Citrus Sinensis ID: 029837

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------
MEATSLISLSSFAAGASSLPPVLCPHGNNRRGLLSLTVDQQRCDNIGFISSKILSFCPKASLRGNLEAVGVPTSVPVRVAHELLQAGHRYLDVRTPEEFSAGHATGAINVPYMYRVGSGMTKNLKFVEEVSTRFRKHDEIIGCQSGKRSMMAATDLLNAVSTHANYPSKPLTWFLSNQLLTEEKLKS
cccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHcccEEEEEccHHHHHcccccccEEcccccccccccccccHHHHHHHHHcccccEEEEccccHHHHHHHHHHHHcccccEEccccHHHHHHHccccccccccc
ccccccccccHHcccccccccccccccccHHccHHHHHHHHcccccEEEEEEcccccHHHHccccHHHccccccccHHHHHHHHHcccEEEEEccHHHHHcccccccEEEcEEEcccccccccHHHHHHHHHccccccEEEEEcccHHHHHHHHHHHHcccccEEccHHHHHHHHHccccccccccc
MEATSLISLssfaagasslppvlcphgnnrrgllSLTVdqqrcdnigfisskilsfcpkaslrgnleavgvptsvPVRVAHELLQAGhryldvrtpeefsaghatgainvpymyrvgsgmtknLKFVEEVSTRFrkhdeiigcqsgkrSMMAATDLLNAVSthanypskpltwflsnqllteeklks
MEATSLISLSSFAAGASSLPPVLCPHGNNRRGLLSLTVDQQRCDNIGFISSKILSFCPKASLRGNLEAVGVPTSVPVRVAHELLQAGHRYLDVRTPEEFSAGHATGAINVPYMYRVGSGMTKNLKFVEEVStrfrkhdeiigcqsgkrSMMAATDLLNAVSTHANYPSKPLtwflsnqllteeklks
MEATslislssfaagasslPPVLCPHGNNRRGLLSLTVDQQRCDNIGFISSKILSFCPKASLRGNLEAVGVPTSVPVRVAHELLQAGHRYLDVRTPEEFSAGHATGAINVPYMYRVGSGMTKNLKFVEEVSTRFRKHDEIIGCQSGKRSMMAATDLLNAVSTHANYPSKPLTWFLSNQLLTEEKLKS
********************PVLCPHGNNRRGLLSLTVDQQRCDNIGFISSKILSFCPKASLRGNLEAVGVPTSVPVRVAHELLQAGHRYLDVRTPEEFSAGHATGAINVPYMYRVGSGMTKNLKFVEEVSTRFRKHDEIIGCQSGKRSMMAATDLLNAVSTHANYPSKPLTWFLSNQL********
*********SSFAAGASSLPPVLCPHGN*RR**************IGFISSKILS*******************VPVRVAHELLQAGHRYLDVRTPEEFSAGHATGAINVPYMYRVGSGMTK********STRFRKHDEIIGCQSGKRSMMAATDLLNAVSTHANYPSKPLTWFLS***********
********LSSFAAGASSLPPVLCPHGNNRRGLLSLTVDQQRCDNIGFISSKILSFCPKASLRGNLEAVGVPTSVPVRVAHELLQAGHRYLDVRTPEEFSAGHATGAINVPYMYRVGSGMTKNLKFVEEVSTRFRKHDEIIGCQSGKRSMMAATDLLNAVSTHANYPSKPLTWFLSNQLLTEEKLKS
*************AGASSLPPVLCPHGNNRRGLLSLTVDQQRCDNIGFISSKILSFCPKASLRGNLEAVGVPTSVPVRVAHELLQAGHRYLDVRTPEEFSAGHATGAINVPYMYRVGSGMTKNLKFVEEVSTRFRKHDEIIGCQSGKRSMMAATDLLNAVSTHANYPSKPLTWFLSNQLLT******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEATSLISLSSFAAGASSLPPVLCPHGNNRRGLLSLTVDQQRCDNIGFISSKILSFCPKASLRGNLEAVGVPTSVPVRVAHELLQAGHRYLDVRTPEEFSAGHATGAINVPYMYRVGSGMTKNLKFVEEVSTRFRKHDEIIGCQSGKRSMMAATDLLNAVSTHANYPSKPLTWFLSNQLLTEEKLKS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query187 2.2.26 [Sep-21-2011]
Q38853182 Rhodanese-like domain-con no no 0.925 0.950 0.484 1e-36
P27626183 Senescence-associated pro N/A no 0.598 0.612 0.610 4e-32
Q39129120 Thiosulfate sulfurtransfe no no 0.475 0.741 0.7 6e-29
Q9FKW8136 Thiosulfate sulfurtransfe no no 0.459 0.632 0.494 1e-16
Q8RUD6169 Rhodanese-like domain-con no no 0.481 0.532 0.406 2e-13
F4IPI4156 Rhodanese-like domain-con no no 0.459 0.551 0.382 5e-09
>sp|Q38853|STR15_ARATH Rhodanese-like domain-containing protein 15, chloroplastic OS=Arabidopsis thaliana GN=STR15 PE=2 SV=1 Back     alignment and function desciption
 Score =  152 bits (384), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 93/192 (48%), Positives = 116/192 (60%), Gaps = 19/192 (9%)

Query: 1   MEATSLISLSSFAAGASSLPPVLCPHGN------NRRGLLSLTVDQQRCDNIGFISSKIL 54
           ME T+  + S     +S++ P L   G+       RRG++   V   R  N  +  +   
Sbjct: 1   METTAFNTTSRIGNWSSAISPPLQTCGSFKCQLPTRRGVI---VADLRNSNFRWRKATTT 57

Query: 55  SFCPKASLRGNL--EAVGVPTSVPVRVAHELLQAGHRYLDVRTPEEFSAGHATGAINVPY 112
           S       RGN+  EAV +PTSVPVRVA EL QAG+RYLDVRTP+EFS GH T AINVPY
Sbjct: 58  S-------RGNVAAEAVKIPTSVPVRVARELAQAGYRYLDVRTPDEFSIGHPTRAINVPY 110

Query: 113 MYRVGSGMTKNLKFVEEVSTRFRKHDE-IIGCQSGKRSMMAATDLLNAVSTHANYPSKPL 171
           MYRVGSGM KN  F+ +VS+ FRKHDE IIGC+SG+ S MA+TDLL A  T     +   
Sbjct: 111 MYRVGSGMVKNPSFLRQVSSHFRKHDEIIIGCESGQMSFMASTDLLTAGFTAITDIAGGY 170

Query: 172 TWFLSNQLLTEE 183
             +  N+L  EE
Sbjct: 171 VAWTENELPVEE 182

Arabidopsis thaliana (taxid: 3702)
>sp|P27626|DIN1_RAPSA Senescence-associated protein DIN1 OS=Raphanus sativus GN=DIN1 PE=2 SV=1 Back     alignment and function description
>sp|Q39129|STR16_ARATH Thiosulfate sulfurtransferase 16, chloroplastic OS=Arabidopsis thaliana GN=STR16 PE=1 SV=2 Back     alignment and function description
>sp|Q9FKW8|STR18_ARATH Thiosulfate sulfurtransferase 18 OS=Arabidopsis thaliana GN=STR18 PE=1 SV=1 Back     alignment and function description
>sp|Q8RUD6|STR19_ARATH Rhodanese-like domain-containing protein 19, mitochondrial OS=Arabidopsis thaliana GN=STR19 PE=2 SV=1 Back     alignment and function description
>sp|F4IPI4|STR17_ARATH Rhodanese-like domain-containing protein 17 OS=Arabidopsis thaliana GN=STR17 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query187
224133954180 predicted protein [Populus trichocarpa] 0.823 0.855 0.677 7e-51
255579783182 Senescence-associated protein DIN1, puta 0.957 0.983 0.630 5e-50
359497218177 PREDICTED: senescence-associated protein 0.673 0.711 0.666 7e-40
351728052186 uncharacterized protein LOC100305968 [Gl 0.593 0.596 0.732 1e-39
351726216185 uncharacterized protein LOC100499831 [Gl 0.593 0.6 0.732 8e-39
357483967185 Senescence-associated protein DIN1 [Medi 0.721 0.729 0.635 1e-38
388501622179 unknown [Lotus japonicus] 0.582 0.608 0.720 3e-38
449434108184 PREDICTED: rhodanese-like domain-contain 0.727 0.739 0.631 2e-36
145334233177 senescence-associated protein DIN1 [Arab 0.834 0.881 0.514 9e-36
7340289150 OP1 [Cucumis sativus] 0.657 0.82 0.642 1e-35
>gi|224133954|ref|XP_002327720.1| predicted protein [Populus trichocarpa] gi|222836805|gb|EEE75198.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  205 bits (521), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 109/161 (67%), Positives = 125/161 (77%), Gaps = 7/161 (4%)

Query: 1   MEATSLISLSSFAAGASSLPPVLCPHG-NNRRGLLSLTVDQQRCDNIGFISSKILSFCPK 59
           M A +++   S +  +++L PVLCP   N RRG+ +  V+ +RC     I+ K LSF PK
Sbjct: 1   MAAKAVVCYGS-STSSTTLRPVLCPQQLNKRRGVFA--VNSRRCSI--NINHKSLSFRPK 55

Query: 60  ASLRGNLEAVGVPTSVPVRVAHELLQAGHRYLDVRTPEEFSAGHATGAINVPYMYRVGSG 119
            SLR NLEA G+PTSVPVRVAHEL QAGHRYLDVRTP+EFS GHA GAIN+PYMYRVGSG
Sbjct: 56  TSLRWNLEATGIPTSVPVRVAHELHQAGHRYLDVRTPDEFSTGHAAGAINIPYMYRVGSG 115

Query: 120 MTKNLKFVEEVSTRFRKHDEII-GCQSGKRSMMAATDLLNA 159
           MTKN KFVEEVS+ FRKHDEII GCQ GKRSMMAATDLL A
Sbjct: 116 MTKNPKFVEEVSSHFRKHDEIIVGCQLGKRSMMAATDLLAA 156

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255579783|ref|XP_002530729.1| Senescence-associated protein DIN1, putative [Ricinus communis] gi|223529693|gb|EEF31635.1| Senescence-associated protein DIN1, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|359497218|ref|XP_002271073.2| PREDICTED: senescence-associated protein DIN1-like [Vitis vinifera] gi|296088206|emb|CBI35721.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|351728052|ref|NP_001235646.1| uncharacterized protein LOC100305968 [Glycine max] gi|255627141|gb|ACU13915.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|351726216|ref|NP_001236607.1| uncharacterized protein LOC100499831 [Glycine max] gi|255626991|gb|ACU13840.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|357483967|ref|XP_003612270.1| Senescence-associated protein DIN1 [Medicago truncatula] gi|217071246|gb|ACJ83983.1| unknown [Medicago truncatula] gi|355513605|gb|AES95228.1| Senescence-associated protein DIN1 [Medicago truncatula] gi|388495624|gb|AFK35878.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|388501622|gb|AFK38877.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|449434108|ref|XP_004134838.1| PREDICTED: rhodanese-like domain-containing protein 15, chloroplastic-like [Cucumis sativus] gi|449491287|ref|XP_004158850.1| PREDICTED: rhodanese-like domain-containing protein 15, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|145334233|ref|NP_001078497.1| senescence-associated protein DIN1 [Arabidopsis thaliana] gi|332661162|gb|AEE86562.1| senescence-associated protein DIN1 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|7340289|gb|AAF61174.1|AF245222_1 OP1 [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query187
TAIR|locus:2128038182 SEN1 "AT4G35770" [Arabidopsis 0.641 0.659 0.632 9.5e-34
UNIPROTKB|B2C7Y6185 NRIP1 "Chloroplast N receptor- 0.631 0.637 0.625 4.2e-31
TAIR|locus:2156937120 STR16 "AT5G66040" [Arabidopsis 0.475 0.741 0.7 2.8e-27
TAIR|locus:2156882138 STR18 "AT5G66170" [Arabidopsis 0.657 0.891 0.427 3.6e-18
TAIR|locus:505006261169 AT2G21045 [Arabidopsis thalian 0.534 0.591 0.392 3.8e-14
TAIR|locus:2827795156 AT2G17850 "AT2G17850" [Arabido 0.695 0.833 0.316 5.8e-11
UNIPROTKB|Q8ECN1132 SO_3105 "Periplasmic rhodanese 0.422 0.598 0.359 3.8e-07
TIGR_CMR|SO_3105132 SO_3105 "phage shock protein E 0.422 0.598 0.359 3.8e-07
UNIPROTKB|Q607E4120 MCA1816 "Sulfurtransferase" [M 0.304 0.475 0.442 7e-06
UNIPROTKB|F1MW03114 TSTD1 "Uncharacterized protein 0.438 0.719 0.360 6.1e-05
TAIR|locus:2128038 SEN1 "AT4G35770" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 367 (134.2 bits), Expect = 9.5e-34, P = 9.5e-34
 Identities = 79/125 (63%), Positives = 92/125 (73%)

Query:    63 RGNL--EAVGVPTSVPVRVAHELLQAGHRYLDVRTPEEFSAGHATGAINVPYMYRVGSGM 120
             RGN+  EAV +PTSVPVRVA EL QAG+RYLDVRTP+EFS GH T AINVPYMYRVGSGM
Sbjct:    59 RGNVAAEAVKIPTSVPVRVARELAQAGYRYLDVRTPDEFSIGHPTRAINVPYMYRVGSGM 118

Query:   121 TKNLKFVEEVSTRFRKHDEII-GCQSGKRSMMAATDLLNAVSTH-ANYPSKPLTWFLSNQ 178
              KN  F+ +VS+ FRKHDEII GC+SG+ S MA+TDLL A  T   +     + W   N+
Sbjct:   119 VKNPSFLRQVSSHFRKHDEIIIGCESGQMSFMASTDLLTAGFTAITDIAGGYVAW-TENE 177

Query:   179 LLTEE 183
             L  EE
Sbjct:   178 LPVEE 182
GO:0003674 "molecular_function" evidence=ND
GO:0007568 "aging" evidence=IEP;ISS
GO:0009507 "chloroplast" evidence=ISM;IDA
GO:0006979 "response to oxidative stress" evidence=IEP
GO:0009611 "response to wounding" evidence=IEP
GO:0009753 "response to jasmonic acid stimulus" evidence=IEP
GO:0009744 "response to sucrose stimulus" evidence=RCA
GO:0009750 "response to fructose stimulus" evidence=RCA
UNIPROTKB|B2C7Y6 NRIP1 "Chloroplast N receptor-interacting protein 1" [Nicotiana benthamiana (taxid:4100)] Back     alignment and assigned GO terms
TAIR|locus:2156937 STR16 "AT5G66040" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2156882 STR18 "AT5G66170" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:505006261 AT2G21045 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2827795 AT2G17850 "AT2G17850" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q8ECN1 SO_3105 "Periplasmic rhodanese domain protein" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms
TIGR_CMR|SO_3105 SO_3105 "phage shock protein E" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms
UNIPROTKB|Q607E4 MCA1816 "Sulfurtransferase" [Methylococcus capsulatus str. Bath (taxid:243233)] Back     alignment and assigned GO terms
UNIPROTKB|F1MW03 TSTD1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer2.8.1.10.824
3rd Layer2.8.10.766

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query187
PLN02160136 PLN02160, PLN02160, thiosulfate sulfurtransferase 4e-22
pfam00581106 pfam00581, Rhodanese, Rhodanese-like domain 5e-13
cd0015889 cd00158, RHOD, Rhodanese Homology Domain (RHOD); a 2e-11
smart00450100 smart00450, RHOD, Rhodanese Homology Domain 8e-11
cd01522117 cd01522, RHOD_1, Member of the Rhodanese Homology 3e-08
cd0152490 cd01524, RHOD_Pyr_redox, Member of the Rhodanese H 1e-06
PRK08762 376 PRK08762, PRK08762, molybdopterin biosynthesis pro 1e-06
PRK10287104 PRK10287, PRK10287, thiosulfate:cyanide sulfurtran 3e-06
COG0607110 COG0607, PspE, Rhodanese-related sulfurtransferase 5e-06
TIGR02981101 TIGR02981, phageshock_pspE, phage shock operon rho 2e-05
cd01519106 cd01519, RHOD_HSP67B2, Member of the Rhodanese Hom 3e-05
cd0152799 cd01527, RHOD_YgaP, Member of the Rhodanese Homolo 7e-05
PRK11784 345 PRK11784, PRK11784, tRNA 2-selenouridine synthase; 1e-04
cd01449118 cd01449, TST_Repeat_2, Thiosulfate sulfurtransfera 2e-04
cd0153495 cd01534, 4RHOD_Repeat_3, Member of the Rhodanese H 4e-04
cd0152996 cd01529, 4RHOD_Repeats, Member of the Rhodanese Ho 5e-04
COG2897285 COG2897, SseA, Rhodanese-related sulfurtransferase 7e-04
TIGR03167 311 TIGR03167, tRNA_sel_U_synt, tRNA 2-selenouridine s 0.002
PRK00162108 PRK00162, glpE, thiosulfate sulfurtransferase; Val 0.004
cd01520128 cd01520, RHOD_YbbB, Member of the Rhodanese Homolo 0.004
>gnl|CDD|177819 PLN02160, PLN02160, thiosulfate sulfurtransferase Back     alignment and domain information 
 Score = 86.3 bits (213), Expect = 4e-22
 Identities = 48/114 (42%), Positives = 65/114 (57%), Gaps = 4/114 (3%)

Query: 74  SVPVRVAHELLQAGHRYLDVRTPEEFSAGHATGA--INVPYMYRVGSGMTKNLKFVEEVS 131
           SV V  A  LLQ+GH+YLDVRT +EF  GH   A  +N+PYM     G  KN +F+E+VS
Sbjct: 16  SVDVSQAKTLLQSGHQYLDVRTQDEFRRGHCEAAKIVNIPYMLNTPQGRVKNQEFLEQVS 75

Query: 132 TRFRKHDEI-IGCQSGKRSMMAATDLLNAVSTH-ANYPSKPLTWFLSNQLLTEE 183
           +     D+I +GCQSG RS+ A T+L+ A      N     L W   +  + +E
Sbjct: 76  SLLNPADDILVGCQSGARSLKATTELVAAGYKKVRNKGGGYLAWVDHSFPINQE 129

Length = 136
>gnl|CDD|216005 pfam00581, Rhodanese, Rhodanese-like domain Back     alignment and domain information
>gnl|CDD|238089 cd00158, RHOD, Rhodanese Homology Domain (RHOD); an alpha beta fold domain found duplicated in the rhodanese protein Back     alignment and domain information
>gnl|CDD|197731 smart00450, RHOD, Rhodanese Homology Domain Back     alignment and domain information
>gnl|CDD|238780 cd01522, RHOD_1, Member of the Rhodanese Homology Domain superfamily, subgroup 1 Back     alignment and domain information
>gnl|CDD|238782 cd01524, RHOD_Pyr_redox, Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>gnl|CDD|236337 PRK08762, PRK08762, molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>gnl|CDD|182356 PRK10287, PRK10287, thiosulfate:cyanide sulfurtransferase; Provisional Back     alignment and domain information
>gnl|CDD|223680 COG0607, PspE, Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|132026 TIGR02981, phageshock_pspE, phage shock operon rhodanese PspE Back     alignment and domain information
>gnl|CDD|238777 cd01519, RHOD_HSP67B2, Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>gnl|CDD|238785 cd01527, RHOD_YgaP, Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>gnl|CDD|236982 PRK11784, PRK11784, tRNA 2-selenouridine synthase; Provisional Back     alignment and domain information
>gnl|CDD|238726 cd01449, TST_Repeat_2, Thiosulfate sulfurtransferase (TST), C-terminal, catalytic domain Back     alignment and domain information
>gnl|CDD|238792 cd01534, 4RHOD_Repeat_3, Member of the Rhodanese Homology Domain superfamily, repeat 3 Back     alignment and domain information
>gnl|CDD|238787 cd01529, 4RHOD_Repeats, Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>gnl|CDD|225450 COG2897, SseA, Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|234132 TIGR03167, tRNA_sel_U_synt, tRNA 2-selenouridine synthase Back     alignment and domain information
>gnl|CDD|178908 PRK00162, glpE, thiosulfate sulfurtransferase; Validated Back     alignment and domain information
>gnl|CDD|238778 cd01520, RHOD_YbbB, Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 187
KOG1530136 consensus Rhodanese-related sulfurtransferase [Ino 99.93
PLN02160136 thiosulfate sulfurtransferase 99.92
cd01533109 4RHOD_Repeat_2 Member of the Rhodanese Homology Do 99.9
cd0152799 RHOD_YgaP Member of the Rhodanese Homology Domain 99.9
TIGR03865162 PQQ_CXXCW PQQ-dependent catabolism-associated CXXC 99.9
PRK00162108 glpE thiosulfate sulfurtransferase; Validated 99.9
cd01518101 RHOD_YceA Member of the Rhodanese Homology Domain 99.88
cd01523100 RHOD_Lact_B Member of the Rhodanese Homology Domai 99.88
cd0152490 RHOD_Pyr_redox Member of the Rhodanese Homology Do 99.87
cd01521110 RHOD_PspE2 Member of the Rhodanese Homology Domain 99.87
cd0153495 4RHOD_Repeat_3 Member of the Rhodanese Homology Do 99.86
cd01519106 RHOD_HSP67B2 Member of the Rhodanese Homology Doma 99.86
cd01520128 RHOD_YbbB Member of the Rhodanese Homology Domain 99.86
cd01526122 RHOD_ThiF Member of the Rhodanese Homology Domain 99.86
cd01528101 RHOD_2 Member of the Rhodanese Homology Domain sup 99.85
cd0144496 GlpE_ST GlpE sulfurtransferase (ST) and homologs a 99.85
cd01447103 Polysulfide_ST Polysulfide-sulfurtransferase - Rho 99.85
cd01535145 4RHOD_Repeat_4 Member of the Rhodanese Homology Do 99.85
cd01522117 RHOD_1 Member of the Rhodanese Homology Domain sup 99.85
cd01448122 TST_Repeat_1 Thiosulfate sulfurtransferase (TST), 99.84
cd01449118 TST_Repeat_2 Thiosulfate sulfurtransferase (TST), 99.84
cd01525105 RHOD_Kc Member of the Rhodanese Homology Domain su 99.84
cd01530121 Cdc25 Cdc25 phosphatases are members of the Rhodan 99.83
PRK08762 376 molybdopterin biosynthesis protein MoeB; Validated 99.83
smart00450100 RHOD Rhodanese Homology Domain. An alpha beta fold 99.83
cd0152996 4RHOD_Repeats Member of the Rhodanese Homology Dom 99.83
PF00581113 Rhodanese: Rhodanese-like domain This Prosite entr 99.81
PRK11493281 sseA 3-mercaptopyruvate sulfurtransferase; Provisi 99.81
PRK11493 281 sseA 3-mercaptopyruvate sulfurtransferase; Provisi 99.81
cd0153292 4RHOD_Repeat_1 Member of the Rhodanese Homology Do 99.81
TIGR02981101 phageshock_pspE phage shock operon rhodanese PspE. 99.8
PRK10287104 thiosulfate:cyanide sulfurtransferase; Provisional 99.8
PRK09629 610 bifunctional thiosulfate sulfurtransferase/phospha 99.8
cd01445138 TST_Repeats Thiosulfate sulfurtransferases (TST) c 99.79
COG0607110 PspE Rhodanese-related sulfurtransferase [Inorgani 99.79
cd0015889 RHOD Rhodanese Homology Domain (RHOD); an alpha be 99.78
PLN02723320 3-mercaptopyruvate sulfurtransferase 99.78
PRK05320257 rhodanese superfamily protein; Provisional 99.78
PRK01415247 hypothetical protein; Validated 99.78
PLN02723 320 3-mercaptopyruvate sulfurtransferase 99.78
cd01531113 Acr2p Eukaryotic arsenate resistance proteins are 99.77
COG2897285 SseA Rhodanese-related sulfurtransferase [Inorgani 99.76
PRK07411390 hypothetical protein; Validated 99.75
PRK07878392 molybdopterin biosynthesis-like protein MoeZ; Vali 99.75
PRK00142314 putative rhodanese-related sulfurtransferase; Prov 99.75
PRK09629 610 bifunctional thiosulfate sulfurtransferase/phospha 99.75
cd01443113 Cdc25_Acr2p Cdc25 enzymes are members of the Rhoda 99.73
PRK11784 345 tRNA 2-selenouridine synthase; Provisional 99.73
TIGR03167 311 tRNA_sel_U_synt tRNA 2-selenouridine synthase. The 99.71
PRK05597355 molybdopterin biosynthesis protein MoeB; Validated 99.71
COG2897 285 SseA Rhodanese-related sulfurtransferase [Inorgani 99.69
cd01446132 DSP_MapKP N-terminal regulatory rhodanese domain o 99.64
PRK05600370 thiamine biosynthesis protein ThiF; Validated 99.61
PRK01269482 tRNA s(4)U8 sulfurtransferase; Provisional 99.45
COG1054308 Predicted sulfurtransferase [General function pred 99.34
KOG2017427 consensus Molybdopterin synthase sulfurylase [Coen 99.21
KOG1529 286 consensus Mercaptopyruvate sulfurtransferase/thios 99.19
KOG3772325 consensus M-phase inducer phosphatase [Cell cycle 99.12
KOG1529286 consensus Mercaptopyruvate sulfurtransferase/thios 98.98
COG5105427 MIH1 Mitotic inducer, protein phosphatase [Cell di 98.1
COG2603 334 Predicted ATPase [General function prediction only 97.74
TIGR01244135 conserved hypothetical protein TIGR01244. No membe 97.27
PF04273110 DUF442: Putative phosphatase (DUF442); InterPro: I 97.23
PRK00142 314 putative rhodanese-related sulfurtransferase; Prov 95.5
KOG1093725 consensus Predicted protein kinase (contains TBC a 94.8
COG3453130 Uncharacterized protein conserved in bacteria [Fun 92.86
PF13350164 Y_phosphatase3: Tyrosine phosphatase family; PDB: 92.38
PLN02727 986 NAD kinase 92.15
KOG1717 343 consensus Dual specificity phosphatase [Defense me 91.76
cd00127139 DSPc Dual specificity phosphatases (DSP); Ser/Thr 91.48
smart00195138 DSPc Dual specificity phosphatase, catalytic domai 90.68
KOG3636 669 consensus Uncharacterized conserved protein, conta 90.12
TIGR03167311 tRNA_sel_U_synt tRNA 2-selenouridine synthase. The 81.83
>KOG1530 consensus Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] Back     alignment and domain information 
Probab=99.93  E-value=2.6e-25  Score=154.94  Aligned_cols=113  Identities=41%  Similarity=0.623  Sum_probs=101.3

Q ss_pred             cCCCcccCHHHHHHHHHCC-CEEEecCChhhhccccCCCcEEeCcccccCCCCCCCHHHHHHHhhcCCC-CCcEE-EcCC
Q 029837           69 VGVPTSVPVRVAHELLQAG-HRYLDVRTPEEFSAGHATGAINVPYMYRVGSGMTKNLKFVEEVSTRFRK-HDEII-GCQS  145 (187)
Q Consensus        69 ~~~~~~v~~~~~~~~l~~~-~~iIDvR~~~e~~~ghIpgAi~ip~~~~~~~~~~~~~~~~~~~~~~l~~-~~~iv-~C~~  145 (187)
                      .+.+..++.++++++++.+ .++||||+++||.+||||.+||||+......+...+++|++......++ ++.|| +|++
T Consensus        19 ~~~~~sv~~~qvk~L~~~~~~~llDVRepeEfk~gh~~~siNiPy~~~~~~~~l~~~eF~kqvg~~kp~~d~eiIf~C~S   98 (136)
T KOG1530|consen   19 ASNPQSVSVEQVKNLLQHPDVVLLDVREPEEFKQGHIPASINIPYMSRPGAGALKNPEFLKQVGSSKPPHDKEIIFGCAS   98 (136)
T ss_pred             cCCcEEEEHHHHHHHhcCCCEEEEeecCHHHhhccCCcceEeccccccccccccCCHHHHHHhcccCCCCCCcEEEEecc
Confidence            3556789999999999987 9999999999999999999999999866677788899999998766554 55999 9999


Q ss_pred             ChhHHHHHHHHHHCCCCee-EecCcHhhhhhCCCcee
Q 029837          146 GKRSMMAATDLLNAVSTHA-NYPSKPLTWFLSNQLLT  181 (187)
Q Consensus       146 g~rs~~aa~~L~~~G~~~v-~l~GG~~~W~~~g~p~~  181 (187)
                      |.||..|...|..+||++| .|.|||.+|.+.++|..
T Consensus        99 G~Rs~~A~~~l~s~Gyknv~ny~Gs~~~W~~k~~~~~  135 (136)
T KOG1530|consen   99 GVRSLKATKILVSAGYKNVGNYPGSYLAWVDKGGPKK  135 (136)
T ss_pred             CcchhHHHHHHHHcCcccccccCccHHHHHHccCCCC
Confidence            9999999999999999999 89999999999998753

>PLN02160 thiosulfate sulfurtransferase Back     alignment and domain information
>cd01533 4RHOD_Repeat_2 Member of the Rhodanese Homology Domain superfamily, repeat 2 Back     alignment and domain information
>cd01527 RHOD_YgaP Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>TIGR03865 PQQ_CXXCW PQQ-dependent catabolism-associated CXXCW motif protein Back     alignment and domain information
>PRK00162 glpE thiosulfate sulfurtransferase; Validated Back     alignment and domain information
>cd01518 RHOD_YceA Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01523 RHOD_Lact_B Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01524 RHOD_Pyr_redox Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01521 RHOD_PspE2 Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01534 4RHOD_Repeat_3 Member of the Rhodanese Homology Domain superfamily, repeat 3 Back     alignment and domain information
>cd01519 RHOD_HSP67B2 Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01520 RHOD_YbbB Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01526 RHOD_ThiF Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01528 RHOD_2 Member of the Rhodanese Homology Domain superfamily, subgroup 2 Back     alignment and domain information
>cd01444 GlpE_ST GlpE sulfurtransferase (ST) and homologs are members of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01447 Polysulfide_ST Polysulfide-sulfurtransferase - Rhodanese Homology Domain Back     alignment and domain information
>cd01535 4RHOD_Repeat_4 Member of the Rhodanese Homology Domain superfamily, repeat 4 Back     alignment and domain information
>cd01522 RHOD_1 Member of the Rhodanese Homology Domain superfamily, subgroup 1 Back     alignment and domain information
>cd01448 TST_Repeat_1 Thiosulfate sulfurtransferase (TST), N-terminal, inactive domain Back     alignment and domain information
>cd01449 TST_Repeat_2 Thiosulfate sulfurtransferase (TST), C-terminal, catalytic domain Back     alignment and domain information
>cd01525 RHOD_Kc Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01530 Cdc25 Cdc25 phosphatases are members of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>PRK08762 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>smart00450 RHOD Rhodanese Homology Domain Back     alignment and domain information
>cd01529 4RHOD_Repeats Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>PF00581 Rhodanese: Rhodanese-like domain This Prosite entry represents a subset of this family Back     alignment and domain information
>PRK11493 sseA 3-mercaptopyruvate sulfurtransferase; Provisional Back     alignment and domain information
>PRK11493 sseA 3-mercaptopyruvate sulfurtransferase; Provisional Back     alignment and domain information
>cd01532 4RHOD_Repeat_1 Member of the Rhodanese Homology Domain superfamily, repeat 1 Back     alignment and domain information
>TIGR02981 phageshock_pspE phage shock operon rhodanese PspE Back     alignment and domain information
>PRK10287 thiosulfate:cyanide sulfurtransferase; Provisional Back     alignment and domain information
>PRK09629 bifunctional thiosulfate sulfurtransferase/phosphatidylserine decarboxylase; Provisional Back     alignment and domain information
>cd01445 TST_Repeats Thiosulfate sulfurtransferases (TST) contain 2 copies of the Rhodanese Homology Domain Back     alignment and domain information
>COG0607 PspE Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd00158 RHOD Rhodanese Homology Domain (RHOD); an alpha beta fold domain found duplicated in the rhodanese protein Back     alignment and domain information
>PLN02723 3-mercaptopyruvate sulfurtransferase Back     alignment and domain information
>PRK05320 rhodanese superfamily protein; Provisional Back     alignment and domain information
>PRK01415 hypothetical protein; Validated Back     alignment and domain information
>PLN02723 3-mercaptopyruvate sulfurtransferase Back     alignment and domain information
>cd01531 Acr2p Eukaryotic arsenate resistance proteins are members of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>COG2897 SseA Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK07411 hypothetical protein; Validated Back     alignment and domain information
>PRK07878 molybdopterin biosynthesis-like protein MoeZ; Validated Back     alignment and domain information
>PRK00142 putative rhodanese-related sulfurtransferase; Provisional Back     alignment and domain information
>PRK09629 bifunctional thiosulfate sulfurtransferase/phosphatidylserine decarboxylase; Provisional Back     alignment and domain information
>cd01443 Cdc25_Acr2p Cdc25 enzymes are members of the Rhodanese Homology Domain (RHOD) superfamily Back     alignment and domain information
>PRK11784 tRNA 2-selenouridine synthase; Provisional Back     alignment and domain information
>TIGR03167 tRNA_sel_U_synt tRNA 2-selenouridine synthase Back     alignment and domain information
>PRK05597 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>COG2897 SseA Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd01446 DSP_MapKP N-terminal regulatory rhodanese domain of dual specificity phosphatases (DSP), such as Mapk Phosphatase Back     alignment and domain information
>PRK05600 thiamine biosynthesis protein ThiF; Validated Back     alignment and domain information
>PRK01269 tRNA s(4)U8 sulfurtransferase; Provisional Back     alignment and domain information
>COG1054 Predicted sulfurtransferase [General function prediction only] Back     alignment and domain information
>KOG2017 consensus Molybdopterin synthase sulfurylase [Coenzyme transport and metabolism] Back     alignment and domain information
>KOG1529 consensus Mercaptopyruvate sulfurtransferase/thiosulfate sulfurtransferase [Defense mechanisms] Back     alignment and domain information
>KOG3772 consensus M-phase inducer phosphatase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1529 consensus Mercaptopyruvate sulfurtransferase/thiosulfate sulfurtransferase [Defense mechanisms] Back     alignment and domain information
>COG5105 MIH1 Mitotic inducer, protein phosphatase [Cell division and chromosome partitioning] Back     alignment and domain information
>COG2603 Predicted ATPase [General function prediction only] Back     alignment and domain information
>TIGR01244 conserved hypothetical protein TIGR01244 Back     alignment and domain information
>PF04273 DUF442: Putative phosphatase (DUF442); InterPro: IPR005939 Although this domain is uncharacterised it seems likely that it performs a phosphatase function Back     alignment and domain information
>PRK00142 putative rhodanese-related sulfurtransferase; Provisional Back     alignment and domain information
>KOG1093 consensus Predicted protein kinase (contains TBC and RHOD domains) [General function prediction only] Back     alignment and domain information
>COG3453 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13350 Y_phosphatase3: Tyrosine phosphatase family; PDB: 1YWF_A 2OZ5_B Back     alignment and domain information
>PLN02727 NAD kinase Back     alignment and domain information
>KOG1717 consensus Dual specificity phosphatase [Defense mechanisms] Back     alignment and domain information
>cd00127 DSPc Dual specificity phosphatases (DSP); Ser/Thr and Tyr protein phosphatases Back     alignment and domain information
>smart00195 DSPc Dual specificity phosphatase, catalytic domain Back     alignment and domain information
>KOG3636 consensus Uncharacterized conserved protein, contains TBC and Rhodanese domains [General function prediction only] Back     alignment and domain information
>TIGR03167 tRNA_sel_U_synt tRNA 2-selenouridine synthase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query187
1tq1_A129 Solution Structure Of At5g66040, A Putative Protein 3e-30
>pdb|1TQ1|A Chain A, Solution Structure Of At5g66040, A Putative Protein From Arabidosis Thaliana Length = 129 Back     alignment and structure 
Iteration: 1

 Score =  127 bits (320), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 63/90 (70%), Positives = 72/90 (80%), Gaps = 1/90 (1%)
Query: 71  VPTSVPVRVAHELLQAGHRYLDVRTPEEFSAGHATGAINVPYMYRVGSGMTKNLKFVEEV 130
           VP+SV V VAH+LL AGHRYLDVRTPEEFS GHA GAINVPYM R  SGM+KN  F+E+V
Sbjct: 16  VPSSVSVTVAHDLLLAGHRYLDVRTPEEFSQGHACGAINVPYMNRGASGMSKNTDFLEQV 75
Query: 131 STRFRKHDEII-GCQSGKRSMMAATDLLNA 159
           S+ F + D II GCQSG RS+ A TDLL+A
Sbjct: 76  SSHFGQSDNIIVGCQSGGRSIKATTDLLHA 105

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query187
1tq1_A129 AT5G66040, senescence-associated family protein; C 1e-32
3hix_A106 ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q 2e-13
1wv9_A94 Rhodanese homolog TT1651; CDC25, phosphatase, sulf 2e-13
3ilm_A141 ALR3790 protein; rhodanese-like, NSR437H, NESG, st 4e-13
3d1p_A139 Putative thiosulfate sulfurtransferase YOR285W; at 9e-13
2jtq_A85 Phage shock protein E; solution structure rhodanes 2e-12
1gmx_A108 GLPE protein; transferase, rhodanese, sulfurtransf 6e-12
2k0z_A110 Uncharacterized protein HP1203; A/B domain, struct 8e-12
3eme_A103 Rhodanese-like domain protein; alpha-beta-alpha sa 4e-11
3foj_A100 Uncharacterized protein; protein SSP1007, structur 6e-11
2fsx_A148 RV0390, COG0607: rhodanese-related sulfurtransfera 6e-11
3gk5_A108 Uncharacterized rhodanese-related protein TVG08686 9e-11
1vee_A134 Proline-rich protein family; hypothetical protein, 6e-10
3nhv_A144 BH2092 protein; alpha-beta protein, structural gen 2e-09
3g5j_A134 Putative ATP/GTP binding protein; N-terminal domai 4e-09
1c25_A161 CDC25A; hydrolase, cell cycle phosphatase,dual spe 4e-09
3i2v_A127 Adenylyltransferase and sulfurtransferase MOCS3; r 6e-09
3tp9_A474 Beta-lactamase and rhodanese domain protein; struc 2e-08
3flh_A124 Uncharacterized protein LP_1913; alpha-beta protei 4e-08
1yt8_A539 Thiosulfate sulfurtransferase; rhodanase domains, 4e-08
1yt8_A 539 Thiosulfate sulfurtransferase; rhodanase domains, 3e-07
1yt8_A 539 Thiosulfate sulfurtransferase; rhodanase domains, 6e-07
1yt8_A 539 Thiosulfate sulfurtransferase; rhodanase domains, 1e-06
1t3k_A152 Arath CDC25, dual-specificity tyrosine phosphatase 5e-08
3ics_A588 Coenzyme A-disulfide reductase; pyridine nucleotid 1e-07
1qb0_A211 Protein (M-phase inducer phosphatase 2 (CDC25B)); 3e-07
3r2u_A466 Metallo-beta-lactamase family protein; structural 5e-07
3ntd_A565 FAD-dependent pyridine nucleotide-disulphide oxido 1e-06
2a2k_A175 M-phase inducer phosphatase 2; dual specificity, s 1e-06
3op3_A216 M-phase inducer phosphatase 3; structural genomics 1e-06
2hhg_A139 Hypothetical protein RPA3614; MCSG, structural gen 2e-06
1qxn_A137 SUD, sulfide dehydrogenase; polysulfide-sulfur tra 8e-06
3f4a_A169 Uncharacterized protein YGR203W; protein phosphata 6e-05
1e0c_A271 Rhodanese, sulfurtransferase; sulfur metabolism, t 7e-05
2j6p_A152 SB(V)-AS(V) reductase; arsenate reductase, antimon 1e-04
3hzu_A318 Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, 2e-04
1uar_A285 Rhodanese; sulfurtransferase, riken structural gen 5e-04
3aay_A277 Putative thiosulfate sulfurtransferase; sulfurtran 5e-04
>1tq1_A AT5G66040, senescence-associated family protein; CESG, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: c.46.1.3 Length = 129 Back     alignment and structure
 Score =  112 bits (283), Expect = 1e-32
 Identities = 64/94 (68%), Positives = 73/94 (77%), Gaps = 1/94 (1%)

Query: 67  EAVGVPTSVPVRVAHELLQAGHRYLDVRTPEEFSAGHATGAINVPYMYRVGSGMTKNLKF 126
           E   VP+SV V VAH+LL AGHRYLDVRTPEEFS GHA GAINVPYM R  SGM+KN  F
Sbjct: 12  EESRVPSSVSVTVAHDLLLAGHRYLDVRTPEEFSQGHACGAINVPYMNRGASGMSKNTDF 71

Query: 127 VEEVSTRFRKHDEII-GCQSGKRSMMAATDLLNA 159
           +E+VS+ F + D II GCQSG RS+ A TDLL+A
Sbjct: 72  LEQVSSHFGQSDNIIVGCQSGGRSIKATTDLLHA 105
>3hix_A ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q8YQN0_anAsp, NSR437I, NESG, structural genomics, PSI-2, protein structure initiative; 1.92A {Anabaena SP} PDB: 3k9r_A Length = 106 Back     alignment and structure
>1wv9_A Rhodanese homolog TT1651; CDC25, phosphatase, sulfurtransferase, structural genomics, NPPSFA; 2.00A {Thermus thermophilus} Length = 94 Back     alignment and structure
>3ilm_A ALR3790 protein; rhodanese-like, NSR437H, NESG, structural genomics, protein structure initiative, northeast structural genomics consortium; 2.26A {Nostoc SP} PDB: 2kl3_A Length = 141 Back     alignment and structure
>3d1p_A Putative thiosulfate sulfurtransferase YOR285W; atomic structure, atomic resolution structure, PSI, MCSG; HET: MSE; 0.98A {Saccharomyces cerevisiae} Length = 139 Back     alignment and structure
>2jtq_A Phage shock protein E; solution structure rhodanese, stress response, transferase; NMR {Escherichia coli} PDB: 2jtr_A 2jts_A Length = 85 Back     alignment and structure
>1gmx_A GLPE protein; transferase, rhodanese, sulfurtransferase, glycerol metabolism; 1.1A {Escherichia coli} SCOP: c.46.1.3 PDB: 1gn0_A Length = 108 Back     alignment and structure
>2k0z_A Uncharacterized protein HP1203; A/B domain, structural genomics, unknown function, PSI-2, PR structure initiative; NMR {Helicobacter pylori} Length = 110 Back     alignment and structure
>3foj_A Uncharacterized protein; protein SSP1007, structural genomics, PSI-2, protein structure initiative; 1.60A {Staphylococcus saprophyticus subsp} Length = 100 Back     alignment and structure
>2fsx_A RV0390, COG0607: rhodanese-related sulfurtransferase; RV0390 BR SAD DATA with FBAR, structural genomics, PSI; 1.80A {Mycobacterium tuberculosis} Length = 148 Back     alignment and structure
>3gk5_A Uncharacterized rhodanese-related protein TVG0868615; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.40A {Thermoplasma volcanium GSS1} Length = 108 Back     alignment and structure
>1vee_A Proline-rich protein family; hypothetical protein, structural genomics, rhodanese domain, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} PDB: 2dcq_A Length = 134 Back     alignment and structure
>3nhv_A BH2092 protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 2.50A {Bacillus halodurans} PDB: 3o3w_A Length = 144 Back     alignment and structure
>3g5j_A Putative ATP/GTP binding protein; N-terminal domain of ATP/GTP binding protein, PSI, MCSG, STR genomics, protein structure initiative; HET: PGE; 1.76A {Clostridium difficile} Length = 134 Back     alignment and structure
>1c25_A CDC25A; hydrolase, cell cycle phosphatase,dual specificity protein phosphatase, CDK2; 2.30A {Homo sapiens} SCOP: c.46.1.1 Length = 161 Back     alignment and structure
>3i2v_A Adenylyltransferase and sulfurtransferase MOCS3; rhodanese, UBA4, structural genomics, ubiquitin biology, structural genomics consortium, SGC; 1.25A {Homo sapiens} Length = 127 Back     alignment and structure
>3tp9_A Beta-lactamase and rhodanese domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.70A {Alicyclobacillus acidocaldarius subsp} Length = 474 Back     alignment and structure
>3flh_A Uncharacterized protein LP_1913; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.00A {Lactobacillus plantarum} PDB: 3fnj_A 3i3u_A Length = 124 Back     alignment and structure
>1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 Length = 539 Back     alignment and structure
>1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 Length = 539 Back     alignment and structure
>1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 Length = 539 Back     alignment and structure
>1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 Length = 539 Back     alignment and structure
>1t3k_A Arath CDC25, dual-specificity tyrosine phosphatase; cell cycle, phosphorylation, plant, hydrolase; NMR {Arabidopsis thaliana} SCOP: c.46.1.1 Length = 152 Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Length = 588 Back     alignment and structure
>1qb0_A Protein (M-phase inducer phosphatase 2 (CDC25B)); hydrolase, cell cycle phosphatase, dual specificity protein phosphatase; 1.91A {Homo sapiens} SCOP: c.46.1.1 PDB: 1cwr_A 1cws_A 2uzq_A Length = 211 Back     alignment and structure
>3r2u_A Metallo-beta-lactamase family protein; structural genomics, for structural genomics of infectious diseases, csgid, HYDR; 2.10A {Staphylococcus aureus} Length = 466 Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Length = 565 Back     alignment and structure
>2a2k_A M-phase inducer phosphatase 2; dual specificity, substrate trapping, active site mutant, hydrolase; 1.52A {Homo sapiens} PDB: 2ifv_A 1ymd_A 1ym9_A 1ymk_A 1yml_A 1ys0_A 1cwt_A 2ifd_A Length = 175 Back     alignment and structure
>3op3_A M-phase inducer phosphatase 3; structural genomics, structural genomics consortium, SGC, Al alpha sandwich, kinase, cytosol, hydrolase; 2.63A {Homo sapiens} Length = 216 Back     alignment and structure
>2hhg_A Hypothetical protein RPA3614; MCSG, structural genomics, rohopseudom palustris, PSI-2, protein structure initiative; 1.20A {Rhodopseudomonas palustris} Length = 139 Back     alignment and structure
>1qxn_A SUD, sulfide dehydrogenase; polysulfide-sulfur transferase, homodimer; NMR {Wolinella succinogenes} SCOP: c.46.1.3 Length = 137 Back     alignment and structure
>3f4a_A Uncharacterized protein YGR203W; protein phosphatase, rhodanese-like family, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.80A {Saccharomyces cerevisiae} PDB: 3fs5_A* Length = 169 Back     alignment and structure
>1e0c_A Rhodanese, sulfurtransferase; sulfur metabolism, thiosulfate:cyanide sulfurtransferase; 1.8A {Azotobacter vinelandii} SCOP: c.46.1.2 c.46.1.2 PDB: 1h4k_X 1h4m_X Length = 271 Back     alignment and structure
>2j6p_A SB(V)-AS(V) reductase; arsenate reductase, antimonate reductase, CDC25 phosphatase, rhodanese, C-MYC epitope, oxidoreductase; HET: EPE; 2.15A {Leishmania major} Length = 152 Back     alignment and structure
>3hzu_A Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, infectious disease, transferase structural genomics; 2.10A {Mycobacterium tuberculosis} PDB: 3p3a_A Length = 318 Back     alignment and structure
>1uar_A Rhodanese; sulfurtransferase, riken structural genomics/PROT initiative, RSGI, structural genomics, transferase; 1.70A {Thermus thermophilus} SCOP: c.46.1.2 c.46.1.2 Length = 285 Back     alignment and structure
>3aay_A Putative thiosulfate sulfurtransferase; sulfurtranserase, structural genomics, PSI, structure initiative; 1.90A {Mycobacterium tuberculosis} PDB: 3aax_A 3hwi_A Length = 277 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query187
3iwh_A103 Rhodanese-like domain protein; alpha-beta-alpha sa 99.96
1tq1_A129 AT5G66040, senescence-associated family protein; C 99.94
3gk5_A108 Uncharacterized rhodanese-related protein TVG08686 99.94
3foj_A100 Uncharacterized protein; protein SSP1007, structur 99.94
3eme_A103 Rhodanese-like domain protein; alpha-beta-alpha sa 99.94
1gmx_A108 GLPE protein; transferase, rhodanese, sulfurtransf 99.93
3ilm_A141 ALR3790 protein; rhodanese-like, NSR437H, NESG, st 99.93
3hix_A106 ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q 99.93
3d1p_A139 Putative thiosulfate sulfurtransferase YOR285W; at 99.93
1qxn_A137 SUD, sulfide dehydrogenase; polysulfide-sulfur tra 99.92
2hhg_A139 Hypothetical protein RPA3614; MCSG, structural gen 99.92
1wv9_A94 Rhodanese homolog TT1651; CDC25, phosphatase, sulf 99.91
3flh_A124 Uncharacterized protein LP_1913; alpha-beta protei 99.91
3nhv_A144 BH2092 protein; alpha-beta protein, structural gen 99.91
2k0z_A110 Uncharacterized protein HP1203; A/B domain, struct 99.9
2fsx_A148 RV0390, COG0607: rhodanese-related sulfurtransfera 99.89
1t3k_A152 Arath CDC25, dual-specificity tyrosine phosphatase 99.89
2jtq_A85 Phage shock protein E; solution structure rhodanes 99.88
1vee_A134 Proline-rich protein family; hypothetical protein, 99.88
1e0c_A 271 Rhodanese, sulfurtransferase; sulfur metabolism, t 99.87
1urh_A280 3-mercaptopyruvate sulfurtransferase; rhodanese; 2 99.87
3g5j_A134 Putative ATP/GTP binding protein; N-terminal domai 99.86
3hzu_A 318 Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, 99.86
1e0c_A271 Rhodanese, sulfurtransferase; sulfur metabolism, t 99.86
1urh_A 280 3-mercaptopyruvate sulfurtransferase; rhodanese; 2 99.86
1uar_A285 Rhodanese; sulfurtransferase, riken structural gen 99.86
3hzu_A318 Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, 99.86
1rhs_A296 Sulfur-substituted rhodanese; transferase, sulfurt 99.85
3i2v_A127 Adenylyltransferase and sulfurtransferase MOCS3; r 99.85
1c25_A161 CDC25A; hydrolase, cell cycle phosphatase,dual spe 99.85
3aay_A 277 Putative thiosulfate sulfurtransferase; sulfurtran 99.85
2a2k_A175 M-phase inducer phosphatase 2; dual specificity, s 99.84
1qb0_A211 Protein (M-phase inducer phosphatase 2 (CDC25B)); 99.84
3olh_A302 MST, 3-mercaptopyruvate sulfurtransferase; structu 99.84
3aay_A277 Putative thiosulfate sulfurtransferase; sulfurtran 99.84
1rhs_A 296 Sulfur-substituted rhodanese; transferase, sulfurt 99.84
1uar_A 285 Rhodanese; sulfurtransferase, riken structural gen 99.83
2ouc_A142 Dual specificity protein phosphatase 10; rhodanese 99.83
2j6p_A152 SB(V)-AS(V) reductase; arsenate reductase, antimon 99.83
3olh_A 302 MST, 3-mercaptopyruvate sulfurtransferase; structu 99.83
2vsw_A153 Dual specificity protein phosphatase 16; hydrolase 99.82
1okg_A 373 Possible 3-mercaptopyruvate sulfurtransferase; rho 99.82
3tp9_A474 Beta-lactamase and rhodanese domain protein; struc 99.82
2eg4_A230 Probable thiosulfate sulfurtransferase; structural 99.82
3op3_A216 M-phase inducer phosphatase 3; structural genomics 99.82
4f67_A265 UPF0176 protein LPG2838; structural genomics, PSI- 99.82
1yt8_A539 Thiosulfate sulfurtransferase; rhodanase domains, 99.81
1yt8_A 539 Thiosulfate sulfurtransferase; rhodanase domains, 99.81
2wlr_A423 Putative thiosulfate sulfurtransferase YNJE; rhoda 99.81
2wlr_A 423 Putative thiosulfate sulfurtransferase YNJE; rhoda 99.8
3f4a_A169 Uncharacterized protein YGR203W; protein phosphata 99.77
3ics_A588 Coenzyme A-disulfide reductase; pyridine nucleotid 99.77
1hzm_A154 Dual specificity protein phosphatase 6; hydrolase; 99.77
3tg1_B158 Dual specificity protein phosphatase 10; kinase/rh 99.77
1okg_A373 Possible 3-mercaptopyruvate sulfurtransferase; rho 99.76
3ntd_A565 FAD-dependent pyridine nucleotide-disulphide oxido 99.75
2eg4_A 230 Probable thiosulfate sulfurtransferase; structural 99.72
3utn_X327 Thiosulfate sulfurtransferase TUM1; rhodanese-like 99.7
3tp9_A474 Beta-lactamase and rhodanese domain protein; struc 99.7
3r2u_A466 Metallo-beta-lactamase family protein; structural 99.68
1whb_A157 KIAA0055; deubiqutinating enzyme, UBPY, structural 99.68
2gwf_A157 Ubiquitin carboxyl-terminal hydrolase 8; protein-p 99.67
3utn_X 327 Thiosulfate sulfurtransferase TUM1; rhodanese-like 99.66
3r2u_A466 Metallo-beta-lactamase family protein; structural 99.39
2f46_A156 Hypothetical protein; structural genomics, joint c 98.05
4erc_A150 Dual specificity protein phosphatase 23; alpha bet 94.91
1v8c_A168 MOAD related protein; riken structural genomics/pr 93.76
2img_A151 Dual specificity protein phosphatase 23; DUSP23, V 93.68
1xri_A151 AT1G05000; structural genomics, protein structure 93.1
2nt2_A145 Protein phosphatase slingshot homolog 2; alpha/bet 90.89
2hcm_A164 Dual specificity protein phosphatase; structural g 90.22
1fpz_A212 Cyclin-dependent kinase inhibitor 3; alpha-beta sa 90.04
1yz4_A160 DUSP15, dual specificity phosphatase-like 15 isofo 88.97
2r0b_A154 Serine/threonine/tyrosine-interacting protein; str 88.23
1wrm_A165 Dual specificity phosphatase 22; DSP, JNK, hydrola 88.09
3ezz_A144 Dual specificity protein phosphatase 4; alpha/beta 87.86
2esb_A188 Dual specificity protein phosphatase 18; alpha/bet 87.4
3rgo_A157 Protein-tyrosine phosphatase mitochondrial 1; phos 86.74
2wgp_A190 Dual specificity protein phosphatase 14; MKP6, DUS 86.28
1ywf_A 296 Phosphotyrosine protein phosphatase PTPB; four str 85.12
1zzw_A149 Dual specificity protein phosphatase 10; MKP, PTP, 84.86
3f81_A183 Dual specificity protein phosphatase 3; hydrolase, 84.74
2e0t_A151 Dual specificity phosphatase 26; conserved hypothe 84.62
2i6j_A161 Ssoptp, sulfolobus solfataricus protein tyrosine p 84.46
2g6z_A211 Dual specificity protein phosphatase 5; alpha/beta 83.77
2pq5_A205 Dual specificity protein phosphatase 13; hydrolase 81.08
>3iwh_A Rhodanese-like domain protein; alpha-beta-alpha sandwich, structural genomics, C structural genomics of infectious diseases, csgid; 2.00A {Staphylococcus aureus subsp} PDB: 3mzz_A Back     alignment and structure
Probab=99.96  E-value=3.3e-29  Score=172.09  Aligned_cols=98  Identities=20%  Similarity=0.191  Sum_probs=87.7

Q ss_pred             cccCHHHHHHHHHCC--CEEEecCChhhhccccCCCcEEeCcccccCCCCCCCHHHHHHHhhcCCCCCcEE-EcCCChhH
Q 029837           73 TSVPVRVAHELLQAG--HRYLDVRTPEEFSAGHATGAINVPYMYRVGSGMTKNLKFVEEVSTRFRKHDEII-GCQSGKRS  149 (187)
Q Consensus        73 ~~v~~~~~~~~l~~~--~~iIDvR~~~e~~~ghIpgAi~ip~~~~~~~~~~~~~~~~~~~~~~l~~~~~iv-~C~~g~rs  149 (187)
                      ..|+++++++++.++  ++|||||+++||..||||||+|||++            .+......++++++|| ||.+|.||
T Consensus         2 k~Is~~el~~~l~~~~~~~liDvR~~~e~~~ghIpgA~~ip~~------------~l~~~~~~l~~~~~ivv~C~~G~rS   69 (103)
T 3iwh_A            2 KSITTDELKNKLLESKPVQIVDVRTDEETAMGYIPNAKLIPMD------------TIPDNLNSFNKNEIYYIVCAGGVRS   69 (103)
T ss_dssp             CEECHHHHHHGGGSSSCCEEEECSCHHHHTTCBCTTCEECCGG------------GGGGCGGGCCTTSEEEEECSSSSHH
T ss_pred             CCcCHHHHHHHHhCCCCeEEEECCChhHHhcCccCCcccCccc------------chhhhhhhhcCCCeEEEECCCCHHH
Confidence            468999999988654  89999999999999999999999995            3344455688999999 99999999


Q ss_pred             HHHHHHHHHCCCCeeEecCcHhhhhhCCCceec
Q 029837          150 MMAATDLLNAVSTHANYPSKPLTWFLSNQLLTE  182 (187)
Q Consensus       150 ~~aa~~L~~~G~~~v~l~GG~~~W~~~g~p~~~  182 (187)
                      ..++..|+..||+++++.||+.+|..+|+|+++
T Consensus        70 ~~aa~~L~~~G~~~~~l~GG~~~W~~~g~pves  102 (103)
T 3iwh_A           70 AKVVEYLEANGIDAVNVEGGMHAWGDEGLEIKS  102 (103)
T ss_dssp             HHHHHHHHTTTCEEEEETTHHHHHCSSSCBCCC
T ss_pred             HHHHHHHHHcCCCEEEecChHHHHHHCCCccee
Confidence            999999999999888999999999999999975
>1tq1_A AT5G66040, senescence-associated family protein; CESG, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: c.46.1.3 Back     alignment and structure
>3gk5_A Uncharacterized rhodanese-related protein TVG0868615; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.40A {Thermoplasma volcanium GSS1} Back     alignment and structure
>3foj_A Uncharacterized protein; protein SSP1007, structural genomics, PSI-2, protein structure initiative; 1.60A {Staphylococcus saprophyticus subsp} Back     alignment and structure
>1gmx_A GLPE protein; transferase, rhodanese, sulfurtransferase, glycerol metabolism; 1.1A {Escherichia coli} SCOP: c.46.1.3 PDB: 1gn0_A Back     alignment and structure
>3ilm_A ALR3790 protein; rhodanese-like, NSR437H, NESG, structural genomics, protein structure initiative, northeast structural genomics consortium; 2.26A {Nostoc SP} PDB: 2kl3_A Back     alignment and structure
>3hix_A ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q8YQN0_anAsp, NSR437I, NESG, structural genomics, PSI-2, protein structure initiative; 1.92A {Anabaena SP} PDB: 3k9r_A Back     alignment and structure
>3d1p_A Putative thiosulfate sulfurtransferase YOR285W; atomic structure, atomic resolution structure, PSI, MCSG; HET: MSE; 0.98A {Saccharomyces cerevisiae} Back     alignment and structure
>1qxn_A SUD, sulfide dehydrogenase; polysulfide-sulfur transferase, homodimer; NMR {Wolinella succinogenes} SCOP: c.46.1.3 Back     alignment and structure
>2hhg_A Hypothetical protein RPA3614; MCSG, structural genomics, rohopseudom palustris, PSI-2, protein structure initiative; 1.20A {Rhodopseudomonas palustris} Back     alignment and structure
>1wv9_A Rhodanese homolog TT1651; CDC25, phosphatase, sulfurtransferase, structural genomics, NPPSFA; 2.00A {Thermus thermophilus} Back     alignment and structure
>3flh_A Uncharacterized protein LP_1913; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.00A {Lactobacillus plantarum} PDB: 3fnj_A 3i3u_A Back     alignment and structure
>3nhv_A BH2092 protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 2.50A {Bacillus halodurans} PDB: 3o3w_A Back     alignment and structure
>2k0z_A Uncharacterized protein HP1203; A/B domain, structural genomics, unknown function, PSI-2, PR structure initiative; NMR {Helicobacter pylori} Back     alignment and structure
>2fsx_A RV0390, COG0607: rhodanese-related sulfurtransferase; RV0390 BR SAD DATA with FBAR, structural genomics, PSI; 1.80A {Mycobacterium tuberculosis} Back     alignment and structure
>1t3k_A Arath CDC25, dual-specificity tyrosine phosphatase; cell cycle, phosphorylation, plant, hydrolase; NMR {Arabidopsis thaliana} SCOP: c.46.1.1 Back     alignment and structure
>2jtq_A Phage shock protein E; solution structure rhodanese, stress response, transferase; NMR {Escherichia coli} PDB: 2jtr_A 2jts_A Back     alignment and structure
>1vee_A Proline-rich protein family; hypothetical protein, structural genomics, rhodanese domain, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} PDB: 2dcq_A Back     alignment and structure
>1e0c_A Rhodanese, sulfurtransferase; sulfur metabolism, thiosulfate:cyanide sulfurtransferase; 1.8A {Azotobacter vinelandii} SCOP: c.46.1.2 c.46.1.2 PDB: 1h4k_X 1h4m_X Back     alignment and structure
>1urh_A 3-mercaptopyruvate sulfurtransferase; rhodanese; 2.8A {Escherichia coli} SCOP: c.46.1.2 c.46.1.2 Back     alignment and structure
>3g5j_A Putative ATP/GTP binding protein; N-terminal domain of ATP/GTP binding protein, PSI, MCSG, STR genomics, protein structure initiative; HET: PGE; 1.76A {Clostridium difficile} Back     alignment and structure
>3hzu_A Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, infectious disease, transferase structural genomics; 2.10A {Mycobacterium tuberculosis} PDB: 3p3a_A Back     alignment and structure
>1e0c_A Rhodanese, sulfurtransferase; sulfur metabolism, thiosulfate:cyanide sulfurtransferase; 1.8A {Azotobacter vinelandii} SCOP: c.46.1.2 c.46.1.2 PDB: 1h4k_X 1h4m_X Back     alignment and structure
>1urh_A 3-mercaptopyruvate sulfurtransferase; rhodanese; 2.8A {Escherichia coli} SCOP: c.46.1.2 c.46.1.2 Back     alignment and structure
>1uar_A Rhodanese; sulfurtransferase, riken structural genomics/PROT initiative, RSGI, structural genomics, transferase; 1.70A {Thermus thermophilus} SCOP: c.46.1.2 c.46.1.2 Back     alignment and structure
>3hzu_A Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, infectious disease, transferase structural genomics; 2.10A {Mycobacterium tuberculosis} PDB: 3p3a_A Back     alignment and structure
>1rhs_A Sulfur-substituted rhodanese; transferase, sulfurtransferase; 1.36A {Bos taurus} SCOP: c.46.1.2 c.46.1.2 PDB: 1boh_A 1boi_A 1orb_A 2ora_A 1dp2_A* 1rhd_A Back     alignment and structure
>3i2v_A Adenylyltransferase and sulfurtransferase MOCS3; rhodanese, UBA4, structural genomics, ubiquitin biology, structural genomics consortium, SGC; 1.25A {Homo sapiens} Back     alignment and structure
>1c25_A CDC25A; hydrolase, cell cycle phosphatase,dual specificity protein phosphatase, CDK2; 2.30A {Homo sapiens} SCOP: c.46.1.1 Back     alignment and structure
>3aay_A Putative thiosulfate sulfurtransferase; sulfurtranserase, structural genomics, PSI, structure initiative; 1.90A {Mycobacterium tuberculosis} PDB: 3aax_A 3hwi_A Back     alignment and structure
>2a2k_A M-phase inducer phosphatase 2; dual specificity, substrate trapping, active site mutant, hydrolase; 1.52A {Homo sapiens} PDB: 2ifv_A 1ymd_A 1ym9_A 1ymk_A 1yml_A 1ys0_A 1cwt_A 2ifd_A Back     alignment and structure
>1qb0_A Protein (M-phase inducer phosphatase 2 (CDC25B)); hydrolase, cell cycle phosphatase, dual specificity protein phosphatase; 1.91A {Homo sapiens} SCOP: c.46.1.1 PDB: 1cwr_A 1cws_A 2uzq_A Back     alignment and structure
>3olh_A MST, 3-mercaptopyruvate sulfurtransferase; structural genomics, structural genomics consortium, SGC, RH fold; 2.50A {Homo sapiens} Back     alignment and structure
>3aay_A Putative thiosulfate sulfurtransferase; sulfurtranserase, structural genomics, PSI, structure initiative; 1.90A {Mycobacterium tuberculosis} PDB: 3aax_A 3hwi_A Back     alignment and structure
>1rhs_A Sulfur-substituted rhodanese; transferase, sulfurtransferase; 1.36A {Bos taurus} SCOP: c.46.1.2 c.46.1.2 PDB: 1boh_A 1boi_A 1orb_A 2ora_A 1dp2_A* 1rhd_A Back     alignment and structure
>1uar_A Rhodanese; sulfurtransferase, riken structural genomics/PROT initiative, RSGI, structural genomics, transferase; 1.70A {Thermus thermophilus} SCOP: c.46.1.2 c.46.1.2 Back     alignment and structure
>2ouc_A Dual specificity protein phosphatase 10; rhodanese fold, hydrolase; 2.20A {Homo sapiens} Back     alignment and structure
>2j6p_A SB(V)-AS(V) reductase; arsenate reductase, antimonate reductase, CDC25 phosphatase, rhodanese, C-MYC epitope, oxidoreductase; HET: EPE; 2.15A {Leishmania major} Back     alignment and structure
>3olh_A MST, 3-mercaptopyruvate sulfurtransferase; structural genomics, structural genomics consortium, SGC, RH fold; 2.50A {Homo sapiens} Back     alignment and structure
>2vsw_A Dual specificity protein phosphatase 16; hydrolase, dual specificity phosphatase, nucleus, cytoplasm, rhodanese domain, CAsp8; 2.20A {Homo sapiens} PDB: 3tg3_A Back     alignment and structure
>1okg_A Possible 3-mercaptopyruvate sulfurtransferase; rhodanese, prolyl isomerase, catalytic triad, serine protease, leishmania pyruvate; HET: CSR; 2.10A {Leishmania major} SCOP: c.46.1.2 c.46.1.2 d.26.1.3 Back     alignment and structure
>3tp9_A Beta-lactamase and rhodanese domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.70A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>2eg4_A Probable thiosulfate sulfurtransferase; structural genomics, NPPSFA, national Pro protein structural and functional analyses; 1.70A {Thermus thermophilus} PDB: 2eg3_A Back     alignment and structure
>3op3_A M-phase inducer phosphatase 3; structural genomics, structural genomics consortium, SGC, Al alpha sandwich, kinase, cytosol, hydrolase; 2.63A {Homo sapiens} Back     alignment and structure
>4f67_A UPF0176 protein LPG2838; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium; 1.79A {Legionella pneumophila subsp} Back     alignment and structure
>1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 Back     alignment and structure
>1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 Back     alignment and structure
>2wlr_A Putative thiosulfate sulfurtransferase YNJE; rhodanese domains; HET: EPE; 1.45A {Escherichia coli} PDB: 2wlx_A* 3ipo_A* 3ipp_A Back     alignment and structure
>2wlr_A Putative thiosulfate sulfurtransferase YNJE; rhodanese domains; HET: EPE; 1.45A {Escherichia coli} PDB: 2wlx_A* 3ipo_A* 3ipp_A Back     alignment and structure
>3f4a_A Uncharacterized protein YGR203W; protein phosphatase, rhodanese-like family, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.80A {Saccharomyces cerevisiae} PDB: 3fs5_A* Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>1hzm_A Dual specificity protein phosphatase 6; hydrolase; NMR {Homo sapiens} SCOP: c.46.1.1 Back     alignment and structure
>3tg1_B Dual specificity protein phosphatase 10; kinase/rhodanese-like domain, docking interaction, transfera hydrolase complex; 2.71A {Homo sapiens} Back     alignment and structure
>1okg_A Possible 3-mercaptopyruvate sulfurtransferase; rhodanese, prolyl isomerase, catalytic triad, serine protease, leishmania pyruvate; HET: CSR; 2.10A {Leishmania major} SCOP: c.46.1.2 c.46.1.2 d.26.1.3 Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>2eg4_A Probable thiosulfate sulfurtransferase; structural genomics, NPPSFA, national Pro protein structural and functional analyses; 1.70A {Thermus thermophilus} PDB: 2eg3_A Back     alignment and structure
>3utn_X Thiosulfate sulfurtransferase TUM1; rhodanese-like domain; 1.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3tp9_A Beta-lactamase and rhodanese domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.70A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>3r2u_A Metallo-beta-lactamase family protein; structural genomics, for structural genomics of infectious diseases, csgid, HYDR; 2.10A {Staphylococcus aureus} Back     alignment and structure
>1whb_A KIAA0055; deubiqutinating enzyme, UBPY, structural genomics, riken structural genomics/proteomics initiative, RSGI, hydrolase; NMR {Homo sapiens} SCOP: c.46.1.4 Back     alignment and structure
>2gwf_A Ubiquitin carboxyl-terminal hydrolase 8; protein-protein complex, E3 ligase, protein ubiquitination, hydrolase, protease, UBL conjugation pathway; 2.30A {Homo sapiens} SCOP: c.46.1.4 Back     alignment and structure
>3utn_X Thiosulfate sulfurtransferase TUM1; rhodanese-like domain; 1.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3r2u_A Metallo-beta-lactamase family protein; structural genomics, for structural genomics of infectious diseases, csgid, HYDR; 2.10A {Staphylococcus aureus} Back     alignment and structure
>2f46_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 1.41A {Neisseria meningitidis Z2491} Back     alignment and structure
>4erc_A Dual specificity protein phosphatase 23; alpha beta, phosphatase(hydrolase), hydrolase; 1.15A {Homo sapiens} PDB: 2img_A Back     alignment and structure
>1v8c_A MOAD related protein; riken structural genomics/proteomics initiative, RSGI, structural genomics, protein binding; 1.60A {Thermus thermophilus} SCOP: d.15.3.1 d.129.5.1 Back     alignment and structure
>2img_A Dual specificity protein phosphatase 23; DUSP23, VHZ, LDP-3, dual specicity protein phosphatase 23, DUS23_human, malate, structural genomics, PSI; 1.93A {Homo sapiens} Back     alignment and structure
>1xri_A AT1G05000; structural genomics, protein structure initiative, CESG for eukaryotic structural genomics, phosphoprote phosphatase; 3.30A {Arabidopsis thaliana} SCOP: c.45.1.1 PDB: 2q47_A Back     alignment and structure
>2nt2_A Protein phosphatase slingshot homolog 2; alpha/beta hydrolase; 2.10A {Homo sapiens} Back     alignment and structure
>2hcm_A Dual specificity protein phosphatase; structural genomics, PSI, protein structure INI NEW YORK SGX research center for structural genomics; 2.00A {Mus musculus} Back     alignment and structure
>1fpz_A Cyclin-dependent kinase inhibitor 3; alpha-beta sandwich, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.1 PDB: 1fq1_A* Back     alignment and structure
>1yz4_A DUSP15, dual specificity phosphatase-like 15 isoform A; hydrolase; HET: BOG; 2.40A {Homo sapiens} Back     alignment and structure
>2r0b_A Serine/threonine/tyrosine-interacting protein; structural genomics, phosphatase, PSI-2, protein structure initiative; 1.60A {Homo sapiens} Back     alignment and structure
>1wrm_A Dual specificity phosphatase 22; DSP, JNK, hydrolase; HET: MES; 1.50A {Homo sapiens} Back     alignment and structure
>3ezz_A Dual specificity protein phosphatase 4; alpha/beta, hydrolase, nucleus; 2.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1m3g_A Back     alignment and structure
>2esb_A Dual specificity protein phosphatase 18; alpha/beta structure, hydrolase; HET: EPE; 2.00A {Homo sapiens} Back     alignment and structure
>3rgo_A Protein-tyrosine phosphatase mitochondrial 1; phosphatidylglycerol phosphate (PGP) phosphatase, hydrolase; 1.93A {Mus musculus} PDB: 3rgq_A* Back     alignment and structure
>2wgp_A Dual specificity protein phosphatase 14; MKP6, DUSP14, hydrolase, dual specifici phosphatase; 1.88A {Homo sapiens} Back     alignment and structure
>1ywf_A Phosphotyrosine protein phosphatase PTPB; four stranded parallel beta sheet with flanking helices, structural genomics, PSI; 1.71A {Mycobacterium tuberculosis} SCOP: c.45.1.5 PDB: 2oz5_A* Back     alignment and structure
>1zzw_A Dual specificity protein phosphatase 10; MKP, PTP, hydrolase; 1.60A {Homo sapiens} Back     alignment and structure
>3f81_A Dual specificity protein phosphatase 3; hydrolase, protein dual-specificity phosphatase, inhibitor; HET: STT; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1vhr_A* 1j4x_A* Back     alignment and structure
>2e0t_A Dual specificity phosphatase 26; conserved hypothetical protein, structural genomics, NPPSFA, project on protein structural and functional analyses; 1.67A {Homo sapiens} Back     alignment and structure
>2i6j_A Ssoptp, sulfolobus solfataricus protein tyrosine phosphatase; PTP domain, hydrolase; 1.66A {Sulfolobus solfataricus} PDB: 2i6i_A 2i6m_A 3ro1_A* 2i6o_A* 2dxp_A* 2i6p_A* Back     alignment and structure
>2g6z_A Dual specificity protein phosphatase 5; alpha/beta, hydrolase; 2.70A {Homo sapiens} Back     alignment and structure
>2pq5_A Dual specificity protein phosphatase 13; hydrolase, dual specificity phosphatase, DUSP13, testis and skeletal muscle specific DSP; 2.30A {Homo sapiens} PDB: 2gwo_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 187
d1tq1a_119 c.46.1.3 (A:) Thiosulfate sulfurtransferase/Senesc 1e-21
d1c25a_161 c.46.1.1 (A:) CDC25a {Human (Homo sapiens) [TaxId: 8e-07
d1gmxa_108 c.46.1.3 (A:) Sulfurtransferase GlpE {Escherichia 2e-05
d1ymka1174 c.46.1.1 (A:377-550) CDC25b {Human (Homo sapiens) 2e-05
d1hzma_154 c.46.1.1 (A:) Erk2 binding domain of Mapk phosphat 2e-04
d2gwfa1135 c.46.1.4 (A:181-315) Ubiquitin carboxyl-terminal h 3e-04
d1yt8a4130 c.46.1.2 (A:243-372) Thiosulfate sulfurtransferase 0.002
d1yt8a1136 c.46.1.2 (A:107-242) Thiosulfate sulfurtransferase 0.003
>d1tq1a_ c.46.1.3 (A:) Thiosulfate sulfurtransferase/Senescence-associated protein {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 119 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Rhodanese/Cell cycle control phosphatase
superfamily: Rhodanese/Cell cycle control phosphatase
family: Single-domain sulfurtransferase
domain: Thiosulfate sulfurtransferase/Senescence-associated protein
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

 Score = 83.4 bits (205), Expect = 1e-21
 Identities = 64/99 (64%), Positives = 73/99 (73%), Gaps = 1/99 (1%)

Query: 67  EAVGVPTSVPVRVAHELLQAGHRYLDVRTPEEFSAGHATGAINVPYMYRVGSGMTKNLKF 126
           E   VP+SV V VAH+LL AGHRYLDVRTPEEFS GHA GAINVPYM R  SGM+KN  F
Sbjct: 2   EESRVPSSVSVTVAHDLLLAGHRYLDVRTPEEFSQGHACGAINVPYMNRGASGMSKNTDF 61

Query: 127 VEEVSTRFRKHDEIIG-CQSGKRSMMAATDLLNAVSTHA 164
           +E+VS+ F + D II  CQSG RS+ A TDLL+A  T  
Sbjct: 62  LEQVSSHFGQSDNIIVGCQSGGRSIKATTDLLHAGFTGV 100
>d1c25a_ c.46.1.1 (A:) CDC25a {Human (Homo sapiens) [TaxId: 9606]} Length = 161 Back     information, alignment and structure
>d1gmxa_ c.46.1.3 (A:) Sulfurtransferase GlpE {Escherichia coli [TaxId: 562]} Length = 108 Back     information, alignment and structure
>d1ymka1 c.46.1.1 (A:377-550) CDC25b {Human (Homo sapiens) [TaxId: 9606]} Length = 174 Back     information, alignment and structure
>d1hzma_ c.46.1.1 (A:) Erk2 binding domain of Mapk phosphatase mkp-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 154 Back     information, alignment and structure
>d2gwfa1 c.46.1.4 (A:181-315) Ubiquitin carboxyl-terminal hydrolase 8, USP8 {Human (Homo sapiens) [TaxId: 9606]} Length = 135 Back     information, alignment and structure
>d1yt8a4 c.46.1.2 (A:243-372) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Length = 130 Back     information, alignment and structure
>d1yt8a1 c.46.1.2 (A:107-242) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Length = 136 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query187
d1tq1a_119 Thiosulfate sulfurtransferase/Senescence-associate 99.95
d1yt8a1136 Thiosulfate sulfurtransferase PA2603 {Pseudomonas 99.93
d1gmxa_108 Sulfurtransferase GlpE {Escherichia coli [TaxId: 5 99.92
d1yt8a3157 Thiosulfate sulfurtransferase PA2603 {Pseudomonas 99.91
d1e0ca2136 Sulfurtransferase {Azotobacter vinelandii [TaxId: 99.91
d1qxna_137 Polysulfide-sulfur transferase (sulfide dehydrogen 99.9
d1yt8a2101 Thiosulfate sulfurtransferase PA2603 {Pseudomonas 99.9
d1urha1147 3-mercaptopyruvate sulfurtransferase {Escherichia 99.9
d1e0ca1135 Sulfurtransferase {Azotobacter vinelandii [TaxId: 99.9
d1rhsa2144 Rhodanese {Cow (Bos taurus) [TaxId: 9913]} 99.89
d1uara1143 Sulfurtransferase {Thermus thermophilus [TaxId: 27 99.89
d1rhsa1149 Rhodanese {Cow (Bos taurus) [TaxId: 9913]} 99.89
d1uara2141 Sulfurtransferase {Thermus thermophilus [TaxId: 27 99.89
d1yt8a4130 Thiosulfate sulfurtransferase PA2603 {Pseudomonas 99.88
d1urha2120 3-mercaptopyruvate sulfurtransferase {Escherichia 99.87
d1t3ka_132 Dual specificity phosphatase Cdc25 {Thale cress (A 99.85
d1okga2139 3-mercaptopyruvate sulfurtransferase {Leishmania m 99.84
d1okga1156 3-mercaptopyruvate sulfurtransferase {Leishmania m 99.84
d1c25a_161 CDC25a {Human (Homo sapiens) [TaxId: 9606]} 99.77
d1ymka1174 CDC25b {Human (Homo sapiens) [TaxId: 9606]} 99.7
d2gwfa1135 Ubiquitin carboxyl-terminal hydrolase 8, USP8 {Hum 99.63
d1hzma_154 Erk2 binding domain of Mapk phosphatase mkp-3 {Hum 99.55
d1xria_151 Putative phosphatase At1g05000 {Thale cress (Arabi 94.17
d1c4oa2174 Nucleotide excision repair enzyme UvrB {Thermus th 90.82
d1fpza_176 Kinase associated phosphatase (kap) {Human (Homo s 85.66
d1ywfa1 272 Phosphotyrosine protein phosphatase PtpB {Mycobact 83.54
d1t5ia_168 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 83.04
d1t5la2181 Nucleotide excision repair enzyme UvrB {Bacillus c 82.82
d1fuka_162 Initiation factor 4a {Baker's yeast (Saccharomyces 82.2
d1jr6a_138 HCV helicase domain {Human hepatitis C virus (HCV) 82.13
d1s2ma2171 Putative ATP-dependent RNA helicase DHH1 {Baker's 80.27
>d1tq1a_ c.46.1.3 (A:) Thiosulfate sulfurtransferase/Senescence-associated protein {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Rhodanese/Cell cycle control phosphatase
superfamily: Rhodanese/Cell cycle control phosphatase
family: Single-domain sulfurtransferase
domain: Thiosulfate sulfurtransferase/Senescence-associated protein
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

Probab=99.95  E-value=4.6e-29  Score=173.97  Aligned_cols=113  Identities=58%  Similarity=0.836  Sum_probs=101.3

Q ss_pred             cCCCcccCHHHHHHHHHCCCEEEecCChhhhccccCCCcEEeCcccccCCCCCCCHHHHHHHhhcCCCCCcEE-EcCCCh
Q 029837           69 VGVPTSVPVRVAHELLQAGHRYLDVRTPEEFSAGHATGAINVPYMYRVGSGMTKNLKFVEEVSTRFRKHDEII-GCQSGK  147 (187)
Q Consensus        69 ~~~~~~v~~~~~~~~l~~~~~iIDvR~~~e~~~ghIpgAi~ip~~~~~~~~~~~~~~~~~~~~~~l~~~~~iv-~C~~g~  147 (187)
                      ...+..+++.++.++++++.+|||||++.||..||||||+|+|+.+.........++++......++++++|| ||++|.
T Consensus         4 ~~~p~~i~~~~a~~l~~~g~~liDvR~~~e~~~ghi~ga~~ip~~~~~~~~~~~~~~~~~~~~~~~~~~~~iv~~C~~G~   83 (119)
T d1tq1a_           4 SRVPSSVSVTVAHDLLLAGHRYLDVRTPEEFSQGHACGAINVPYMNRGASGMSKNTDFLEQVSSHFGQSDNIIVGCQSGG   83 (119)
T ss_dssp             SCCCEEEEHHHHHHHHHHTCCEEEESCHHHHHHCCBTTBEECCSCCCSTTTCCCTTTHHHHHTTTCCTTSSEEEEESSCS
T ss_pred             ccCCCccCHHHHHHHHHCcCEEEECCCHHHHHcCCCCCccchhhcccccccccccHHHHHHHHHhcCCCcEEEEEcCCcC
Confidence            4456789999999999989999999999999999999999999875555556667778888877789999999 999999


Q ss_pred             hHHHHHHHHHHCCCCee-EecCcHhhhhhCCCcee
Q 029837          148 RSMMAATDLLNAVSTHA-NYPSKPLTWFLSNQLLT  181 (187)
Q Consensus       148 rs~~aa~~L~~~G~~~v-~l~GG~~~W~~~g~p~~  181 (187)
                      ||..++..|.++||++| +|.||+.+|.++|+|++
T Consensus        84 rs~~a~~~L~~~G~~nv~~l~GG~~~W~~~g~P~e  118 (119)
T d1tq1a_          84 RSIKATTDLLHAGFTGVKDIVGGYSAWAKNGLPTK  118 (119)
T ss_dssp             HHHHHHHHHHHHHCCSEEEEECCHHHHHHHTCCCC
T ss_pred             cHHHHHHHHHhcccCCeEEecChHHHHHHCCCCcc
Confidence            99999999999999999 78999999999999986
>d1yt8a1 c.46.1.2 (A:107-242) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1gmxa_ c.46.1.3 (A:) Sulfurtransferase GlpE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yt8a3 c.46.1.2 (A:373-529) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1e0ca2 c.46.1.2 (A:136-271) Sulfurtransferase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1qxna_ c.46.1.3 (A:) Polysulfide-sulfur transferase (sulfide dehydrogenase, Sud) {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1yt8a2 c.46.1.2 (A:6-106) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1urha1 c.46.1.2 (A:2-148) 3-mercaptopyruvate sulfurtransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e0ca1 c.46.1.2 (A:1-135) Sulfurtransferase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1rhsa2 c.46.1.2 (A:150-293) Rhodanese {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1uara1 c.46.1.2 (A:2-144) Sulfurtransferase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1rhsa1 c.46.1.2 (A:1-149) Rhodanese {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1uara2 c.46.1.2 (A:145-285) Sulfurtransferase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1yt8a4 c.46.1.2 (A:243-372) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1urha2 c.46.1.2 (A:149-268) 3-mercaptopyruvate sulfurtransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t3ka_ c.46.1.1 (A:) Dual specificity phosphatase Cdc25 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1okga2 c.46.1.2 (A:163-301) 3-mercaptopyruvate sulfurtransferase {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1okga1 c.46.1.2 (A:7-162) 3-mercaptopyruvate sulfurtransferase {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1c25a_ c.46.1.1 (A:) CDC25a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ymka1 c.46.1.1 (A:377-550) CDC25b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gwfa1 c.46.1.4 (A:181-315) Ubiquitin carboxyl-terminal hydrolase 8, USP8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hzma_ c.46.1.1 (A:) Erk2 binding domain of Mapk phosphatase mkp-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xria_ c.45.1.1 (A:) Putative phosphatase At1g05000 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1fpza_ c.45.1.1 (A:) Kinase associated phosphatase (kap) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ywfa1 c.45.1.5 (A:4-275) Phosphotyrosine protein phosphatase PtpB {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure