Citrus Sinensis ID: 029865

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180------
MATSLNFSANQVSTQPPELCLRRSSFKSKLSSPRRPKFVSFAVNSTEPSSPEPEKPEIELEFIAPRAGDDGSYPVERAKAISGEKLLRNIMLDNKIELYATYGKVMNCGGGGSCGTCIVEIIDGKDLLNERTNTELRYLKKKPESWRLACQTIVGNKENSGKCRIKYLKVEALCSLYRAVGYLGGH
cccccccccccccccccccccccccccccccccccccEEEEEEccccccccccccccEEEEEEcccccccccccccEEEEcccHHHHHHHHHHccccccccccccccccccEEEcccEEEEcccccccccccHHHHHHccccccccEEEcEEEEccccccEEEEEEEEcHHHHHcccccccccccc
cccEEEcccHHcccccccHHcccccccccccccccccEEEEEEccccccccccccccEEEEEEcccccccccccccEEEccccHHHHHHHHHHccccEEcccccEEcccccccccEEEEEEEccccccccccHHHHHHHcccccccEEEEEEEEcccccccEEEEEEEEcHcHHHHHHHHcccccc
matslnfsanqvstqppelclrrssfksklssprrpkfvsfavnstepsspepekpeielefiapragddgsypvERAKAISGEKLLRNIMLDNKIELYATYGkvmncggggscgTCIVEIIDGKDLLNERTNTELRYlkkkpeswRLACQTIVGnkensgkcrikYLKVEALCSLYRAVGYLGGH
matslnfsanqvstqppelclrrssfksklssprrpkfvsfavnstepsspepekpeIELEFIApragddgsyPVERAKAisgekllrNIMLDNKIELYATYGKVMNCGGGGSCGTCIVEIIDGKDLLNERTNTELrylkkkpeswrLACQtivgnkensgkcrikYLKVEALCSLYRAVGYLGGH
MATSLNFSANQVSTQPPELClrrssfksklssprrpkfVSFAVNstepsspepekpeieleFIAPRAGDDGSYPVERAKAISGEKLLRNIMLDNKIELYATYGKVMNCGGGGSCGTCIVEIIDGKDLLNERTNTELRYLKKKPESWRLACQTIVGNKENSGKCRIKYLKVEALCSLYRAVGYLGGH
******************************************************************************KAISGEKLLRNIMLDNKIELYATYGKVMNCGGGGSCGTCIVEIIDGKDLLNERTNTELRYLKKKPESWRLACQTIVGNKENSGKCRIKYLKVEALCSLYRAVGYL***
************************************************************EFIAPRAGDDGSYPVERAKAISGEKLLRNIMLDNKIELYATYGKVMNCGGGGSCGTCIVEIIDGKDL*N**********KKKPESWRLACQTIVGNKENSGKCRIKYLKVEALCSLYRAVGYL***
*****************ELCLRRSS**********PKFVSFA**************EIELEFIAPRAGDDGSYPVERAKAISGEKLLRNIMLDNKIELYATYGKVMNCGGGGSCGTCIVEIIDGKDLLNERTNTELRYLKKKPESWRLACQTIVGNKENSGKCRIKYLKVEALCSLYRAVGYLGGH
***********V**********************RPKFVSFAVNSTEPSSPEPEKPEIELEFIAPRAGDDGSYPVERAKAISGEKLLRNIMLDNKIELYATYGKVMNCGGGGSCGTCIVEIIDGKDLLNERTNTELRYLKKKPESWRLACQTIVGNKENSGKCRIKYLKVEALCSLYRAVGYLGG*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MATSLNFSANQVSTQPPELCLRRSSFKSKLSSPRRPKFVSFAVNSTEPSSPEPEKPEIELEFIAPRAGDDGSYPVERAKAISGEKLLRNIMLDNKIELYATYGKVMNCGGGGSCGTCIVEIIDGKDLLNERTNTELRYLKKKPESWRLACQTIVGNKENSGKCRIKYLKVEALCSLYRAVGYLGGH
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query186
356563826161 PREDICTED: uncharacterized protein LOC10 0.698 0.807 0.792 4e-54
225430081172 PREDICTED: uncharacterized protein LOC10 0.881 0.953 0.708 3e-51
296081922137 unnamed protein product [Vitis vinifera] 0.698 0.948 0.823 1e-47
449441962176 PREDICTED: uncharacterized protein LOC10 0.865 0.914 0.668 2e-46
255551138171 electron carrier, putative [Ricinus comm 0.876 0.953 0.660 5e-44
224092396178 predicted protein [Populus trichocarpa] 0.720 0.752 0.741 5e-41
242091313185 hypothetical protein SORBIDRAFT_09g02789 0.704 0.708 0.715 3e-40
449441964158 PREDICTED: uncharacterized protein LOC10 0.768 0.905 0.571 8e-40
226503349182 electron carrier/ electron transporter/ 0.725 0.741 0.680 6e-39
297802756175 hypothetical protein ARALYDRAFT_913185 [ 0.650 0.691 0.752 7e-39
>gi|356563826|ref|XP_003550159.1| PREDICTED: uncharacterized protein LOC100807125 [Glycine max] Back     alignment and taxonomy information
 Score =  216 bits (549), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 107/135 (79%), Positives = 115/135 (85%), Gaps = 5/135 (3%)

Query: 34  RRPKFVSFAVNSTEPSSPEPEKPEIELEFIAPRAGDDGSYPVERAKAISGEKLLRNIMLD 93
           R+P  V FA  S+ P SP    PEIELEFI P+ G DGSYPVER KAISGEKLLRNIMLD
Sbjct: 27  RQPNTVIFAAASS-PESP----PEIELEFIGPKPGSDGSYPVERVKAISGEKLLRNIMLD 81

Query: 94  NKIELYATYGKVMNCGGGGSCGTCIVEIIDGKDLLNERTNTELRYLKKKPESWRLACQTI 153
           NKIELYATYGK+MNC GGGSCGTCIVEII+GKDLLNERTNTELRYL KKPESWRLACQTI
Sbjct: 82  NKIELYATYGKLMNCAGGGSCGTCIVEIIEGKDLLNERTNTELRYLSKKPESWRLACQTI 141

Query: 154 VGNKENSGKCRIKYL 168
           VGNKENSGK  ++ +
Sbjct: 142 VGNKENSGKVAVQRI 156

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225430081|ref|XP_002281853.1| PREDICTED: uncharacterized protein LOC100250753 [Vitis vinifera] Back     alignment and taxonomy information
>gi|296081922|emb|CBI20927.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449441962|ref|XP_004138751.1| PREDICTED: uncharacterized protein LOC101202753 isoform 1 [Cucumis sativus] Back     alignment and taxonomy information
>gi|255551138|ref|XP_002516617.1| electron carrier, putative [Ricinus communis] gi|223544437|gb|EEF45958.1| electron carrier, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224092396|ref|XP_002309590.1| predicted protein [Populus trichocarpa] gi|222855566|gb|EEE93113.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|242091313|ref|XP_002441489.1| hypothetical protein SORBIDRAFT_09g027890 [Sorghum bicolor] gi|241946774|gb|EES19919.1| hypothetical protein SORBIDRAFT_09g027890 [Sorghum bicolor] Back     alignment and taxonomy information
>gi|449441964|ref|XP_004138752.1| PREDICTED: uncharacterized protein LOC101202753 isoform 2 [Cucumis sativus] Back     alignment and taxonomy information
>gi|226503349|ref|NP_001147484.1| electron carrier/ electron transporter/ iron ion binding protein [Zea mays] gi|195611680|gb|ACG27670.1| electron carrier/ electron transporter/ iron ion binding protein [Zea mays] Back     alignment and taxonomy information
>gi|297802756|ref|XP_002869262.1| hypothetical protein ARALYDRAFT_913185 [Arabidopsis lyrata subsp. lyrata] gi|297315098|gb|EFH45521.1| hypothetical protein ARALYDRAFT_913185 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query186
TAIR|locus:2125637180 AT4G32590 [Arabidopsis thalian 0.543 0.561 0.841 1.5e-44
TAIR|locus:2094882204 PnsB3 "Photosynthetic NDH subc 0.526 0.480 0.53 1e-22
TIGR_CMR|CPS_1137112 CPS_1137 "ferredoxin, 2Fe-2S" 0.387 0.642 0.369 0.00045
UNIPROTKB|Q4K6U3113 fdx "Ferredoxin, 2Fe-2S type, 0.317 0.522 0.385 0.00076
TAIR|locus:2125637 AT4G32590 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 469 (170.2 bits), Expect = 1.5e-44, P = 1.5e-44
 Identities = 85/101 (84%), Positives = 94/101 (93%)

Query:    62 FIAPRAGDDGSYPVERAKAISGEKLLRNIMLDNKIELYATYGKVMNCGGGGSCGTCIVEI 121
             F  P+ G DGSYPV++AKA+SG+KLLR+IM DNKIELYA YGKVMNCGGGGSCGTCIVEI
Sbjct:    62 FFGPKPGSDGSYPVDKAKAVSGDKLLRSIMQDNKIELYAAYGKVMNCGGGGSCGTCIVEI 121

Query:   122 IDGKDLLNERTNTELRYLKKKPESWRLACQTIVGNKENSGK 162
             +DG+DLLNERT+TE RYLKKKPESWRLACQTIVGNKENSGK
Sbjct:   122 LDGRDLLNERTDTENRYLKKKPESWRLACQTIVGNKENSGK 162
GO:0009055 "electron carrier activity" evidence=IEA;ISS
GO:0051536 "iron-sulfur cluster binding" evidence=IEA
GO:0009688 "abscisic acid biosynthetic process" evidence=RCA
TAIR|locus:2094882 PnsB3 "Photosynthetic NDH subcomplex B 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TIGR_CMR|CPS_1137 CPS_1137 "ferredoxin, 2Fe-2S" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
UNIPROTKB|Q4K6U3 fdx "Ferredoxin, 2Fe-2S type, ISC system" [Pseudomonas protegens Pf-5 (taxid:220664)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query186
COG0633102 COG0633, Fdx, Ferredoxin [Energy production and co 1e-08
PRK05464 409 PRK05464, PRK05464, Na(+)-translocating NADH-quino 4e-08
COG2871 410 COG2871, NqrF, Na+-transporting NADH:ubiquinone ox 1e-07
TIGR01941 405 TIGR01941, nqrF, NADH:ubiquinone oxidoreductase, N 2e-07
cd0020784 cd00207, fer2, 2Fe-2S iron-sulfur cluster binding 2e-05
TIGR02007110 TIGR02007, fdx_isc, ferredoxin, 2Fe-2S type, ISC s 3e-05
pfam0011177 pfam00111, Fer2, 2Fe-2S iron-sulfur cluster bindin 5e-05
COG3894 614 COG3894, COG3894, Uncharacterized metal-binding pr 6e-04
>gnl|CDD|223706 COG0633, Fdx, Ferredoxin [Energy production and conversion] Back     alignment and domain information 
 Score = 50.1 bits (120), Expect = 1e-08
 Identities = 23/75 (30%), Positives = 34/75 (45%), Gaps = 10/75 (13%)

Query: 82  SGEKLLRNIMLDNKIELYATYGKVMNCGGGGSCGTCIVEIIDGKDLLNERTNTELRYLK- 140
            GE LL      N I +         C GG +CGTC V++++G D ++    +E   L  
Sbjct: 21  EGETLLEA-AERNGIPI------EYACRGG-ACGTCRVKVLEGFDEVSPPEESEEDLLDA 72

Query: 141 -KKPESWRLACQTIV 154
                + RL+CQ  V
Sbjct: 73  AGLEGNSRLSCQCRV 87

Length = 102
>gnl|CDD|235481 PRK05464, PRK05464, Na(+)-translocating NADH-quinone reductase subunit F; Provisional Back     alignment and domain information
>gnl|CDD|225426 COG2871, NqrF, Na+-transporting NADH:ubiquinone oxidoreductase, subunit NqrF [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|130996 TIGR01941, nqrF, NADH:ubiquinone oxidoreductase, Na(+)-translocating, F subunit Back     alignment and domain information
>gnl|CDD|238126 cd00207, fer2, 2Fe-2S iron-sulfur cluster binding domain Back     alignment and domain information
>gnl|CDD|131062 TIGR02007, fdx_isc, ferredoxin, 2Fe-2S type, ISC system Back     alignment and domain information
>gnl|CDD|215725 pfam00111, Fer2, 2Fe-2S iron-sulfur cluster binding domain Back     alignment and domain information
>gnl|CDD|226410 COG3894, COG3894, Uncharacterized metal-binding protein [General function prediction only] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 186
KOG3309159 consensus Ferredoxin [Energy production and conver 99.86
PLN02593117 adrenodoxin-like ferredoxin protein 99.86
PTZ00490143 Ferredoxin superfamily; Provisional 99.84
TIGR02007110 fdx_isc ferredoxin, 2Fe-2S type, ISC system. This 99.78
COG0633102 Fdx Ferredoxin [Energy production and conversion] 99.73
CHL0013499 petF ferredoxin; Validated 99.64
TIGR0200897 fdx_plant ferredoxin [2Fe-2S]. This model represen 99.64
PLN03136148 Ferredoxin; Provisional 99.62
PRK1071384 2Fe-2S ferredoxin YfaE; Provisional 99.61
PTZ00038191 ferredoxin; Provisional 99.58
TIGR01941 405 nqrF NADH:ubiquinone oxidoreductase, Na(+)-translo 99.57
PRK05464 409 Na(+)-translocating NADH-quinone reductase subunit 99.55
cd0020784 fer2 2Fe-2S iron-sulfur cluster binding domain. Ir 99.48
PRK11872 340 antC anthranilate dioxygenase reductase; Provision 99.45
PRK07609 339 CDP-6-deoxy-delta-3,4-glucoseen reductase; Validat 99.43
COG2871 410 NqrF Na+-transporting NADH:ubiquinone oxidoreducta 99.43
COG3894 614 Uncharacterized metal-binding protein [General fun 99.4
PRK05713 312 hypothetical protein; Provisional 99.4
PF0011178 Fer2: 2Fe-2S iron-sulfur cluster binding domain; I 99.39
PRK10684332 HCP oxidoreductase, NADH-dependent; Provisional 99.38
TIGR02160352 PA_CoA_Oxy5 phenylacetate-CoA oxygenase/reductase, 99.32
PF13085110 Fer2_3: 2Fe-2S iron-sulfur cluster binding domain; 98.88
PLN00129 276 succinate dehydrogenase [ubiquinone] iron-sulfur s 98.79
PRK13552 239 frdB fumarate reductase iron-sulfur subunit; Provi 98.67
PRK07569 234 bidirectional hydrogenase complex protein HoxU; Va 98.57
PRK06259 486 succinate dehydrogenase/fumarate reductase iron-su 98.53
COG0479 234 FrdB Succinate dehydrogenase/fumarate reductase, F 98.53
PRK08640 249 sdhB succinate dehydrogenase iron-sulfur subunit; 98.53
PRK12385 244 fumarate reductase iron-sulfur subunit; Provisiona 98.52
PRK12575 235 succinate dehydrogenase iron-sulfur subunit; Provi 98.5
PF1351082 Fer2_4: 2Fe-2S iron-sulfur cluster binding domain; 98.45
PRK12577 329 succinate dehydrogenase iron-sulfur subunit; Provi 98.42
PRK12576 279 succinate dehydrogenase iron-sulfur subunit; Provi 98.38
PRK05950 232 sdhB succinate dehydrogenase iron-sulfur subunit; 98.31
PRK12386 251 fumarate reductase iron-sulfur subunit; Provisiona 98.26
TIGR00384 220 dhsB succinate dehydrogenase and fumarate reductas 98.23
PRK07570 250 succinate dehydrogenase/fumarate reductase iron-su 98.14
PRK08166 847 NADH dehydrogenase subunit G; Validated 97.97
PRK12814 652 putative NADPH-dependent glutamate synthase small 97.52
PTZ00305 297 NADH:ubiquinone oxidoreductase; Provisional 97.27
PRK08493 819 NADH dehydrogenase subunit G; Validated 97.15
PRK07860 797 NADH dehydrogenase subunit G; Validated 97.0
PRK11433217 aldehyde oxidoreductase 2Fe-2S subunit; Provisiona 96.96
TIGR01973 603 NuoG NADH-quinone oxidoreductase, chain G. This mo 96.94
PRK09130 687 NADH dehydrogenase subunit G; Validated 96.71
PRK09129 776 NADH dehydrogenase subunit G; Validated 96.31
COG1034 693 NuoG NADH dehydrogenase/NADH:ubiquinone oxidoreduc 95.98
PRK09908159 xanthine dehydrogenase subunit XdhC; Provisional 95.9
TIGR03193148 4hydroxCoAred 4-hydroxybenzoyl-CoA reductase, gamm 95.29
TIGR03198151 pucE xanthine dehydrogenase E subunit. This gene h 95.18
KOG3049 288 consensus Succinate dehydrogenase, Fe-S protein su 95.11
COG3383 978 Uncharacterized anaerobic dehydrogenase [General f 93.67
COG2080156 CoxS Aerobic-type carbon monoxide dehydrogenase, s 93.27
PRK09800 956 putative hypoxanthine oxidase; Provisional 92.61
TIGR01372 985 soxA sarcosine oxidase, alpha subunit family, hete 91.77
cd06218246 DHOD_e_trans FAD/NAD binding domain in the electro 91.14
cd06219248 DHOD_e_trans_like1 FAD/NAD binding domain in the e 89.94
PRK06222281 ferredoxin-NADP(+) reductase subunit alpha; Review 89.8
TIGR02963 467 xanthine_xdhA xanthine dehydrogenase, small subuni 89.42
cd06221253 sulfite_reductase_like Anaerobic sulfite reductase 89.26
TIGR03313 951 Se_sel_red_Mo probable selenate reductase, molybde 88.82
PRK08345289 cytochrome-c3 hydrogenase subunit gamma; Provision 88.72
PRK00054250 dihydroorotate dehydrogenase electron transfer sub 88.38
PRK05802320 hypothetical protein; Provisional 87.82
cd06220233 DHOD_e_trans_like2 FAD/NAD binding domain in the e 86.95
TIGR02969 1330 mam_aldehyde_ox aldehyde oxidase. Members of this 86.61
TIGR03311 848 Se_dep_Molyb_1 selenium-dependent molybdenum hydro 85.85
PRK08221263 anaerobic sulfite reductase subunit B; Provisional 84.62
TIGR02911261 sulfite_red_B sulfite reductase, subunit B. Member 84.34
KOG2282 708 consensus NADH-ubiquinone oxidoreductase, NDUFS1/7 83.83
cd06192243 DHOD_e_trans_like FAD/NAD binding domain (electron 81.07
>KOG3309 consensus Ferredoxin [Energy production and conversion] Back     alignment and domain information 
Probab=99.86  E-value=7.6e-22  Score=158.46  Aligned_cols=132  Identities=21%  Similarity=0.285  Sum_probs=103.9

Q ss_pred             cccccccCCCccceeEEeecCCCCCCCCCCCCcEEEEEecCCCCCCCCcceEEEEecCCchHHHHHHHHCCCCccccCCc
Q 029865           25 SFKSKLSSPRRPKFVSFAVNSTEPSSPEPEKPEIELEFIAPRAGDDGSYPVERAKAISGEKLLRNIMLDNKIELYATYGK  104 (186)
Q Consensus        25 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~V~v~f~~~~~~~d~~~~v~~v~v~~G~tLLr~al~~~GI~l~~~~~~  104 (186)
                      .+|-..+.+.+.|..+.+.....+. .+.+...|+|+|+++++.      ...+++..|+||| +++.++||+++++   
T Consensus        12 ~~~~a~~~~~~~f~~~~t~~~~~~~-~~~~~e~i~Itfv~~dG~------~~~i~g~vGdtlL-d~ah~n~idleGA---   80 (159)
T KOG3309|consen   12 ISRLAPFTRNHIFRTSSTSEFSPSK-GPRKVEDIKITFVDPDGE------EIKIKGKVGDTLL-DAAHENNLDLEGA---   80 (159)
T ss_pred             hhhccccccceeeccCccccccccc-CCCCCceEEEEEECCCCC------EEEeeeecchHHH-HHHHHcCCCcccc---
Confidence            3444555666666654322211111 233445699999998762      3688999999999 9999999999985   


Q ss_pred             ccCCCCceeecCCEEEEecCc-ccCCCCChHHHhccCCC---CCCeEEeeEeEeeeccCCCceEEEEcchHhH
Q 029865          105 VMNCGGGGSCGTCIVEIIDGK-DLLNERTNTELRYLKKK---PESWRLACQTIVGNKENSGKCRIKYLKVEAL  173 (186)
Q Consensus       105 ~~~CgG~G~CGTC~V~V~~G~-~~l~~~t~~E~~~L~~~---~~g~RLACQ~~v~~~~~~gdv~V~~lP~~~~  173 (186)
                         |+|..+|+||||+|.+.. +.|++|+++|+++|+.+   .+++||+||+..+ ++++|..  +.+|+...
T Consensus        81 ---CEgslACSTCHViv~~~~yekl~ep~DeE~DmLDlA~gLt~tSRLGCQI~l~-keldG~~--v~vP~atr  147 (159)
T KOG3309|consen   81 ---CEGSLACSTCHVIVDEEYYEKLPEPEDEENDMLDLAFGLTETSRLGCQIVLT-KELDGMR--VAVPEATR  147 (159)
T ss_pred             ---ccccccccceEEEEcHHHHhcCCCCcchHHHHHHhhhccccccccceEEEec-cccCCcE--EECccccc
Confidence               999999999999999887 68899999999999986   7899999999999 8999985  58997653

>PLN02593 adrenodoxin-like ferredoxin protein Back     alignment and domain information
>PTZ00490 Ferredoxin superfamily; Provisional Back     alignment and domain information
>TIGR02007 fdx_isc ferredoxin, 2Fe-2S type, ISC system Back     alignment and domain information
>COG0633 Fdx Ferredoxin [Energy production and conversion] Back     alignment and domain information
>CHL00134 petF ferredoxin; Validated Back     alignment and domain information
>TIGR02008 fdx_plant ferredoxin [2Fe-2S] Back     alignment and domain information
>PLN03136 Ferredoxin; Provisional Back     alignment and domain information
>PRK10713 2Fe-2S ferredoxin YfaE; Provisional Back     alignment and domain information
>PTZ00038 ferredoxin; Provisional Back     alignment and domain information
>TIGR01941 nqrF NADH:ubiquinone oxidoreductase, Na(+)-translocating, F subunit Back     alignment and domain information
>PRK05464 Na(+)-translocating NADH-quinone reductase subunit F; Provisional Back     alignment and domain information
>cd00207 fer2 2Fe-2S iron-sulfur cluster binding domain Back     alignment and domain information
>PRK11872 antC anthranilate dioxygenase reductase; Provisional Back     alignment and domain information
>PRK07609 CDP-6-deoxy-delta-3,4-glucoseen reductase; Validated Back     alignment and domain information
>COG2871 NqrF Na+-transporting NADH:ubiquinone oxidoreductase, subunit NqrF [Energy production and conversion] Back     alignment and domain information
>COG3894 Uncharacterized metal-binding protein [General function prediction only] Back     alignment and domain information
>PRK05713 hypothetical protein; Provisional Back     alignment and domain information
>PF00111 Fer2: 2Fe-2S iron-sulfur cluster binding domain; InterPro: IPR001041 The ferredoxin protein family are electron carrier proteins with an iron-sulphur cofactor that act in a wide variety of metabolic reactions Back     alignment and domain information
>PRK10684 HCP oxidoreductase, NADH-dependent; Provisional Back     alignment and domain information
>TIGR02160 PA_CoA_Oxy5 phenylacetate-CoA oxygenase/reductase, PaaK subunit Back     alignment and domain information
>PF13085 Fer2_3: 2Fe-2S iron-sulfur cluster binding domain; PDB: 3P4Q_N 1KFY_N 3CIR_N 3P4R_B 2B76_N 1KF6_B 3P4P_N 3P4S_B 1L0V_B 1ZOY_B Back     alignment and domain information
>PLN00129 succinate dehydrogenase [ubiquinone] iron-sulfur subunit Back     alignment and domain information
>PRK13552 frdB fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>PRK07569 bidirectional hydrogenase complex protein HoxU; Validated Back     alignment and domain information
>PRK06259 succinate dehydrogenase/fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>COG0479 FrdB Succinate dehydrogenase/fumarate reductase, Fe-S protein subunit [Energy production and conversion] Back     alignment and domain information
>PRK08640 sdhB succinate dehydrogenase iron-sulfur subunit; Reviewed Back     alignment and domain information
>PRK12385 fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>PRK12575 succinate dehydrogenase iron-sulfur subunit; Provisional Back     alignment and domain information
>PF13510 Fer2_4: 2Fe-2S iron-sulfur cluster binding domain; PDB: 1Y56_A 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A Back     alignment and domain information
>PRK12577 succinate dehydrogenase iron-sulfur subunit; Provisional Back     alignment and domain information
>PRK12576 succinate dehydrogenase iron-sulfur subunit; Provisional Back     alignment and domain information
>PRK05950 sdhB succinate dehydrogenase iron-sulfur subunit; Reviewed Back     alignment and domain information
>PRK12386 fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>TIGR00384 dhsB succinate dehydrogenase and fumarate reductase iron-sulfur protein Back     alignment and domain information
>PRK07570 succinate dehydrogenase/fumarate reductase iron-sulfur subunit; Validated Back     alignment and domain information
>PRK08166 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>PTZ00305 NADH:ubiquinone oxidoreductase; Provisional Back     alignment and domain information
>PRK08493 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>PRK07860 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>PRK11433 aldehyde oxidoreductase 2Fe-2S subunit; Provisional Back     alignment and domain information
>TIGR01973 NuoG NADH-quinone oxidoreductase, chain G Back     alignment and domain information
>PRK09130 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>PRK09129 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>COG1034 NuoG NADH dehydrogenase/NADH:ubiquinone oxidoreductase 75 kD subunit (chain G) [Energy production and conversion] Back     alignment and domain information
>PRK09908 xanthine dehydrogenase subunit XdhC; Provisional Back     alignment and domain information
>TIGR03193 4hydroxCoAred 4-hydroxybenzoyl-CoA reductase, gamma subunit Back     alignment and domain information
>TIGR03198 pucE xanthine dehydrogenase E subunit Back     alignment and domain information
>KOG3049 consensus Succinate dehydrogenase, Fe-S protein subunit [Energy production and conversion] Back     alignment and domain information
>COG3383 Uncharacterized anaerobic dehydrogenase [General function prediction only] Back     alignment and domain information
>COG2080 CoxS Aerobic-type carbon monoxide dehydrogenase, small subunit CoxS/CutS homologs [Energy production and conversion] Back     alignment and domain information
>PRK09800 putative hypoxanthine oxidase; Provisional Back     alignment and domain information
>TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form Back     alignment and domain information
>cd06218 DHOD_e_trans FAD/NAD binding domain in the electron transfer subunit of dihydroorotate dehydrogenase Back     alignment and domain information
>cd06219 DHOD_e_trans_like1 FAD/NAD binding domain in the electron transfer subunit of dihydroorotate dehydrogenase-like proteins Back     alignment and domain information
>PRK06222 ferredoxin-NADP(+) reductase subunit alpha; Reviewed Back     alignment and domain information
>TIGR02963 xanthine_xdhA xanthine dehydrogenase, small subunit Back     alignment and domain information
>cd06221 sulfite_reductase_like Anaerobic sulfite reductase contains an FAD and NADPH binding module with structural similarity to ferredoxin reductase and sequence similarity to dihydroorotate dehydrogenases Back     alignment and domain information
>TIGR03313 Se_sel_red_Mo probable selenate reductase, molybdenum-binding subunit Back     alignment and domain information
>PRK08345 cytochrome-c3 hydrogenase subunit gamma; Provisional Back     alignment and domain information
>PRK00054 dihydroorotate dehydrogenase electron transfer subunit; Reviewed Back     alignment and domain information
>PRK05802 hypothetical protein; Provisional Back     alignment and domain information
>cd06220 DHOD_e_trans_like2 FAD/NAD binding domain in the electron transfer subunit of dihydroorotate dehydrogenase-like proteins Back     alignment and domain information
>TIGR02969 mam_aldehyde_ox aldehyde oxidase Back     alignment and domain information
>TIGR03311 Se_dep_Molyb_1 selenium-dependent molybdenum hydroxylase 1 Back     alignment and domain information
>PRK08221 anaerobic sulfite reductase subunit B; Provisional Back     alignment and domain information
>TIGR02911 sulfite_red_B sulfite reductase, subunit B Back     alignment and domain information
>KOG2282 consensus NADH-ubiquinone oxidoreductase, NDUFS1/75 kDa subunit [Energy production and conversion] Back     alignment and domain information
>cd06192 DHOD_e_trans_like FAD/NAD binding domain (electron transfer subunit) of dihydroorotate dehydrogenase-like proteins Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query186
1l5p_A93 Ferredoxin; [2Fe-2S] cluster, electron transfer, i 2e-09
1i7h_A111 Ferredoxin; 2Fe-2S,electron transport; 1.70A {Esch 6e-07
3ah7_A113 [2Fe-2S]ferredoxin; [2Fe-2S] cluster, iron-sulfur 9e-07
3zyy_X 631 Iron-sulfur cluster binding protein; iron-sulfur-b 3e-06
2wlb_A103 ETP1-FD, electron transfer protein 1, mitochondria 2e-05
2y5c_A109 Adrenodoxin-like protein, mitochondrial; electron 7e-05
3n9z_C123 Adrenodoxin; cytochrome P450, 22-hydroxycholestero 5e-04
1b9r_A105 Protein (terpredoxin); structure from molmol, ferr 7e-04
1uwm_A106 Ferredoxin VI, FDVI; electron transport, metal-bin 9e-04
>1l5p_A Ferredoxin; [2Fe-2S] cluster, electron transfer, iron-sulfur protein, metalloprotein, oxidoreductase; 2.20A {Trichomonas vaginalis} SCOP: d.15.4.1 Length = 93 Back     alignment and structure
 Score = 51.4 bits (124), Expect = 2e-09
 Identities = 15/69 (21%), Positives = 28/69 (40%), Gaps = 10/69 (14%)

Query: 89  NIM---LDNKIELYATYGKVMNCGGGGSCGTCIVEIIDGKDLLNERTNTELRYLKKKPES 145
            +     +  +           C G  +CG CI + + GK  +    + E  +L+ +P +
Sbjct: 21  TLFTVLTEAGLM-----SADDTCQGNKACGKCICKHVSGK--VAAAEDDEKEFLEDQPAN 73

Query: 146 WRLACQTIV 154
            RLAC   +
Sbjct: 74  ARLACAITL 82
>1i7h_A Ferredoxin; 2Fe-2S,electron transport; 1.70A {Escherichia coli} SCOP: d.15.4.1 Length = 111 Back     alignment and structure
>3ah7_A [2Fe-2S]ferredoxin; [2Fe-2S] cluster, iron-sulfur cluster biosynthes pseudomonas, metal binding protein; 1.90A {Pseudomonas putida} Length = 113 Back     alignment and structure
>3zyy_X Iron-sulfur cluster binding protein; iron-sulfur-binding protein, ashka family, ATPase; 2.20A {Carboxydothermus hydrogenoformans} Length = 631 Back     alignment and structure
>2wlb_A ETP1-FD, electron transfer protein 1, mitochondrial; iron-sulfur, iron, transport, ferredoxin, adrenodoxin-like, electron transport; 2.60A {Schizosaccharomyces pombe} Length = 103 Back     alignment and structure
>2y5c_A Adrenodoxin-like protein, mitochondrial; electron transport, iron-sulfur cluster biogenesis; 1.70A {Homo sapiens} Length = 109 Back     alignment and structure
>3n9z_C Adrenodoxin; cytochrome P450, 22-hydroxycholesterol, cholesterol SIDE CHA cleavage, structural genomics; HET: HEM HC9; 2.17A {Homo sapiens} PDB: 3na1_C* 3p1m_A* 1l6u_A 1l6v_A 1e6e_B* 1cje_A Length = 123 Back     alignment and structure
>1b9r_A Protein (terpredoxin); structure from molmol, ferredoxin; NMR {Pseudomonas SP} SCOP: d.15.4.1 Length = 105 Back     alignment and structure
>1uwm_A Ferredoxin VI, FDVI; electron transport, metal-binding, iron-sulfur, iron, 2Fe-2S; 2.0A {Rhodobacter capsulatus} SCOP: d.15.4.1 PDB: 1e9m_A Length = 106 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query186
3hui_A126 Ferredoxin; cytochrome P450, electron transfer, ir 99.86
3lxf_A104 Ferredoxin; iron, iron-sulfur, metal-binding, meta 99.86
2bt6_A108 Adrenodoxin 1; ruthenium(II) bipyridyl complex, in 99.86
2y5c_A109 Adrenodoxin-like protein, mitochondrial; electron 99.85
3n9z_C123 Adrenodoxin; cytochrome P450, 22-hydroxycholestero 99.83
3ah7_A113 [2Fe-2S]ferredoxin; [2Fe-2S] cluster, iron-sulfur 99.83
1xlq_A106 Putidaredoxin, PDX; [2Fe-2S], ferredoxin, oxidored 99.82
1uwm_A106 Ferredoxin VI, FDVI; electron transport, metal-bin 99.81
2wlb_A103 ETP1-FD, electron transfer protein 1, mitochondria 99.81
1b9r_A105 Protein (terpredoxin); structure from molmol, ferr 99.79
1i7h_A111 Ferredoxin; 2Fe-2S,electron transport; 1.70A {Esch 99.78
1l5p_A93 Ferredoxin; [2Fe-2S] cluster, electron transfer, i 99.78
1czp_A98 Ferredoxin I; [2Fe-2S] protein, crystal reduced wi 99.65
1frd_A98 Heterocyst [2Fe-2S] ferredoxin; electron transport 99.65
1iue_A98 Ferredoxin; electron transport, iron-sulfur; 1.70A 99.65
1awd_A94 Ferredoxin; electron transport, eukaryotic, green 99.65
1a70_A97 Ferredoxin; iron-sulfur protein, photosynthesis, e 99.65
1jq4_A98 Methane monooxygenase component C; [2Fe-2S] ferred 99.63
1frr_A95 Ferredoxin I; electron transfer(iron-sulfur protei 99.63
1wri_A93 Ferredoxin II, ferredoxin; electron transport; 1.2 99.62
1krh_A 338 Benzoate 1,2-dioxygenase reductase; alpha-beta, FA 99.57
3zyy_X 631 Iron-sulfur cluster binding protein; iron-sulfur-b 99.51
1doi_A128 2Fe-2S ferredoxin; halophilic protein, redox prote 99.5
2pia_A321 Phthalate dioxygenase reductase; HET: FMN; 2.00A { 99.43
2bs2_B 241 Quinol-fumarate reductase iron-sulfur subunit B; 2 98.68
1kf6_B 243 Fumarate reductase iron-sulfur protein; respiratio 98.56
2wdq_B 238 Succinate dehydrogenase iron-sulfur subunit; succi 98.55
3vr8_B 282 Iron-sulfur subunit of succinate dehydrogenase; me 98.42
2h88_B 252 Succinate dehydrogenase IP subunit; complex II, me 98.41
1t3q_A168 Quinoline 2-oxidoreductase small subunit; QOR, mol 98.04
3i9v_3 783 NADH-quinone oxidoreductase subunit 3; electron tr 98.01
3c8y_A 574 Iron hydrogenase 1; dithiomethylether, H-cluster, 97.71
1rm6_C161 4-hydroxybenzoyl-COA reductase gamma subunit; xant 97.55
3hrd_D160 Nicotinate dehydrogenase small FES subunit; seleni 96.84
1n62_A166 Carbon monoxide dehydrogenase small chain; CODH, m 96.78
1ffv_A163 CUTS, iron-sulfur protein of carbon monoxide dehyd 96.71
1dgj_A 907 Aldehyde oxidoreductase; beta half-barrel, four-he 95.84
1vlb_A 907 Aldehyde oxidoreductase; iron-sulphur cluster; HET 95.14
2w3s_A 462 Xanthine dehydrogenase; XO, XDH, GOUT, iron, 2Fe-2 93.94
3nvw_A164 Xanthine dehydrogenase/oxidase; hydroxylase, homod 93.68
1y56_A 493 Hypothetical protein PH1363; dehydrogenase, protei 90.58
2gag_A 965 Heterotetrameric sarcosine oxidase alpha-subunit; 86.25
1ep3_B262 Dihydroorotate dehydrogenase B (PYRK subunit); het 83.18
>3hui_A Ferredoxin; cytochrome P450, electron transfer, iron, iron-sulfur, metal-binding, electron transport; 2.01A {Rhodopseudomonas palustris} Back     alignment and structure
Probab=99.86  E-value=4.3e-22  Score=154.29  Aligned_cols=106  Identities=20%  Similarity=0.299  Sum_probs=85.8

Q ss_pred             CCCCCCcEEEEEecCCCCCCCCcceEEEEecCCchHHHHHHHHCCCC-ccccCCcccCCCCceeecCCEEEEecCc-ccC
Q 029865           51 PEPEKPEIELEFIAPRAGDDGSYPVERAKAISGEKLLRNIMLDNKIE-LYATYGKVMNCGGGGSCGTCIVEIIDGK-DLL  128 (186)
Q Consensus        51 ~~~~~~~V~v~f~~~~~~~d~~~~v~~v~v~~G~tLLr~al~~~GI~-l~~~~~~~~~CgG~G~CGTC~V~V~~G~-~~l  128 (186)
                      .+.++..++|+|.++++      ..+++++.+|+||| ++++++||+ +++      .|+|.|.||||+|+|.+|+ ..+
T Consensus        15 ~~~~~~M~~Vt~~~~~G------~~~~v~~~~G~tLL-~aa~~~gi~gi~~------~C~G~G~CgtC~v~v~~G~~~~l   81 (126)
T 3hui_A           15 VPRGSHMAKINFVDHTG------ETRTVEVEEGATVM-EAAIRNAIPGVEA------ECGGACACATCHVYVDEAWREKV   81 (126)
T ss_dssp             CCTTCSEEEEEEECTTS------CEEEEEEETTSBHH-HHHHTTTCTTCCC------TTSSSSCCSTTEEEECGGGHHHH
T ss_pred             cCCCCCceEEEEEeCCC------CEEEEEECCCCcHH-HHHHHcCCCCCcc------CCCCCCCCCCCEEEECCCccccc
Confidence            44455566677876543      13688999999999 999999999 998      6999999999999999997 567


Q ss_pred             CCCChHHHhccCC---CCCCeEEeeEeEeeeccCCCceEEEEcchHh
Q 029865          129 NERTNTELRYLKK---KPESWRLACQTIVGNKENSGKCRIKYLKVEA  172 (186)
Q Consensus       129 ~~~t~~E~~~L~~---~~~g~RLACQ~~v~~~~~~gdv~V~~lP~~~  172 (186)
                      +++++.|+++|+.   ..++|||+||+++. .|++| ++ +.+|+.+
T Consensus        82 ~~~~~~E~~~L~~~~e~~~g~RLaCQ~~~~-~dldg-l~-V~lp~~~  125 (126)
T 3hui_A           82 GGPSPMEEDMLDFGYDVRPNSRLSCQIKVS-NELDG-LI-VTTPERQ  125 (126)
T ss_dssp             CCCCHHHHHHHTTSSSCCTTEEEGGGCBCC-GGGTT-EE-EECCSCC
T ss_pred             CCCCHHHhhhcCchhhccCCeEEeeeCEEC-cCCCc-EE-EEecCcC
Confidence            8899999999984   37899999999998 55555 45 5888653
>3lxf_A Ferredoxin; iron, iron-sulfur, metal-binding, metal protein; 2.30A {Novosphingobium aromaticivorans} SCOP: d.15.4.0 Back     alignment and structure
>2bt6_A Adrenodoxin 1; ruthenium(II) bipyridyl complex, intramolecular electron TRA electron transport, metal-binding; HET: RUA; 1.50A {Bos taurus} SCOP: d.15.4.1 PDB: 1ayf_A 3n9y_C* 2jqr_B* 3na0_C* Back     alignment and structure
>2y5c_A Adrenodoxin-like protein, mitochondrial; electron transport, iron-sulfur cluster biogenesis; 1.70A {Homo sapiens} Back     alignment and structure
>3n9z_C Adrenodoxin; cytochrome P450, 22-hydroxycholesterol, cholesterol SIDE CHA cleavage, structural genomics; HET: HEM HC9; 2.17A {Homo sapiens} SCOP: d.15.4.1 PDB: 3na1_C* 3p1m_A* 1l6u_A 1l6v_A 1e6e_B* 1cje_A Back     alignment and structure
>3ah7_A [2Fe-2S]ferredoxin; [2Fe-2S] cluster, iron-sulfur cluster biosynthes pseudomonas, metal binding protein; 1.90A {Pseudomonas putida} Back     alignment and structure
>1xlq_A Putidaredoxin, PDX; [2Fe-2S], ferredoxin, oxidoreductase; 1.45A {Pseudomonas putida} SCOP: d.15.4.1 PDB: 1xlp_A 1oqr_A 1r7s_A 1pdx_A 1yji_A 1yjj_A 1oqq_A 1xln_A 1xlo_A 3lb8_C* 1put_A 1gpx_A Back     alignment and structure
>1uwm_A Ferredoxin VI, FDVI; electron transport, metal-binding, iron-sulfur, iron, 2Fe-2S; 2.0A {Rhodobacter capsulatus} SCOP: d.15.4.1 PDB: 1e9m_A Back     alignment and structure
>2wlb_A ETP1-FD, electron transfer protein 1, mitochondrial; iron-sulfur, iron, transport, ferredoxin, adrenodoxin-like, electron transport; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>1b9r_A Protein (terpredoxin); structure from molmol, ferredoxin; NMR {Pseudomonas SP} SCOP: d.15.4.1 Back     alignment and structure
>1i7h_A Ferredoxin; 2Fe-2S,electron transport; 1.70A {Escherichia coli} SCOP: d.15.4.1 Back     alignment and structure
>1l5p_A Ferredoxin; [2Fe-2S] cluster, electron transfer, iron-sulfur protein, metalloprotein, oxidoreductase; 2.20A {Trichomonas vaginalis} SCOP: d.15.4.1 Back     alignment and structure
>1czp_A Ferredoxin I; [2Fe-2S] protein, crystal reduced with dithionite, electron; 1.17A {Nostoc SP} SCOP: d.15.4.1 PDB: 1ewy_C* 1fxa_A 1qt9_A 1qog_A 1j7c_A 1j7b_A 1qof_A 1qob_A 1j7a_A 1qoa_A 1rfk_A 3p63_A 4fxc_A 3ab5_A 1roe_A 2cjn_A 2cjo_A 1off_A 1dox_A 1doy_A ... Back     alignment and structure
>1frd_A Heterocyst [2Fe-2S] ferredoxin; electron transport; 1.70A {Nostoc SP} SCOP: d.15.4.1 Back     alignment and structure
>1iue_A Ferredoxin; electron transport, iron-sulfur; 1.70A {Plasmodium falciparum} SCOP: d.15.4.1 Back     alignment and structure
>1awd_A Ferredoxin; electron transport, eukaryotic, green ALGA, electron transfer, metalloprotein; 1.40A {'chlorella' fusca} SCOP: d.15.4.1 Back     alignment and structure
>1a70_A Ferredoxin; iron-sulfur protein, photosynthesis, electron transport; 1.70A {Spinacia oleracea} SCOP: d.15.4.1 PDB: 1pfd_A Back     alignment and structure
>1jq4_A Methane monooxygenase component C; [2Fe-2S] ferredoxin, oxidoreductase; NMR {Methylococcus capsulatus str} SCOP: d.15.4.2 Back     alignment and structure
>1frr_A Ferredoxin I; electron transfer(iron-sulfur protein); 1.80A {Equisetum arvense} SCOP: d.15.4.1 Back     alignment and structure
>1wri_A Ferredoxin II, ferredoxin; electron transport; 1.20A {Equisetum arvense} SCOP: d.15.4.1 Back     alignment and structure
>1krh_A Benzoate 1,2-dioxygenase reductase; alpha-beta, FAD-binding, ferredoxin, NADH-binding, oxidoreductase; HET: FAD; 1.50A {Acinetobacter SP} SCOP: b.43.4.2 c.25.1.2 d.15.4.2 Back     alignment and structure
>3zyy_X Iron-sulfur cluster binding protein; iron-sulfur-binding protein, ashka family, ATPase; 2.20A {Carboxydothermus hydrogenoformans} Back     alignment and structure
>1doi_A 2Fe-2S ferredoxin; halophilic protein, redox protein, iron-sulfur, electron transport; 1.90A {Haloarcula marismortui} SCOP: d.15.4.1 PDB: 1e0z_A* 1e10_A Back     alignment and structure
>2pia_A Phthalate dioxygenase reductase; HET: FMN; 2.00A {Burkholderia cepacia} SCOP: b.43.4.2 c.25.1.2 d.15.4.2 Back     alignment and structure
>2bs2_B Quinol-fumarate reductase iron-sulfur subunit B; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.1.2.1 d.15.4.2 PDB: 2bs3_B* 1e7p_B* 1qlb_B* 2bs4_B* Back     alignment and structure
>1kf6_B Fumarate reductase iron-sulfur protein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.1.2.1 d.15.4.2 PDB: 1kfy_B* 1l0v_B* 2b76_B* 3cir_B* 3p4p_B* 3p4q_B* 3p4r_B* 3p4s_B* Back     alignment and structure
>2wdq_B Succinate dehydrogenase iron-sulfur subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_B* 2acz_B* 1nek_B* 2wdr_B* 2wdv_B* 2ws3_B* 2wu2_B* 2wu5_B* 2wp9_B* Back     alignment and structure
>3vr8_B Iron-sulfur subunit of succinate dehydrogenase; membrane protein, reductase, mitochondria MEMB oxidoreductase; HET: FAD HEM RQX EPH; 2.81A {Ascaris suum} PDB: 3vrb_B* Back     alignment and structure
>2h88_B Succinate dehydrogenase IP subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_B* 1yq3_B* 2fbw_B* 2h89_B* 2wqy_B* 3aef_B* 3abv_B* 3ae1_B* 3ae3_B* 3ae2_B* 3ae5_B* 3ae6_B* 3ae7_B* 3ae8_B* 3ae9_B* 3aea_B* 3aeb_B* 3aec_B* 3aed_B* 3aee_B* ... Back     alignment and structure
>1t3q_A Quinoline 2-oxidoreductase small subunit; QOR, molybdenum, MCD; HET: FAD MCN; 1.80A {Pseudomonas putida} SCOP: a.56.1.1 d.15.4.2 Back     alignment and structure
>3i9v_3 NADH-quinone oxidoreductase subunit 3; electron transport, respiratory chain, cell flavoprotein, FMN, iron, iron-sulfur, membrane; HET: FMN; 3.10A {Thermus thermophilus} PDB: 2ybb_3* 2fug_3* 3iam_3* 3ias_3* 3m9s_3* Back     alignment and structure
>3c8y_A Iron hydrogenase 1; dithiomethylether, H-cluster, iron-sulfur binding, oxidoreductase; HET: HCN; 1.39A {Clostridium pasteurianum} SCOP: c.96.1.1 d.15.4.2 d.58.1.5 PDB: 1c4c_A* 1c4a_A* 1feh_A* Back     alignment and structure
>1rm6_C 4-hydroxybenzoyl-COA reductase gamma subunit; xanthine oxidase family, dimer heterotrimers, oxidoreductase; HET: PCD FAD SF4 EPE; 1.60A {Thauera aromatica} SCOP: a.56.1.1 d.15.4.2 PDB: 1sb3_C* Back     alignment and structure
>3hrd_D Nicotinate dehydrogenase small FES subunit; selenium ligand, iron, iron-sulfur, metal-binding, oxidoreductase; HET: MCN FAD; 2.20A {Eubacterium barkeri} Back     alignment and structure
>1n62_A Carbon monoxide dehydrogenase small chain; CODH, molybdenum, molybdopterin, oxidoreductase; HET: CUB MCN FAD; 1.09A {Oligotropha carboxidovorans} SCOP: a.56.1.1 d.15.4.2 PDB: 1n5w_A* 1n61_A* 1n60_A* 1n63_A* 1zxi_A* Back     alignment and structure
>1ffv_A CUTS, iron-sulfur protein of carbon monoxide dehydrogenase; hydrolase; HET: ARO PCD FAD; 2.25A {Hydrogenophaga pseudoflava} SCOP: a.56.1.1 d.15.4.2 PDB: 1ffu_A* Back     alignment and structure
>1dgj_A Aldehyde oxidoreductase; beta half-barrel, four-helix bundle, beta barrel; HET: MCN; 2.80A {Desulfovibrio desulfuricans} SCOP: a.56.1.1 d.15.4.2 d.41.1.1 d.133.1.1 Back     alignment and structure
>1vlb_A Aldehyde oxidoreductase; iron-sulphur cluster; HET: PCD; 1.28A {Desulfovibrio gigas} SCOP: a.56.1.1 d.15.4.2 d.41.1.1 d.133.1.1 PDB: 1sij_A* 1zcs_A* 3fah_A* 3fc4_A* 3l4p_A* Back     alignment and structure
>2w3s_A Xanthine dehydrogenase; XO, XDH, GOUT, iron, 2Fe-2S, iron-sulfur, oxidoreductase, purine metabolism, molybdenum cofactor, hypoxanthine; HET: MPN FAD XAN; 2.60A {Rhodobacter capsulatus} PDB: 2w3r_A* 2w54_A* 2w55_A* 1jro_A* 1jrp_A* Back     alignment and structure
>3nvw_A Xanthine dehydrogenase/oxidase; hydroxylase, homodimer, xanthine oxidase, guanine, oxidoredu; HET: FAD MTE GUN; 1.60A {Bos taurus} PDB: 3etr_A* 3ns1_A* 3nvv_A* 3nrz_A* 3nvy_A* 3nvz_A* 3rca_A* 3sr6_A* 3eub_A* Back     alignment and structure
>1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Back     alignment and structure
>1ep3_B Dihydroorotate dehydrogenase B (PYRK subunit); heterotetramer, alpha-beta barrel, beta sandwich, FAD domain alpha/beta NADP domain; HET: FMN FAD; 2.10A {Lactococcus lactis} SCOP: b.43.4.2 c.25.1.3 PDB: 1ep1_B* 1ep2_B* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 186
d1l5pa_93 d.15.4.1 (A:) 2Fe-2S ferredoxin {Trichomonas vagin 4e-08
d1b9ra_105 d.15.4.1 (A:) 2Fe-2S ferredoxin {Pseudomonas sp., 1e-07
d1i7ha_109 d.15.4.1 (A:) Adrenodoxin-like ferredoxin {Escheri 2e-07
d2bt6a1104 d.15.4.1 (A:5-108) Adrenodoxin {Cow (Bos taurus) [ 8e-06
d2fug3395 d.15.4.2 (3:1-95) Nadh-quinone oxidoreductase chai 2e-05
d1a70a_97 d.15.4.1 (A:) 2Fe-2S ferredoxin {Spinach (Spinacia 6e-05
d1xlqa1106 d.15.4.1 (A:1-106) 2Fe-2S ferredoxin {Pseudomonas 6e-05
d1e9ma_106 d.15.4.1 (A:) 2Fe-2S ferredoxin {Rhodobacter capsu 2e-04
d2piaa398 d.15.4.2 (A:224-321) Phthalate dioxygenase reducta 0.002
>d1l5pa_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Trichomonas vaginalis [TaxId: 5722]} Length = 93 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-Grasp (ubiquitin-like)
superfamily: 2Fe-2S ferredoxin-like
family: 2Fe-2S ferredoxin-related
domain: 2Fe-2S ferredoxin
species: Trichomonas vaginalis [TaxId: 5722]

 Score = 46.9 bits (111), Expect = 4e-08
 Identities = 16/73 (21%), Positives = 30/73 (41%), Gaps = 8/73 (10%)

Query: 82  SGEKLLRNIMLDNKIELYATYGKVMNCGGGGSCGTCIVEIIDGKDLLNERTNTELRYLKK 141
             + L   ++ +  +           C G  +CG CI + + GK       + E  +L+ 
Sbjct: 18  DDQTLF-TVLTEAGLMSAD-----DTCQGNKACGKCICKHVSGKV--AAAEDDEKEFLED 69

Query: 142 KPESWRLACQTIV 154
           +P + RLAC   +
Sbjct: 70  QPANARLACAITL 82
>d1b9ra_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Pseudomonas sp., terpredoxin [TaxId: 306]} Length = 105 Back     information, alignment and structure
>d1i7ha_ d.15.4.1 (A:) Adrenodoxin-like ferredoxin {Escherichia coli [TaxId: 562]} Length = 109 Back     information, alignment and structure
>d2bt6a1 d.15.4.1 (A:5-108) Adrenodoxin {Cow (Bos taurus) [TaxId: 9913]} Length = 104 Back     information, alignment and structure
>d2fug33 d.15.4.2 (3:1-95) Nadh-quinone oxidoreductase chain 3, Nqo3, N-terminal domain {Thermus thermophilus [TaxId: 274]} Length = 95 Back     information, alignment and structure
>d1a70a_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Spinach (Spinacia oleracea) [TaxId: 3562]} Length = 97 Back     information, alignment and structure
>d1xlqa1 d.15.4.1 (A:1-106) 2Fe-2S ferredoxin {Pseudomonas putida, putidaredoxin [TaxId: 303]} Length = 106 Back     information, alignment and structure
>d1e9ma_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Rhodobacter capsulatus, ferredoxin VI [TaxId: 1061]} Length = 106 Back     information, alignment and structure
>d2piaa3 d.15.4.2 (A:224-321) Phthalate dioxygenase reductase, C-terminal domain {Pseudomonas cepacia, db01 [TaxId: 292]} Length = 98 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query186
d1xlqa1106 2Fe-2S ferredoxin {Pseudomonas putida, putidaredox 99.87
d1e9ma_106 2Fe-2S ferredoxin {Rhodobacter capsulatus, ferredo 99.87
d2bt6a1104 Adrenodoxin {Cow (Bos taurus) [TaxId: 9913]} 99.87
d1i7ha_109 Adrenodoxin-like ferredoxin {Escherichia coli [Tax 99.85
d1b9ra_105 2Fe-2S ferredoxin {Pseudomonas sp., terpredoxin [T 99.84
d1l5pa_93 2Fe-2S ferredoxin {Trichomonas vaginalis [TaxId: 5 99.82
d1krha3104 Benzoate dioxygenase reductase, N-terminal domain 99.76
d1a70a_97 2Fe-2S ferredoxin {Spinach (Spinacia oleracea) [Ta 99.72
d1awda_94 2Fe-2S ferredoxin {Chlorella fusca [TaxId: 3073]} 99.71
d1iuea_98 2Fe-2S ferredoxin {Malaria parasite (Plasmodium fa 99.71
d1jq4a_98 Methane monooxygenase reductase N-terminal domain 99.71
d1frra_95 2Fe-2S ferredoxin {Equisetum arvense [TaxId: 3258] 99.71
d1frda_98 2Fe-2S ferredoxin {Cyanobacterium (Anabaena sp.), 99.7
d1czpa_98 2Fe-2S ferredoxin {Cyanobacterium (Anabaena sp.), 99.69
d2fug3395 Nadh-quinone oxidoreductase chain 3, Nqo3, N-termi 99.67
d2piaa398 Phthalate dioxygenase reductase, C-terminal domain 99.66
d1doia_128 2Fe-2S ferredoxin {Archaeon Haloarcula marismortui 99.59
d1wria_93 2Fe-2S ferredoxin {Equisetum arvense [TaxId: 3258] 99.56
d1kf6b2105 Fumarate reductase iron-sulfur protein, N-terminal 98.99
d2bs2b2106 Fumarate reductase iron-sulfur protein, N-terminal 98.92
d1nekb2106 Succinate dehydogenase iron-sulfur protein, N-term 98.44
d3c8ya2126 Fe-only hydrogenase, N-terminal domain {Clostridiu 98.03
d1dgja280 Aldehyde oxidoreductase, N-terminal domain {Desulf 97.17
d1t3qa281 Quinoline 2-oxidoreductase small subunit QorS, N-d 97.09
d1vlba280 Aldehyde oxidoreductase, N-terminal domain {Desulf 96.94
d1rm6c281 4-hydroxybenzoyl-CoA reductase gamma subunit HrcC, 96.81
d1ffva279 Carbone monoxide (CO) dehydrogenase iron-sulfur pr 96.6
d1n62a279 Carbone monoxide (CO) dehydrogenase iron-sulfur pr 96.47
d1jroa284 Xanthine dehydrogenase chain A, N-terminal domain 95.73
d1v97a290 Xanthine oxidase, N-terminal domain {Cow (Bos taur 94.84
d1ep3b2160 Dihydroorotate dehydrogenase B, PyrK subunit {Lact 93.89
>d1xlqa1 d.15.4.1 (A:1-106) 2Fe-2S ferredoxin {Pseudomonas putida, putidaredoxin [TaxId: 303]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-Grasp (ubiquitin-like)
superfamily: 2Fe-2S ferredoxin-like
family: 2Fe-2S ferredoxin-related
domain: 2Fe-2S ferredoxin
species: Pseudomonas putida, putidaredoxin [TaxId: 303]

Probab=99.87  E-value=5.9e-23  Score=152.48  Aligned_cols=98  Identities=22%  Similarity=0.392  Sum_probs=82.1

Q ss_pred             EEEEecCCCCCCCCcceEEEEecCCchHHHHHHHHCCCC-ccccCCcccCCCCceeecCCEEEEecCc-ccCCCCChHHH
Q 029865           59 ELEFIAPRAGDDGSYPVERAKAISGEKLLRNIMLDNKIE-LYATYGKVMNCGGGGSCGTCIVEIIDGK-DLLNERTNTEL  136 (186)
Q Consensus        59 ~v~f~~~~~~~d~~~~v~~v~v~~G~tLLr~al~~~GI~-l~~~~~~~~~CgG~G~CGTC~V~V~~G~-~~l~~~t~~E~  136 (186)
                      +|+|+++++      ..+++++..|+||| ++++++||+ +++      .|+|.|.||||+|+|.+|+ ..++++++.|.
T Consensus         2 KIt~i~~dG------~~~~i~~~~G~tLl-~aa~~~gi~~i~~------~CgG~~~C~tC~V~v~~g~~~~l~~~~~~E~   68 (106)
T d1xlqa1           2 KVVYVSHDG------TRRELDVADGVSLM-QAAVSNGIYDIVG------DCGGSASCATCHVYVNEAFTDKVPAANEREI   68 (106)
T ss_dssp             EEEEECTTS------CEEEEECCTTCBHH-HHHHHTTCTTSCC------TTCSSSSSCTTEEEECTTTGGGSCCCCHHHH
T ss_pred             EEEEECCCC------CEEEEEeCCCChHH-HHHHHhCcCCchh------hhhhccccccceEEecccchhcCCCCCHHHH
Confidence            466888754      24689999999999 999999995 877      5999999999999999997 68899999999


Q ss_pred             hccCC----CCCCeEEeeEeEeeeccCCCceEEEEcchHh
Q 029865          137 RYLKK----KPESWRLACQTIVGNKENSGKCRIKYLKVEA  172 (186)
Q Consensus       137 ~~L~~----~~~g~RLACQ~~v~~~~~~gdv~V~~lP~~~  172 (186)
                      ++|..    ..++||||||+.+. ++++|. + +.+|+.+
T Consensus        69 ~~L~~~~~~~~~~sRLaCQ~~v~-~~~dgl-~-V~vPe~q  105 (106)
T d1xlqa1          69 GMLESVTAELKPNSRLCCQIIMT-PELDGI-V-VDVPDRQ  105 (106)
T ss_dssp             HHHTTCSSCCCTTEEEGGGCBCC-GGGTTE-E-EECCSCC
T ss_pred             HHHHhhhccCCCCcEeeeeeEec-ccCCCE-E-EECCCcc
Confidence            99965    26899999999998 666654 4 5889754
>d1e9ma_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Rhodobacter capsulatus, ferredoxin VI [TaxId: 1061]} Back     information, alignment and structure
>d2bt6a1 d.15.4.1 (A:5-108) Adrenodoxin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1i7ha_ d.15.4.1 (A:) Adrenodoxin-like ferredoxin {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b9ra_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Pseudomonas sp., terpredoxin [TaxId: 306]} Back     information, alignment and structure
>d1l5pa_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Trichomonas vaginalis [TaxId: 5722]} Back     information, alignment and structure
>d1krha3 d.15.4.2 (A:2-105) Benzoate dioxygenase reductase, N-terminal domain {Acinetobacter sp. [TaxId: 472]} Back     information, alignment and structure
>d1a70a_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1awda_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Chlorella fusca [TaxId: 3073]} Back     information, alignment and structure
>d1iuea_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1jq4a_ d.15.4.2 (A:) Methane monooxygenase reductase N-terminal domain {Methylococcus capsulatus [TaxId: 414]} Back     information, alignment and structure
>d1frra_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Equisetum arvense [TaxId: 3258]} Back     information, alignment and structure
>d1frda_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Cyanobacterium (Anabaena sp.), pcc 7119 and 7120 [TaxId: 1167]} Back     information, alignment and structure
>d1czpa_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Cyanobacterium (Anabaena sp.), pcc 7119 and 7120 [TaxId: 1167]} Back     information, alignment and structure
>d2fug33 d.15.4.2 (3:1-95) Nadh-quinone oxidoreductase chain 3, Nqo3, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2piaa3 d.15.4.2 (A:224-321) Phthalate dioxygenase reductase, C-terminal domain {Pseudomonas cepacia, db01 [TaxId: 292]} Back     information, alignment and structure
>d1doia_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1wria_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Equisetum arvense [TaxId: 3258]} Back     information, alignment and structure
>d1kf6b2 d.15.4.2 (B:1-105) Fumarate reductase iron-sulfur protein, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bs2b2 d.15.4.2 (B:1-106) Fumarate reductase iron-sulfur protein, N-terminal domain {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1nekb2 d.15.4.2 (B:1-106) Succinate dehydogenase iron-sulfur protein, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3c8ya2 d.15.4.2 (A:1-126) Fe-only hydrogenase, N-terminal domain {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d1dgja2 d.15.4.2 (A:1-80) Aldehyde oxidoreductase, N-terminal domain {Desulfovibrio desulfuricans [TaxId: 876]} Back     information, alignment and structure
>d1t3qa2 d.15.4.2 (A:7-87) Quinoline 2-oxidoreductase small subunit QorS, N-domain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1vlba2 d.15.4.2 (A:1-80) Aldehyde oxidoreductase, N-terminal domain {Desulfovibrio gigas [TaxId: 879]} Back     information, alignment and structure
>d1rm6c2 d.15.4.2 (C:1-81) 4-hydroxybenzoyl-CoA reductase gamma subunit HrcC, N-terminal domain {Thauera aromatica [TaxId: 59405]} Back     information, alignment and structure
>d1ffva2 d.15.4.2 (A:3-81) Carbone monoxide (CO) dehydrogenase iron-sulfur protein, N-domain {Hydrogenophaga pseudoflava [TaxId: 47421]} Back     information, alignment and structure
>d1n62a2 d.15.4.2 (A:3-81) Carbone monoxide (CO) dehydrogenase iron-sulfur protein, N-domain {Oligotropha carboxidovorans, formerly Pseudomonas carboxydovorans [TaxId: 40137]} Back     information, alignment and structure
>d1jroa2 d.15.4.2 (A:1-84) Xanthine dehydrogenase chain A, N-terminal domain {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1v97a2 d.15.4.2 (A:3-92) Xanthine oxidase, N-terminal domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ep3b2 c.25.1.3 (B:103-262) Dihydroorotate dehydrogenase B, PyrK subunit {Lactococcus lactis, isozyme B [TaxId: 1358]} Back     information, alignment and structure