~ae~~GvkVIIAvAGmAAHLPGVV  188 (188)
                      ++|+|||||+|||++|++|+++|++|||+||++|+||||||+++.+|+++++++|++||||+||+||||||||
T Consensus         3 ~~V~IIMGS~SD~~~mk~Aa~~L~~fgi~ye~~VvSAHRTPe~m~~ya~~a~~~g~~viIAgAGgAAHLPGmv   75 (162)
T COG0041           3 PKVGIIMGSKSDWDTMKKAAEILEEFGVPYEVRVVSAHRTPEKMFEYAEEAEERGVKVIIAGAGGAAHLPGMV   75 (162)
T ss_pred             ceEEEEecCcchHHHHHHHHHHHHHcCCCeEEEEEeccCCHHHHHHHHHHHHHCCCeEEEecCcchhhcchhh
Confidence            3899999999999999999999999999999999999999999999999999999999999999999999986

>TIGR01162 purE phosphoribosylaminoimidazole carboxylase, PurE protein Back     alignment and domain information
>PF00731 AIRC: AIR carboxylase; InterPro: IPR000031 Phosphoribosylaminoimidazole carboxylase is a fusion protein in plants and fungi, but consists of two non-interacting proteins in bacteria, PurK and PurE Back     alignment and domain information
>PLN02948 phosphoribosylaminoimidazole carboxylase Back     alignment and domain information
>COG1691 NCAIR mutase (PurE)-related proteins [General function prediction only] Back     alignment and domain information
>KOG2835 consensus Phosphoribosylamidoimidazole-succinocarboxamide synthase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd08170 GlyDH Glycerol dehydrogenases (GlyDH) catalyzes oxidation of glycerol to dihydroxyacetone in glycerol dissmilation Back     alignment and domain information
>cd08550 GlyDH-like Glycerol_dehydrogenase-like Back     alignment and domain information
>cd08185 Fe-ADH1 Iron-containing alcohol dehydrogenases-like Back     alignment and domain information
>cd08183 Fe-ADH2 Iron-containing alcohol dehydrogenases-like Back     alignment and domain information
>cd08551 Fe-ADH iron-containing alcohol dehydrogenases (Fe-ADH)-like Back     alignment and domain information
>PRK09423 gldA glycerol dehydrogenase; Provisional Back     alignment and domain information
>cd08171 GlyDH-like2 Glycerol dehydrogenase-like Back     alignment and domain information
>cd08195 DHQS Dehydroquinate synthase (DHQS) catalyzes the conversion of DAHP to DHQ in shikimate pathway for aromatic compounds synthesis Back     alignment and domain information
>cd08175 G1PDH Glycerol-1-phosphate dehydrogenase (G1PDH) catalyzes the reversible reduction of dihydroxyacetone phosphate (DHAP) to glycerol-1-phosphate (G1P) in an NADH-dependent manner Back     alignment and domain information
>cd08182 HEPD Hydroxyethylphosphoate dehydrogenase (HEPD) catalyzes the reduction of phosphonoacetaldehyde (PnAA) to hydroxyethylphosphoate (HEP) Back     alignment and domain information
>TIGR01357 aroB 3-dehydroquinate synthase Back     alignment and domain information
>cd08194 Fe-ADH6 Iron-containing alcohol dehydrogenases-like Back     alignment and domain information
>cd08186 Fe-ADH8 Iron-containing alcohol dehydrogenase Back     alignment and domain information
>PRK00843 egsA NAD(P)-dependent glycerol-1-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>cd08176 LPO Lactadehyde:propanediol oxidoreductase (LPO) catalyzes the interconversion between L-lactaldehyde and L-1,2-propanediol in Escherichia coli and other enterobacteria Back     alignment and domain information
>cd08187 BDH Butanol dehydrogenase catalyzes the conversion of butyraldehyde to butanol with the cofactor NAD(P)H being oxidized in the process Back     alignment and domain information
>PF00465 Fe-ADH: Iron-containing alcohol dehydrogenase ; InterPro: IPR001670 Alcohol dehydrogenase (1 Back     alignment and domain information
>cd08178 AAD_C C-terminal alcohol dehydrogenase domain of the acetaldehyde dehydrogenase-alcohol dehydrogenase bifunctional two-domain protein (AAD) Back     alignment and domain information
>cd08181 PPD-like 1,3-propanediol dehydrogenase-like (PPD) Back     alignment and domain information
>TIGR02638 lactal_redase lactaldehyde reductase Back     alignment and domain information
>cd08192 Fe-ADH7 Iron-containing alcohol dehydrogenases-like, involved in the linear alkylbenzenesulfonate (LAS) degradation pathway Back     alignment and domain information
>PRK00002 aroB 3-dehydroquinate synthase; Reviewed Back     alignment and domain information
>cd08193 HVD 5-hydroxyvalerate dehydrogenase (HVD) catalyzes the oxidation of 5-hydroxyvalerate to 5-oxovalerate with NAD+ as cofactor Back     alignment and domain information
>cd08188 Fe-ADH4 Iron-containing alcohol dehydrogenases-like Back     alignment and domain information
>cd08173 Gro1PDH Sn-glycerol-1-phosphate dehydrogenase (Gro1PDH) catalyzes the reversible conversion between dihydroxyacetone phosphate and glycerol-1-phosphate using either NADH or NADPH as a coenzyme Back     alignment and domain information
>cd08179 NADPH_BDH NADPH-dependent butanol dehydrogenase involved in the butanol and ethanol formation pathway in bacteria Back     alignment and domain information
>PRK10624 L-1,2-propanediol oxidoreductase; Provisional Back     alignment and domain information
>cd08197 DOIS 2-deoxy-scyllo-inosose synthase (DOIS) catalyzes carbocycle formation from D-glucose-6-phosphate to 2-deoxy-scyllo-inosose through a multistep reaction in the biosynthesis of aminoglycoside antibiotics Back     alignment and domain information
>cd08189 Fe-ADH5 Iron-containing alcohol dehydrogenases-like Back     alignment and domain information
>PRK15454 ethanol dehydrogenase EutG; Provisional Back     alignment and domain information
>cd07766 DHQ_Fe-ADH Dehydroquinate synthase-like (DHQ-like) and iron-containing alcohol dehydrogenases (Fe-ADH) Back     alignment and domain information
>cd08190 HOT Hydroxyacid-oxoacid transhydrogenase (HOT) involved in gamma-hydroxybutyrate metabolism Back     alignment and domain information
>PRK09860 putative alcohol dehydrogenase; Provisional Back     alignment and domain information
>PF04392 ABC_sub_bind: ABC transporter substrate binding protein; InterPro: IPR007487 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>cd08199 EEVS 2-epi-5-epi-valiolone synthase (EEVS) Back     alignment and domain information
>cd08549 G1PDH_related Glycerol-1-phosphate_dehydrogenase and related proteins Back     alignment and domain information
>PRK15138 aldehyde reductase; Provisional Back     alignment and domain information
>PRK01372 ddl D-alanine--D-alanine ligase; Reviewed Back     alignment and domain information
>cd08191 HHD 6-hydroxyhexanoate dehydrogenase (HHD) catalyzes the oxidation of 6-hydroxyhexanoate to 6-oxohexanoate Back     alignment and domain information
>cd03786 GT1_UDP-GlcNAc_2-Epimerase Bacterial members of the UDP-N-Acetylglucosamine (GlcNAc) 2-Epimerase family are known to catalyze the reversible interconversion of UDP-GlcNAc and UDP-N-acetylmannosamine (UDP-ManNAc) Back     alignment and domain information
>PRK13055 putative lipid kinase; Reviewed Back     alignment and domain information
>PF10096 DUF2334: Uncharacterized protein conserved in bacteria (DUF2334); InterPro: IPR018763 This group of proteins has no known function Back     alignment and domain information
>PRK11914 diacylglycerol kinase; Reviewed Back     alignment and domain information
>cd03028 GRX_PICOT_like Glutaredoxin (GRX) family, PKC-interacting cousin of TRX (PICOT)-like subfamily; composed of PICOT and GRX-PICOT-like proteins Back     alignment and domain information
>PLN02834 3-dehydroquinate synthase Back     alignment and domain information
>PRK00861 putative lipid kinase; Reviewed Back     alignment and domain information
>cd08180 PDD 1,3-propanediol dehydrogenase (PPD) catalyzes the reduction of 3-hydroxypropionaldehyde (3-HPA) to 1,3-propanediol in glycerol metabolism Back     alignment and domain information
>TIGR03702 lip_kinase_YegS lipid kinase YegS Back     alignment and domain information
>cd08177 MAR Maleylacetate reductase is involved in many aromatic compounds degradation pathways of aerobic microbes Back     alignment and domain information
>PRK13337 putative lipid kinase; Reviewed Back     alignment and domain information
>PRK13054 lipid kinase; Reviewed Back     alignment and domain information
>TIGR00365 monothiol glutaredoxin, Grx4 family Back     alignment and domain information
>PF13407 Peripla_BP_4: Periplasmic binding protein domain; PDB: 3BRS_B 3GBP_A 3GA5_A 1GCG_A 1GCA_A 3H75_A 3D02_A 3L49_B 3EJW_B 3T95_A Back     alignment and domain information
>cd01391 Periplasmic_Binding_Protein_Type_1 Type 1 periplasmic binding fold superfamily Back     alignment and domain information
>PRK10653 D-ribose transporter subunit RbsB; Provisional Back     alignment and domain information
>TIGR00147 lipid kinase, YegS/Rv2252/BmrU family Back     alignment and domain information
>COG1454 EutG Alcohol dehydrogenase, class IV [Energy production and conversion] Back     alignment and domain information
>cd00860 ThrRS_anticodon ThrRS Threonyl-anticodon binding domain Back     alignment and domain information
>cd08172 GlyDH-like1 Glycerol dehydrogenases-like Back     alignment and domain information
>COG2984 ABC-type uncharacterized transport system, periplasmic component [General function prediction only] Back     alignment and domain information
>cd01988 Na_H_Antiporter_C The C-terminal domain of a subfamily of Na+ /H+ antiporter existed in bacteria and archea Back     alignment and domain information
>cd06318 PBP1_ABC_sugar_binding_like_9 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems Back     alignment and domain information
>cd01542 PBP1_TreR_like Ligand-binding domain of DNA transcription repressor specific for trehalose (TreR) which is a member of the LacI-GalR family of bacterial transcription regulators Back     alignment and domain information
>PRK13805 bifunctional acetaldehyde-CoA/alcohol dehydrogenase; Provisional Back     alignment and domain information
>PRK10586 putative oxidoreductase; Provisional Back     alignment and domain information
>cd06305 PBP1_methylthioribose_binding_like Methylthioribose-binding protein-like of ABC-type transport systems that belong to a family of pentose/hexose sugar-binding proteins of the type I periplasmic binding protein (PBP1) superfamily Back     alignment and domain information
>cd06273 PBP1_GntR_like_1 This group includes the ligand-binding domain of putative DNA transcription repressors which are highly similar to that of the repressor specific for gluconate (GntR), a member of the LacI-GalR family of bacterial transcription regulators Back     alignment and domain information
>cd08169 DHQ-like Dehydroquinate synthase-like which includes dehydroquinate synthase, 2-deoxy-scyllo-inosose synthase, and 2-epi-5-epi-valiolone synthase Back     alignment and domain information
>cd01539 PBP1_GGBP Periplasmic glucose/galactose-binding protein (GGBP) involved in chemotaxis towards, and active transport of, glucose and galactose in various bacterial species Back     alignment and domain information
>cd01452 VWA_26S_proteasome_subunit 26S proteasome plays a major role in eukaryotic protein breakdown, especially for ubiquitin-tagged proteins Back     alignment and domain information
>PF00763 THF_DHG_CYH: Tetrahydrofolate dehydrogenase/cyclohydrolase, catalytic domain; InterPro: IPR020630 Enzymes that participate in the transfer of one-carbon units require the coenzyme tetrahydrofolate (THF) Back     alignment and domain information
>cd06321 PBP1_ABC_sugar_binding_like_11 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems Back     alignment and domain information
>PRK08862 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd08184 Fe-ADH3 Iron-containing alcohol dehydrogenases-like Back     alignment and domain information
>PRK10076 pyruvate formate lyase II activase; Provisional Back     alignment and domain information
>COG1597 LCB5 Sphingosine kinase and enzymes related to eukaryotic diacylglycerol kinase [Lipid metabolism / General function prediction only] Back     alignment and domain information
>cd01537 PBP1_Repressors_Sugar_Binding_like Ligand-binding domain of the LacI-GalR family of transcription regulators and the sugar-binding domain of ABC-type transport systems Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query188
1o4v_A183 Crystal Structure Of The Catalytic Subunit Of A Pho 8e-16
3lp6_A174 Crystal Structure Of Rv3275c-E60a From Mycobacteriu 3e-12
4b4k_A181 Crystal Structure Of Bacillus Anthracis Pure Length 8e-11
1xmp_A170 Crystal Structure Of Pure (Ba0288) From Bacillus An 9e-11
4grd_A173 Crystal Structure Of Phosphoribosylaminoimidazole C 2e-10
1u11_A182 Pure (N5-Carboxyaminoimidazole Ribonucleotide Mutas 3e-10
2fw1_A183 Structure Of Pure (n5-carboxyaminoimidazole Ribonuc 3e-10
3oow_A166 Octameric Structure Of The Phosphoribosylaminoimida 2e-09
3opq_A163 Phosphoribosylaminoimidazole Carboxylase With Fruct 2e-09
2fwa_A183 Structure Of Pure (n5-carboxyaminoimidazole Ribonuc 3e-09
2fw6_A183 Structure Of Pure (N5-Carboxyaminoimidazole Ribonuc 3e-09
2fwb_A183 Structure Of Pure (N5-Carboxyaminoimidazole Ribonuc 5e-09
2fw9_A183 Structure Of Pure (n5-carboxyaminoimidazole Ribonuc 5e-09
2fwi_A183 Structure Of Pure (n5-carboxyaminoimidazole Ribonuc 5e-09
2nsh_A169 E. Coli Pure H45q Mutant Complexed With Nitro-Air L 1e-07
2nsl_A169 E. Coli Pure H45n Mutant Complexed With Cair Length 2e-07
2fw8_A183 Structure Of Pure (N5-Carboxyaminoimidazole Ribonuc 5e-07
1qcz_A169 Crystal Structure Of E. Coli Pure, An Unusual Mutas 6e-07
2ate_A169 Structure Of The Complex Of Pure With Nitroair Leng 6e-07
3kuu_A174 Structure Of The Pure Phosphoribosylaminoimidazole 1e-06
1d7a_A161 Crystal Structure Of E. Coli Pure-Mononucleotide Co 2e-06
3ors_A163 Crystal Structure Of N5-Carboxyaminoimidazole Ribon 4e-05
3trh_A169 Structure Of A Phosphoribosylaminoimidazole Carboxy 2e-04
>pdb|1O4V|A Chain A, Crystal Structure Of The Catalytic Subunit Of A Phosphoribosylaminoimidazole Mutase (Tm0446) From Thermotoga Maritima At 1.77 A Resolution Length = 183 Back     alignment and structure 
Iteration: 1

 Score = 79.7 bits (195), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 40/74 (54%), Positives = 49/74 (66%)
Query: 115 TPIVGIIMESDSDLPVMNDAARTLSDFGVPYEIKILSPHQNRKGALSYALSAKERGIKII 174
            P VGIIM SDSDLPVM  AA  L +FG+ YEI I+S H+       YA +A+ERGI++I
Sbjct: 13  VPRVGIIMGSDSDLPVMKQAAEILEEFGIDYEITIVSAHRTPDRMFEYAKNAEERGIEVI 72
Query: 175 IVGDGVEAHLSGTL 188
           I G G  AHL G +
Sbjct: 73  IAGAGGAAHLPGMV 86
>pdb|3LP6|A Chain A, Crystal Structure Of Rv3275c-E60a From Mycobacterium Tubercu 1.7a Resolution Length = 174 Back     alignment and structure
>pdb|4B4K|A Chain A, Crystal Structure Of Bacillus Anthracis Pure Length = 181 Back     alignment and structure
>pdb|1XMP|A Chain A, Crystal Structure Of Pure (Ba0288) From Bacillus Anthracis At 1.8 Resolution Length = 170 Back     alignment and structure
>pdb|4GRD|A Chain A, Crystal Structure Of Phosphoribosylaminoimidazole Carboxylase Catalytic Subunit From Burkholderia Cenocepacia J2315 Length = 173 Back     alignment and structure
>pdb|1U11|A Chain A, Pure (N5-Carboxyaminoimidazole Ribonucleotide Mutase) From The Acidophile Acetobacter Aceti Length = 182 Back     alignment and structure
>pdb|2FW1|A Chain A, Structure Of Pure (n5-carboxyaminoimidazole Ribonucleotide Mutase) From The Acidophilic Bacterium Acetobacter Aceti, At Ph 8.5 Length = 183 Back     alignment and structure
>pdb|3OOW|A Chain A, Octameric Structure Of The Phosphoribosylaminoimidazole Carboxylase Catalytic Subunit From Francisella Tularensis Subsp. Tularensis Schu S4. Length = 166 Back     alignment and structure
>pdb|3OPQ|A Chain A, Phosphoribosylaminoimidazole Carboxylase With Fructose-6-Phosphate Bound To The Central Channel Of The Octameric Protein Structure. Length = 163 Back     alignment and structure
>pdb|2FWA|A Chain A, Structure Of Pure (n5-carboxyaminoimidazole Ribonucleotide Mutase) H89n From The Acidophilic Bacterium Acetobacter Aceti, At Ph 7 Length = 183 Back     alignment and structure
>pdb|2FW6|A Chain A, Structure Of Pure (N5-Carboxyaminoimidazole Ribonucleotide Mutase) Mutant H59n From The Acidophilic Bacterium Acetobacter Aceti, At Ph 5.4 Length = 183 Back     alignment and structure
>pdb|2FWB|A Chain A, Structure Of Pure (N5-Carboxyaminoimidazole Ribonucleotide Mutase) H89f From The Acidophilic Bacterium Acetobacter Aceti, At Ph 8 Length = 183 Back     alignment and structure
>pdb|2FW9|A Chain A, Structure Of Pure (n5-carboxyaminoimidazole Ribonucleotide Mutase) H59f From The Acidophilic Bacterium Acetobacter Aceti, At Ph 8 Length = 183 Back     alignment and structure
>pdb|2FWI|A Chain A, Structure Of Pure (n5-carboxyaminoimidazole Ribonucleotide Mutase) H59d, From The Acidophilic Bacterium Acetobacter Aceti, Complexed With 5-aminoimidazole Ribonucleotide (air) Length = 183 Back     alignment and structure
>pdb|2NSH|A Chain A, E. Coli Pure H45q Mutant Complexed With Nitro-Air Length = 169 Back     alignment and structure
>pdb|2NSL|A Chain A, E. Coli Pure H45n Mutant Complexed With Cair Length = 169 Back     alignment and structure
>pdb|2FW8|A Chain A, Structure Of Pure (N5-Carboxyaminoimidazole Ribonucleotide Mutase) H89g From The Acidophilic Bacterium Acetobacter Aceti, At Ph 8 Length = 183 Back     alignment and structure
>pdb|1QCZ|A Chain A, Crystal Structure Of E. Coli Pure, An Unusual Mutase That Catalyzes The Conversion Of N5-carboxyaminoimidazole Ribonucleotide (n5-cair) To 4-carboxyaminoimidazole Ribonucleotide (cair) In The Purine Biosynthetic Pathway Length = 169 Back     alignment and structure
>pdb|2ATE|A Chain A, Structure Of The Complex Of Pure With Nitroair Length = 169 Back     alignment and structure
>pdb|3KUU|A Chain A, Structure Of The Pure Phosphoribosylaminoimidazole Carboxylase Catalytic Subunit From Yersinia Pestis Length = 174 Back     alignment and structure
>pdb|1D7A|A Chain A, Crystal Structure Of E. Coli Pure-Mononucleotide Complex. Length = 161 Back     alignment and structure
>pdb|3ORS|A Chain A, Crystal Structure Of N5-Carboxyaminoimidazole Ribonucleotide Mutase From Staphylococcus Aureus Length = 163 Back     alignment and structure
>pdb|3TRH|A Chain A, Structure Of A Phosphoribosylaminoimidazole Carboxylase Catalytic Subunit (Pure) From Coxiella Burnetii Length = 169 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query188
1o4v_A183 Phosphoribosylaminoimidazole mutase PURE; structur 6e-29
3lp6_A174 Phosphoribosylaminoimidazole carboxylase catalyti; 9e-29
3trh_A169 Phosphoribosylaminoimidazole carboxylase carboxylt 6e-28
3rg8_A159 Phosphoribosylaminoimidazole carboxylase, PURE PR; 1e-26
3ors_A163 N5-carboxyaminoimidazole ribonucleotide mutase; is 2e-26
1xmp_A170 PURE, phosphoribosylaminoimidazole carboxylase; pu 3e-26
4b4k_A181 N5-carboxyaminoimidazole ribonucleotide mutase; is 3e-26
3kuu_A174 Phosphoribosylaminoimidazole carboxylase catalyti 1e-25
3oow_A166 Phosphoribosylaminoimidazole carboxylase,catalyic; 1e-25
1u11_A182 PURE (N5-carboxyaminoimidazole ribonucleotide MUT; 2e-25
2ywx_A157 Phosphoribosylaminoimidazole carboxylase catalyti; 7e-22
2h31_A425 Multifunctional protein ADE2; alpha-beta-alpha, li 1e-14
>1o4v_A Phosphoribosylaminoimidazole mutase PURE; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; 1.77A {Thermotoga maritima} SCOP: c.23.8.1 Length = 183 Back     alignment and structure
 Score =  105 bits (263), Expect = 6e-29
 Identities = 40/83 (48%), Positives = 51/83 (61%)

Query: 104 NANGDSTGKNDTPIVGIIMESDSDLPVMNDAARTLSDFGVPYEIKILSPHQNRKGALSYA 163
            ++      +  P VGIIM SDSDLPVM  AA  L +FG+ YEI I+S H+       YA
Sbjct: 2   GSDKIHHHHHHVPRVGIIMGSDSDLPVMKQAAEILEEFGIDYEITIVSAHRTPDRMFEYA 61

Query: 164 LSAKERGIKIIIVGDGVEAHLSG 186
            +A+ERGI++II G G  AHL G
Sbjct: 62  KNAEERGIEVIIAGAGGAAHLPG 84
>3lp6_A Phosphoribosylaminoimidazole carboxylase catalyti; alpha and beta protein, structural genomics, PSI-2, protein initiative; 1.70A {Mycobacterium tuberculosis} Length = 174 Back     alignment and structure
>3trh_A Phosphoribosylaminoimidazole carboxylase carboxyltransferase subunit; purines, pyrimidines, nucleosides, nucleotides, lyase; 2.20A {Coxiella burnetii} Length = 169 Back     alignment and structure
>3rg8_A Phosphoribosylaminoimidazole carboxylase, PURE PR; purine biosynthesis, lyase; 1.74A {Treponema denticola} PDB: 3rgg_A* Length = 159 Back     alignment and structure
>3ors_A N5-carboxyaminoimidazole ribonucleotide mutase; isomerase, isomerase,biosynthetic protein; 1.45A {Staphylococcus aureus subsp} Length = 163 Back     alignment and structure
>1xmp_A PURE, phosphoribosylaminoimidazole carboxylase; purine biosynthesis, spine, lyase; 1.80A {Bacillus anthracis} SCOP: c.23.8.1 Length = 170 Back     alignment and structure
>4b4k_A N5-carboxyaminoimidazole ribonucleotide mutase; isomerase; 2.50A {Bacillus anthracis} Length = 181 Back     alignment and structure
>3kuu_A Phosphoribosylaminoimidazole carboxylase catalyti PURE; 3-layer (ABA) sandwich, rossmann fold, csgid, lyase, structu genomics; 1.41A {Yersinia pestis} PDB: 1d7a_A* 1qcz_A 2ate_A* 2nsl_A* 2nsh_A* 2nsj_A* Length = 174 Back     alignment and structure
>3oow_A Phosphoribosylaminoimidazole carboxylase,catalyic; structural genomics, center for structural genomics of infec diseases, csgid; HET: MSE; 1.75A {Francisella tularensis subsp} PDB: 3opq_A* Length = 166 Back     alignment and structure
>1u11_A PURE (N5-carboxyaminoimidazole ribonucleotide MUT; acidophIle, protein stability, lyase; HET: CIT; 1.55A {Acetobacter aceti} SCOP: c.23.8.1 PDB: 2fwj_A* 2fw1_A* 2fwb_A 2fwa_A 2fw9_A 2fw7_A 2fw6_A 2fwp_A* 2fwi_A* 2fw8_A Length = 182 Back     alignment and structure
>2ywx_A Phosphoribosylaminoimidazole carboxylase catalyti; rossmann fold, structural genomics, NPPSFA; 2.31A {Methanocaldococcus jannaschii} Length = 157 Back     alignment and structure
>2h31_A Multifunctional protein ADE2; alpha-beta-alpha, ligase, lyase; 2.80A {Homo sapiens} Length = 425 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query188
4b4k_A181 N5-carboxyaminoimidazole ribonucleotide mutase; is 99.96
4grd_A173 N5-CAIR mutase, phosphoribosylaminoimidazole carbo 99.96
1xmp_A170 PURE, phosphoribosylaminoimidazole carboxylase; pu 99.95
3lp6_A174 Phosphoribosylaminoimidazole carboxylase catalyti; 99.95
3rg8_A159 Phosphoribosylaminoimidazole carboxylase, PURE PR; 99.95
3oow_A166 Phosphoribosylaminoimidazole carboxylase,catalyic; 99.95
3kuu_A174 Phosphoribosylaminoimidazole carboxylase catalyti 99.95
3ors_A163 N5-carboxyaminoimidazole ribonucleotide mutase; is 99.95
3trh_A169 Phosphoribosylaminoimidazole carboxylase carboxylt 99.95
1u11_A182 PURE (N5-carboxyaminoimidazole ribonucleotide MUT; 99.94
1o4v_A183 Phosphoribosylaminoimidazole mutase PURE; structur 99.94
2ywx_A157 Phosphoribosylaminoimidazole carboxylase catalyti; 99.92
2h31_A425 Multifunctional protein ADE2; alpha-beta-alpha, li 99.91
3uhj_A 387 Probable glycerol dehydrogenase; structural genomi 94.65
1jq5_A 370 Glycerol dehydrogenase; oxidoreductase, NAD, glyce 94.59
3bfj_A 387 1,3-propanediol oxidoreductase; opportunistic path 93.77
1o2d_A 371 Alcohol dehydrogenase, iron-containing; TM0920, st 93.23
3ce9_A 354 Glycerol dehydrogenase; NP_348253.1, 3-dehydroquin 93.0
3okf_A 390 3-dehydroquinate synthase; structural genomics, ce 92.67
3ox4_A 383 Alcohol dehydrogenase 2; iron, NAD, oxidoreductase 92.34
1rrm_A 386 Lactaldehyde reductase; structural genomics, dehyd 91.83
1vlj_A 407 NADH-dependent butanol dehydrogenase; TM0820, stru 91.75
1ta9_A 450 Glycerol dehydrogenase; oxidoredu; 1.90A {Schizosa 91.25
1sg6_A 393 Pentafunctional AROM polypeptide; shikimate pathwa 91.12
3l49_A 291 ABC sugar (ribose) transporter, periplasmic substr 89.8
3egc_A 291 Putative ribose operon repressor; structural genom 89.34
1oj7_A 408 Hypothetical oxidoreductase YQHD; structural genom 88.39
3s99_A 356 Basic membrane lipoprotein; ssgcid, structural gen 88.31
3lft_A 295 Uncharacterized protein; ABC, ATPase, cassette, L- 88.22
3hl0_A 353 Maleylacetate reductase; structur genomics, PSI-2, 87.59
2fn9_A 290 Ribose ABC transporter, periplasmic ribose-bindin; 87.55
2gru_A 368 2-deoxy-scyllo-inosose synthase; aminoglycoside, 2 87.39
4fn4_A 254 Short chain dehydrogenase; NADH-binding, rossmann 87.04
3lkv_A 302 Uncharacterized conserved domain protein; ATPase b 86.74
3o1i_D 304 Periplasmic protein TORT; ligand free, two compone 86.24
3l6u_A 293 ABC-type sugar transport system periplasmic compo; 86.03
2qh8_A 302 Uncharacterized protein; conserved domain protein, 85.5
3jzd_A 358 Iron-containing alcohol dehydrogenase; YP_298327.1 85.46
3qbe_A 368 3-dehydroquinate synthase; shikimate pathway, myco 85.12
3msz_A89 Glutaredoxin 1; alpha-beta sandwich, center for st 84.94
1xah_A 354 Sadhqs, 3-dehydroquinate synthase; shikimate pathw 84.76
3m9w_A 313 D-xylose-binding periplasmic protein; xylose bindi 84.64
2hqb_A 296 Transcriptional activator of COMK gene; berkeley s 84.47
1dbq_A 289 Purine repressor; transcription regulation, DNA-bi 84.45
2b99_A156 Riboflavin synthase; lumazine riboflavin, transfer 83.82
1x60_A79 Sporulation-specific N-acetylmuramoyl-L-alanine am 83.73
1byk_A 255 Protein (trehalose operon repressor); LACI family, 83.45
3jy6_A 276 Transcriptional regulator, LACI family; NYSGXRC, P 83.45
3hs3_A 277 Ribose operon repressor; PSI-II, NYSGXRC, periplas 83.12
3miz_A 301 Putative transcriptional regulator protein, LACI f 82.77
2iks_A 293 DNA-binding transcriptional dual regulator; escher 82.69
3dlo_A155 Universal stress protein; unknown function, struct 82.68
3c3k_A 285 Alanine racemase; structural genomics, protein str 82.53
3kke_A 303 LACI family transcriptional regulator; structural 82.13
2vzf_A 197 NADH-dependent FMN reductase; oxidoreductase; 2.50 81.68
3brq_A 296 HTH-type transcriptional regulator ASCG; transcrip 81.55
3h75_A 350 Periplasmic sugar-binding domain protein; protein 81.11
3o74_A 272 Fructose transport system repressor FRUR; dual tra 81.02
1nvm_A 345 HOA, 4-hydroxy-2-oxovalerate aldolase; sequestered 80.66
1nyt_A271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 80.43
2qv7_A 337 Diacylglycerol kinase DGKB; alpha-beta domain 1, b 80.37
1tjy_A 316 Sugar transport protein; protein-ligand complex, s 80.36
3zyw_A111 Glutaredoxin-3; metal binding protein; 1.84A {Homo 80.02
3e61_A 277 Putative transcriptional repressor of ribose OPER; 80.02
3rht_A 259 (gatase1)-like protein; structural genomics, PSI-b 80.01
>4b4k_A N5-carboxyaminoimidazole ribonucleotide mutase; isomerase; 2.50A {Bacillus anthracis} Back     alignment and structure
Probab=99.96  E-value=2.1e-30  Score=214.61  Aligned_cols=79  Identities=41%  Similarity=0.685  Sum_probs=72.7

Q ss_pred             CCCCCCCeEEEEeccCCCHHHHHHHHHHHHHhCCCeeEEEEcCCCChhHHHHHHHHHhhCCCeEEEEecCccCcCcCCC
Q 029774          110 TGKNDTPIVGIIMESDSDLPVMNDAARTLSDFGVPYEIKILSPHQNRKGALSYALSAKERGIKIIIVGDGVEAHLSGTL  188 (188)
Q Consensus       110 ~~~~~~pkVaIIMGS~SDlpimekA~~vLeefGIpyDVrVaSAHRtP~~l~eyak~ae~~GvkVIIAvAGmAAHLPGVV  188 (188)
                      ....|+|+|+|||||+||||+|++|.++|++|||+||++|+||||+|+++.+|+++++++|++||||+||++|||||||
T Consensus        17 ~~~~mkp~V~IimGS~SD~~v~~~a~~~L~~~gI~~e~~V~SAHRtp~~l~~~~~~a~~~g~~ViIa~AG~aahLpGvv   95 (181)
T 4b4k_A           17 RGSHMKSLVGVIMGSTSDWETMKYACDILDELNIPYEKKVVSAHRTPDYMFEYAETARERGLKVIIAGAGGAAHLPGMV   95 (181)
T ss_dssp             -----CCSEEEEESSGGGHHHHHHHHHHHHHTTCCEEEEECCTTTSHHHHHHHHHHTTTTTCCEEEEEECSSCCHHHHH
T ss_pred             CCCCCCccEEEEECCHhHHHHHHHHHHHHHHcCCCeeEEEEccccChHHHHHHHHHHHhcCceEEEEeccccccchhhH
Confidence            3456788999999999999999999999999999999999999999999999999999999999999999999999985
>4grd_A N5-CAIR mutase, phosphoribosylaminoimidazole carboxylase catalyti; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures; 1.85A {Burkholderia cenocepacia} Back     alignment and structure
>1xmp_A PURE, phosphoribosylaminoimidazole carboxylase; purine biosynthesis, spine, lyase; 1.80A {Bacillus anthracis} SCOP: c.23.8.1 Back     alignment and structure
>3lp6_A Phosphoribosylaminoimidazole carboxylase catalyti; alpha and beta protein, structural genomics, PSI-2, protein initiative; 1.70A {Mycobacterium tuberculosis} SCOP: c.23.8.0 Back     alignment and structure
>3rg8_A Phosphoribosylaminoimidazole carboxylase, PURE PR; purine biosynthesis, lyase; 1.74A {Treponema denticola} SCOP: c.23.8.0 PDB: 3rgg_A* Back     alignment and structure
>3oow_A Phosphoribosylaminoimidazole carboxylase,catalyic; structural genomics, center for structural genomics of infec diseases, csgid; HET: MSE; 1.75A {Francisella tularensis subsp} SCOP: c.23.8.1 PDB: 3opq_A* Back     alignment and structure
>3kuu_A Phosphoribosylaminoimidazole carboxylase catalyti PURE; 3-layer (ABA) sandwich, rossmann fold, csgid, lyase, structu genomics; 1.41A {Yersinia pestis} SCOP: c.23.8.1 PDB: 1d7a_A* 1qcz_A 2ate_A* 2nsl_A* 2nsh_A* 2nsj_A* Back     alignment and structure
>3ors_A N5-carboxyaminoimidazole ribonucleotide mutase; isomerase, isomerase,biosynthetic protein; 1.45A {Staphylococcus aureus subsp} Back     alignment and structure
>3trh_A Phosphoribosylaminoimidazole carboxylase carboxyltransferase subunit; purines, pyrimidines, nucleosides, nucleotides, lyase; 2.20A {Coxiella burnetii} Back     alignment and structure
>1u11_A PURE (N5-carboxyaminoimidazole ribonucleotide MUT; acidophIle, protein stability, lyase; HET: CIT; 1.55A {Acetobacter aceti} SCOP: c.23.8.1 PDB: 2fwj_A* 2fw1_A* 2fwb_A 2fwa_A 2fw9_A 2fw7_A 2fw6_A 2fwp_A* 2fwi_A* 2fw8_A Back     alignment and structure
>1o4v_A Phosphoribosylaminoimidazole mutase PURE; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; 1.77A {Thermotoga maritima} SCOP: c.23.8.1 Back     alignment and structure
>2ywx_A Phosphoribosylaminoimidazole carboxylase catalyti; rossmann fold, structural genomics, NPPSFA; 2.31A {Methanocaldococcus jannaschii} Back     alignment and structure
>2h31_A Multifunctional protein ADE2; alpha-beta-alpha, ligase, lyase; 2.80A {Homo sapiens} Back     alignment and structure
>3uhj_A Probable glycerol dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.34A {Sinorhizobium meliloti} Back     alignment and structure
>1jq5_A Glycerol dehydrogenase; oxidoreductase, NAD, glycerol metabolism; HET: NAD; 1.70A {Geobacillus stearothermophilus} SCOP: e.22.1.2 PDB: 1jpu_A* 1jqa_A* Back     alignment and structure
>3bfj_A 1,3-propanediol oxidoreductase; opportunistic pathogens, decamer, structural genomics,struct proteomics in europe, spine; 2.70A {Klebsiella pneumoniae} Back     alignment and structure
>1o2d_A Alcohol dehydrogenase, iron-containing; TM0920, structural genomics, JCSG, PSI, protein structure initiative; HET: MSE NAP TRS; 1.30A {Thermotoga maritima} SCOP: e.22.1.2 PDB: 1vhd_A* Back     alignment and structure
>3ce9_A Glycerol dehydrogenase; NP_348253.1, 3-dehydroquinate syntha structural genomics, joint center for structural genomics; HET: MSE; 2.37A {Clostridium acetobutylicum atcc 824} Back     alignment and structure
>3okf_A 3-dehydroquinate synthase; structural genomics, center for structural genomics of infec diseases, csgid, NAD, lyase; HET: NAD; 2.50A {Vibrio cholerae o1 biovar eltor} Back     alignment and structure
>3ox4_A Alcohol dehydrogenase 2; iron, NAD, oxidoreductase; HET: NAD; 2.00A {Zymomonas mobilis} PDB: 3owo_A* Back     alignment and structure
>1rrm_A Lactaldehyde reductase; structural genomics, dehydrogenase, PSI, protein structure initiative; HET: APR; 1.60A {Escherichia coli} SCOP: e.22.1.2 PDB: 2bi4_A* 2bl4_A* Back     alignment and structure
>1vlj_A NADH-dependent butanol dehydrogenase; TM0820, structural G JCSG, protein structure initiative, PSI, joint center for S genomics; HET: NAP; 1.78A {Thermotoga maritima} SCOP: e.22.1.2 Back     alignment and structure
>1ta9_A Glycerol dehydrogenase; oxidoredu; 1.90A {Schizosaccharomyces pombe} Back     alignment and structure
>1sg6_A Pentafunctional AROM polypeptide; shikimate pathway, aromatic amino acid biosynthesis, DHQS, O form J, domain movement, cyclase, lyase; HET: NAD; 1.70A {Emericella nidulans} SCOP: e.22.1.1 PDB: 1nr5_A* 1nrx_A* 1nua_A 1nva_A* 1nvb_A* 1nvd_A* 1nve_A* 1nvf_A* 1dqs_A* Back     alignment and structure
>3l49_A ABC sugar (ribose) transporter, periplasmic substrate-binding subunit; sugar binding/transporter, structural genomics, PSI; HET: UNL; 2.30A {Rhodobacter sphaeroides} Back     alignment and structure
>3egc_A Putative ribose operon repressor; structural genomics, unknown function, DNA-binding, transcri transcription regulation, PSI-2; 2.35A {Burkholderia thailandensis} Back     alignment and structure
>1oj7_A Hypothetical oxidoreductase YQHD; structural genomics; HET: NZQ; 2.0A {Escherichia coli} SCOP: e.22.1.2 Back     alignment and structure
>3s99_A Basic membrane lipoprotein; ssgcid, structural genomics, SEA structural genomics center for infectious disease, adenine; HET: ADE; 2.05A {Brucella melitensis biovar abortus} Back     alignment and structure
>3lft_A Uncharacterized protein; ABC, ATPase, cassette, L-Trp, PSI, MCSG, structural genomics center for structural genomics; HET: MSE TRP; 1.35A {Streptococcus pneumoniae} Back     alignment and structure
>3hl0_A Maleylacetate reductase; structur genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; HET: MSE NAD EPE; 1.60A {Agrobacterium tumefaciens str} Back     alignment and structure
>2fn9_A Ribose ABC transporter, periplasmic ribose-bindin; RBP, ribose binding protein, periplasmic binding protein, thermophilic proteins; 1.40A {Thermotoga maritima} PDB: 2fn8_A* Back     alignment and structure
>2gru_A 2-deoxy-scyllo-inosose synthase; aminoglycoside, 2-deoxystreptamine, dehydroquinate synthase, lyase; HET: NAD EXO CAK; 2.15A {Bacillus circulans} PDB: 2d2x_A* Back     alignment and structure
>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Back     alignment and structure
>3lkv_A Uncharacterized conserved domain protein; ATPase binding cassette, PSI, MCSG, structural genomics, Pro structure initiative; HET: PHE; 2.20A {Vibrio cholerae} Back     alignment and structure
>3o1i_D Periplasmic protein TORT; ligand free, two component sensor, periplasmic binding prote signaling protein; HET: PE4; 2.80A {Vibrio parahaemolyticus} PDB: 3o1h_B* 3o1j_C Back     alignment and structure
>3l6u_A ABC-type sugar transport system periplasmic compo; structural genomics, nysgrc, target 11006S, PSI-2, protein S initiative; 1.90A {Exiguobacterium sibiricum} Back     alignment and structure
>3jzd_A Iron-containing alcohol dehydrogenase; YP_298327.1, putative alcohol dehedrogenase, structural GENO joint center for structural genomics; HET: MSE NAD PG4 P6G PGE; 2.10A {Ralstonia eutropha} Back     alignment and structure
>3qbe_A 3-dehydroquinate synthase; shikimate pathway, mycobacte tuberculosis, nicotinamide adenine dinucleotide (NAD)-depen enzyme; 2.07A {Mycobacterium tuberculosis} PDB: 3qbd_A Back     alignment and structure
>3msz_A Glutaredoxin 1; alpha-beta sandwich, center for structural genomics of infec diseases, csgid, oxidoreductase; HET: GSH; 2.05A {Francisella tularensis subsp} PDB: 3lgc_A* Back     alignment and structure
>1xah_A Sadhqs, 3-dehydroquinate synthase; shikimate pathway, aromatic amino acid biosynthesis, open form, form B, domain movement, cyclase; HET: NAD; 2.20A {Staphylococcus aureus} PDB: 1xag_A* 1xai_A* 1xaj_A* 1xal_A* Back     alignment and structure
>3m9w_A D-xylose-binding periplasmic protein; xylose binding protein, conformational changes, SUGA protein; 2.15A {Escherichia coli} PDB: 3m9x_A* 3ma0_A* Back     alignment and structure
>2hqb_A Transcriptional activator of COMK gene; berkeley structure genomics center target 1957B, structural genomics, PSI; 2.70A {Bacillus halodurans} Back     alignment and structure
>1dbq_A Purine repressor; transcription regulation, DNA-binding regulatory protein; 2.20A {Escherichia coli} SCOP: c.93.1.1 PDB: 1jhz_A Back     alignment and structure
>2b99_A Riboflavin synthase; lumazine riboflavin, transferase; HET: RDL; 2.22A {Methanocaldococcus jannaschii} PDB: 2b98_A* Back     alignment and structure
>1x60_A Sporulation-specific N-acetylmuramoyl-L-alanine amidase; CWLC, CWLCR, peptidoglycan, cell WALL lytic amidase, tandem repeats, hydrolase; NMR {Bacillus subtilis} Back     alignment and structure
>1byk_A Protein (trehalose operon repressor); LACI family, phosphate binding, protein structure, trehalose repressor, gene regulation; HET: T6P; 2.50A {Escherichia coli} SCOP: c.93.1.1 Back     alignment and structure
>3jy6_A Transcriptional regulator, LACI family; NYSGXRC, PSI-II, protein S initiative, structural genomics; 1.97A {Lactobacillus brevis} Back     alignment and structure
>3hs3_A Ribose operon repressor; PSI-II, NYSGXRC, periplasmic binding protein, structural genomics, protein structure initiative; 1.60A {Lactobacillus acidophilus} Back     alignment and structure
>3miz_A Putative transcriptional regulator protein, LACI family; LACL family, protein structure initiative II (PSI II), NYSGXRC, structural genomics; 1.91A {Rhizobium etli} Back     alignment and structure
>2iks_A DNA-binding transcriptional dual regulator; escherichia coli structural genomics, PSI-2, protein structure initiative; 1.85A {Escherichia coli} Back     alignment and structure
>3dlo_A Universal stress protein; unknown function, structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics; HET: MSE; 1.97A {Archaeoglobus fulgidus} PDB: 3qtb_A* Back     alignment and structure
>3c3k_A Alanine racemase; structural genomics, protein structure initiative, NEW YORK research center for structural genomics, nysgxrc; 1.99A {Actinobacillus succinogenes} Back     alignment and structure
>3kke_A LACI family transcriptional regulator; structural genomics, DNA-binding, transcription regulation, PSI-2; 2.20A {Mycobacterium smegmatis str} Back     alignment and structure
>2vzf_A NADH-dependent FMN reductase; oxidoreductase; 2.50A {Edta-degrading bacterium BNC1} PDB: 2vzh_A* 2vzj_A* Back     alignment and structure
>3brq_A HTH-type transcriptional regulator ASCG; transcriptional repressor structure escherichia coli, struct genomics, PSI-2; HET: FRU; 2.00A {Escherichia coli} Back     alignment and structure
>3h75_A Periplasmic sugar-binding domain protein; protein structure initiative II (PSI II), sugar binding PROT alpha/beta fold; 1.60A {Pseudomonas fluorescens pf-5} Back     alignment and structure
>3o74_A Fructose transport system repressor FRUR; dual transcriptional regulator, DNA, transcription; 2.00A {Pseudomonas putida} PDB: 3o75_A* Back     alignment and structure
>1nvm_A HOA, 4-hydroxy-2-oxovalerate aldolase; sequestered tunnel, substrate channeling; HET: NAD; 1.70A {Pseudomonas SP} SCOP: a.5.7.1 c.1.10.5 Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>2qv7_A Diacylglycerol kinase DGKB; alpha-beta domain 1, beta sandwich domain 2, protein-ADP COM transferase; HET: ADP; 2.30A {Staphylococcus aureus} SCOP: e.52.1.2 PDB: 2qvl_A Back     alignment and structure
>1tjy_A Sugar transport protein; protein-ligand complex, signaling protein; HET: PAV; 1.30A {Salmonella typhimurium} SCOP: c.93.1.1 PDB: 1tm2_A 3t95_A* 3ejw_A* Back     alignment and structure
>3zyw_A Glutaredoxin-3; metal binding protein; 1.84A {Homo sapiens} Back     alignment and structure
>3e61_A Putative transcriptional repressor of ribose OPER; structural genomics, DNA-binding, transcripti regulation, PSI-2; 2.00A {Staphylococcus saprophyticus subsp} Back     alignment and structure
>3rht_A (gatase1)-like protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 1.83A {Planctomyces limnophilus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 188
d1qcza_163 c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoi 1e-18
d1o4va_169 c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoi 2e-18
d1xmpa_155 c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoi 4e-18
d1u11a_159 c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoi 1e-16
>d1qcza_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Escherichia coli [TaxId: 562]} Length = 163 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Flavodoxin-like
superfamily: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE)
family: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE)
domain: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE)
species: Escherichia coli [TaxId: 562]

 Score = 76.5 bits (188), Expect = 1e-18
 Identities = 27/73 (36%), Positives = 39/73 (53%)

Query: 116 PIVGIIMESDSDLPVMNDAARTLSDFGVPYEIKILSPHQNRKGALSYALSAKERGIKIII 175
             V I+M S SD   M  AA       VP+ ++++S H+      S+A SA+E G ++II
Sbjct: 2   ARVAIVMGSKSDWATMQFAAEIFEILNVPHHVEVVSAHRTPDKLFSFAESAEENGYQVII 61

Query: 176 VGDGVEAHLSGTL 188
            G G  AHL G +
Sbjct: 62  AGAGGAAHLPGMI 74
>d1o4va_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Thermotoga maritima [TaxId: 2336]} Length = 169 Back     information, alignment and structure
>d1xmpa_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Bacillus anthracis [TaxId: 1392]} Length = 155 Back     information, alignment and structure
>d1u11a_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Acetobacter aceti [TaxId: 435]} Length = 159 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query188
d1qcza_163 N5-CAIR mutase (phosphoribosylaminoimidazole carbo 99.95
d1u11a_159 N5-CAIR mutase (phosphoribosylaminoimidazole carbo 99.95
d1xmpa_155 N5-CAIR mutase (phosphoribosylaminoimidazole carbo 99.94
d1o4va_169 N5-CAIR mutase (phosphoribosylaminoimidazole carbo 99.93
d1jq5a_ 366 Glycerol dehydrogenase {Bacillus stearothermophilu 94.9
d1o2da_ 359 Alcohol dehydrogenase TM0920 {Thermotoga maritima 94.18
d1vlja_ 398 NADH-dependent butanol dehydrogenase A (TM0820) {T 93.03
d2dria_ 271 D-ribose-binding protein {Escherichia coli, strain 92.98
d2bona1 295 Lipid kinase YegS {Escherichia coli [TaxId: 562]} 92.91
d1rrma_ 385 Lactaldehyde reductase FucO {Escherichia coli [Tax 92.22
d1byka_ 255 Trehalose repressor, C-terminal domain {Escherichi 90.56
d2qv7a1 312 Diacylglycerol kinase DgkB {Staphylococcus aureus 89.75
d1tjya_ 316 AI-2 receptor LsrB {Salmonella typhi [TaxId: 90370 89.01
d1oaaa_ 259 Sepiapterin reductase {Mouse (Mus musculus) [TaxId 88.67
d1guda_ 288 D-allose-binding protein {Escherichia coli [TaxId: 88.17
d2bd0a1 240 Bacterial sepiapterin reductase {Chlorobium tepidu 87.74
d1xq1a_ 259 Tropinone reductase {Thale cress (Arabidopsis thal 86.94
d2rhca1 257 beta-keto acyl carrier protein reductase {Streptom 86.73
d1utaa_77 Cell division protein FtsN {Escherichia coli [TaxI 86.65
d1g0oa_ 272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 85.4
d1fmca_ 255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 84.96
d2ae2a_ 259 Tropinone reductase {Jimsonweed (Datura stramonium 84.95
d1g94a2 354 Bacterial alpha-amylase {Pseudoalteromonas halopla 84.74
d1zema1 260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 84.47
d1dbqa_ 282 Purine repressor (PurR), C-terminal domain {Escher 84.38
d1yb1a_ 244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 84.27
d2nzug1 275 Glucose-resistance amylase regulator CcpA, C-termi 84.04
d2pjua1186 Propionate catabolism operon regulatory protein Pr 83.97
d1gega_ 255 meso-2,3-butanediol dehydrogenase {Klebsiella pneu 83.24
d2c07a1 251 beta-keto acyl carrier protein reductase {Malaria 82.53
d1oj7a_ 390 Hypothetical oxidoreductase yqhD {Escherichia coli 82.1
d1vl8a_ 251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 81.77
d1ae1a_ 258 Tropinone reductase {Jimsonweed (Datura stramonium 80.55
d1gpua3146 Transketolase (TK), C-domain {Baker's yeast (Sacch 80.43
>d1qcza_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Flavodoxin-like
superfamily: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE)
family: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE)
domain: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE)
species: Escherichia coli [TaxId: 562]

Probab=99.95  E-value=7.7e-29  Score=199.61  Aligned_cols=73  Identities=37%  Similarity=0.558  Sum_probs=71.4

Q ss_pred             CeEEEEeccCCCHHHHHHHHHHHHHhCCCeeEEEEcCCCChhHHHHHHHHHhhCCCeEEEEecCccCcCcCCC
Q 029774          116 PIVGIIMESDSDLPVMNDAARTLSDFGVPYEIKILSPHQNRKGALSYALSAKERGIKIIIVGDGVEAHLSGTL  188 (188)
Q Consensus       116 pkVaIIMGS~SDlpimekA~~vLeefGIpyDVrVaSAHRtP~~l~eyak~ae~~GvkVIIAvAGmAAHLPGVV  188 (188)
                      ++|+|||||+|||++|+++.++|++|||+||++|+||||+|+++.+|+++++++|++||||+||+||||||||
T Consensus         2 aKV~IImGS~SD~~~~~~a~~~L~~~gI~~e~~v~SAHRtp~~l~~~~~~~~~~~~~ViIa~AG~aa~Lpgvv   74 (163)
T d1qcza_           2 ARVAIVMGSKSDWATMQFAAEIFEILNVPHHVEVVSAHRTPDKLFSFAESAEENGYQVIIAGAGGAAHLPGMI   74 (163)
T ss_dssp             CCEEEEESSGGGHHHHHHHHHHHHHHTCCEEEEECCTTTCHHHHHHHHHHTTTTTCSEEEEEECSSCCHHHHH
T ss_pred             CeEEEEECcHhhHHHHHHHHHHHHHcCCCeEEEEeccccCHHHHHHHHHHHHHcCCeEEEEeccCCCcccchh
Confidence            6899999999999999999999999999999999999999999999999999999999999999999999985
>d1u11a_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Acetobacter aceti [TaxId: 435]} Back     information, alignment and structure
>d1xmpa_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Bacillus anthracis [TaxId: 1392]} Back     information, alignment and structure
>d1o4va_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1jq5a_ e.22.1.2 (A:) Glycerol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1o2da_ e.22.1.2 (A:) Alcohol dehydrogenase TM0920 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vlja_ e.22.1.2 (A:) NADH-dependent butanol dehydrogenase A (TM0820) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2dria_ c.93.1.1 (A:) D-ribose-binding protein {Escherichia coli, strain k-12 [TaxId: 562]} Back     information, alignment and structure
>d2bona1 e.52.1.2 (A:5-299) Lipid kinase YegS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rrma_ e.22.1.2 (A:) Lactaldehyde reductase FucO {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1byka_ c.93.1.1 (A:) Trehalose repressor, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2qv7a1 e.52.1.2 (A:1-312) Diacylglycerol kinase DgkB {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1tjya_ c.93.1.1 (A:) AI-2 receptor LsrB {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
>d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1guda_ c.93.1.1 (A:) D-allose-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1utaa_ d.58.52.1 (A:) Cell division protein FtsN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d1g94a2 c.1.8.1 (A:1-354) Bacterial alpha-amylase {Pseudoalteromonas haloplanktis (Alteromonas haloplanktis) [TaxId: 228]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d1dbqa_ c.93.1.1 (A:) Purine repressor (PurR), C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2nzug1 c.93.1.1 (G:58-332) Glucose-resistance amylase regulator CcpA, C-terminal domain {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d2pjua1 c.92.3.1 (A:11-196) Propionate catabolism operon regulatory protein PrpR {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1oj7a_ e.22.1.2 (A:) Hypothetical oxidoreductase yqhD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d1gpua3 c.48.1.1 (A:535-680) Transketolase (TK), C-domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure