Citrus Sinensis ID: 029867

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180------
MRPADSDKPPYVARVEKIEADHRNNVKVRVRWYYRPEESIGGRRQFHGAKELFLSDHYDVQSAHTIEGKCTVHTFKNYTKLENVGAEDYFCRFEYKAATGGFTPDRVAVYCKCEMPYNPDDLMVQCEGCKDWFHPSCMGMTIEEAKKLDHFLCSDCSSDVDAKRSLNTFSVSPSVEAKVEPKRRKR
ccccccccccEEEEEEEEEEcccccEEEEEEEEEcccccccccccccccccEEEEcccccccccEEEEccEEEEEcccccccccccccEEEcccccccccccccccccEEEEccccccccccEEEccccccccccccccccHHHHHHcccEEcccccccccccccccccccccccccccccccccc
ccccccccccEEEEEEEEEEcccccEEEEEEEEEccHHccccccccccccEEEEcccccEEEccEEEEEEEEEEcccccHHcccccccEEEEEEEcccccccccccEEEEEEEccccccccEEEEEccHHcccccccccccHHHHHHHHHcccccHHHccccHHHccccccccccccccccHHccc
mrpadsdkppyvARVEKIEADHRNNVKVRVRwyyrpeesiggrrqfhgakelflsdhydvqsahtiegkctvhtfknytklenvgaedyfcrfeykaatggftpdrvavyckcempynpddlmvqcegckdwfhpscmgmtIEEAKKLDhflcsdcssdvdakrslntfsvspsveakvepkrrkr
mrpadsdkppyvarvekieadhrnnvkvrvrwyyrpeesiggrrqFHGAKELFLSDHYDVQSAHTIEGKCTVHTFKNYTKLENVGAEDYFCRFEYKaatggftpdRVAVYCKCEMPYNPDDLMVQCEGCKDWFHPSCMGMTIEEAKKLDHFLCSDCSSDVDakrslntfsvspsveakvepkrrkr
MRPADSDKPPYVARVEKIEADHRNNVKVRVRWYYRPEESIGGRRQFHGAKELFLSDHYDVQSAHTIEGKCTVHTFKNYTKLENVGAEDYFCRFEYKAATGGFTPDRVAVYCKCEMPYNPDDLMVQCEGCKDWFHPSCMGMTIEEAKKLDHFLCSDCSSDVDAKRSLNTFSVSPSVEAKVEPKRRKR
****************KIEADHRNNVKVRVRWYYRPEESIGGRRQFHGAKELFLSDHYDVQSAHTIEGKCTVHTFKNYTKLENVGAEDYFCRFEYKAATGGFTPDRVAVYCKCEMPYNPDDLMVQCEGCKDWFHPSCMGMTIEEAKKLDHFLCSDCS*****************************
***********VARVEKIEADHRNNVKVRVRWYYRPEESIGGRRQFHGAKELFLSDHYDVQSAHTIEGKCTVHTFKNYTKLENVGAEDYFCRFEYKAATGGFTPDRVAVYCKCEMPYNPDDLMVQCEGCKDWFHPSCMGMTIEEAKKLDHFLC*********************************
*********PYVARVEKIEADHRNNVKVRVRWYYRPEESIGGRRQFHGAKELFLSDHYDVQSAHTIEGKCTVHTFKNYTKLENVGAEDYFCRFEYKAATGGFTPDRVAVYCKCEMPYNPDDLMVQCEGCKDWFHPSCMGMTIEEAKKLDHFLCSDCSSDVDAKRSLNTFSV***************
*******KPPYVARVEKIEADHRNNVKVRVRWYYRPEESIGGRRQFHGAKELFLSDHYDVQSAHTIEGKCTVHTFKNYTKLENVGAEDYFCRFEYKAATGGFTPDRVAVYCKCEMPYNPDDLMVQCEGCKDWFHPSCMGMTIEEAKKLDHFLCSDCSSDV**************************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRPADSDKPPYVARVEKIEADHRNNVKVRVRWYYRPEESIGGRRQFHGAKELFLSDHYDVQSAHTIEGKCTVHTFKNYTKLENVGAEDYFCRFEYKAATGGFTPDRVAVYCKCEMPYNPDDLMVQCEGCKDWFHPSCMGMTIEEAKKLDHFLCSDCSSDVDAKRSLNTFSVSPSVEAKVEPKRRKR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query186 2.2.26 [Sep-21-2011]
Q9WTU0 1096 Lysine-specific demethyla yes no 0.387 0.065 0.376 6e-10
O75151 1096 Lysine-specific demethyla yes no 0.268 0.045 0.48 7e-10
Q6P949 1063 Lysine-specific demethyla yes no 0.268 0.047 0.46 1e-09
E6ZGB4 1081 Lysine-specific demethyla N/A no 0.268 0.046 0.44 4e-09
Q9UPP1 1060 Histone lysine demethylas no no 0.268 0.047 0.44 8e-09
Q80TJ7 1023 Histone lysine demethylas no no 0.268 0.048 0.44 9e-09
P0CH95 1032 Histone lysine demethylas no no 0.268 0.048 0.42 2e-08
Q9W0T12669 Nucleosome-remodeling fac yes no 0.290 0.020 0.370 2e-08
Q3UWM4 940 Lysine-specific demethyla no no 0.268 0.053 0.44 3e-08
Q9P2812608 BAH and coiled-coil domai no no 0.548 0.039 0.324 6e-08
>sp|Q9WTU0|PHF2_MOUSE Lysine-specific demethylase PHF2 OS=Mus musculus GN=Phf2 PE=1 SV=2 Back     alignment and function desciption
 Score = 63.9 bits (154), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 29/77 (37%), Positives = 44/77 (57%), Gaps = 5/77 (6%)

Query: 107 VAVYCKCEMPYNPDDLMVQCEGCKDWFHPSCMGMTIEEAKKLDHFLCSDCS-----SDVD 161
           V VYC C +PY+    M++C+ CKDWFH SC+G+  EEA  +D + C +C      S + 
Sbjct: 4   VPVYCVCRLPYDVTRFMIECDACKDWFHGSCVGVEEEEAPDIDIYHCPNCEKTHGKSTLK 63

Query: 162 AKRSLNTFSVSPSVEAK 178
            KR+ +     P+ + K
Sbjct: 64  KKRTWHKHGPGPTPDVK 80
Lysine demethylase that demethylates both histones and non-histone proteins. Enzymatically inactive by itself, and becomes active following phosphorylation by PKA: forms a complex with ARID5B and mediates demethylation of methylated ARID5B. Demethylation of ARID5B leads to target the PHF2-ARID5B complex to target promoters, where PHF2 mediates demethylation of dimethylated 'Lys-9' of histone H3 (H3K9me2), followed by transcription activation of target genes. The PHF2-ARID5B complex acts as a coactivator of HNF4A in liver. PHF2 is recruited to trimethylated 'Lys-4' of histone H3 (H3K4me3) at rDNA promoters and promotes expression of rDNA.
Mus musculus (taxid: 10090)
EC: 1EC: .EC: 1EC: 4EC: .EC: 1EC: 1EC: .EC: -
>sp|O75151|PHF2_HUMAN Lysine-specific demethylase PHF2 OS=Homo sapiens GN=PHF2 PE=1 SV=4 Back     alignment and function description
>sp|Q6P949|PHF2_DANRE Lysine-specific demethylase phf2 OS=Danio rerio GN=phf2 PE=2 SV=3 Back     alignment and function description
>sp|E6ZGB4|PHF2_DICLA Lysine-specific demethylase phf2 OS=Dicentrarchus labrax GN=phf2 PE=3 SV=1 Back     alignment and function description
>sp|Q9UPP1|PHF8_HUMAN Histone lysine demethylase PHF8 OS=Homo sapiens GN=PHF8 PE=1 SV=3 Back     alignment and function description
>sp|Q80TJ7|PHF8_MOUSE Histone lysine demethylase PHF8 OS=Mus musculus GN=Phf8 PE=1 SV=2 Back     alignment and function description
>sp|P0CH95|PHF8_DANRE Histone lysine demethylase PHF8 OS=Danio rerio GN=phf8 PE=1 SV=1 Back     alignment and function description
>sp|Q9W0T1|NU301_DROME Nucleosome-remodeling factor subunit NURF301 OS=Drosophila melanogaster GN=E(bx) PE=1 SV=2 Back     alignment and function description
>sp|Q3UWM4|KDM7_MOUSE Lysine-specific demethylase 7 OS=Mus musculus GN=Jhdm1d PE=2 SV=2 Back     alignment and function description
>sp|Q9P281|BAHC1_HUMAN BAH and coiled-coil domain-containing protein 1 OS=Homo sapiens GN=BAHCC1 PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query186
449453529216 PREDICTED: BAH and coiled-coil domain-co 1.0 0.861 0.956 1e-103
225447109215 PREDICTED: BAH and coiled-coil domain-co 0.994 0.860 0.962 1e-102
224131658216 ebs-bah-phd domain-containing protein [P 1.0 0.861 0.930 1e-100
255568693209 phd finger transcription factor, putativ 0.962 0.856 0.966 1e-100
224064916208 ebs-bah-phd domain-containing protein [P 0.956 0.855 0.915 4e-95
147773160208 hypothetical protein VITISV_022159 [Viti 0.946 0.846 0.937 8e-95
363814276216 uncharacterized protein LOC100800993 [Gl 1.0 0.861 0.870 1e-94
359494828215 PREDICTED: BAH and coiled-coil domain-co 0.994 0.860 0.881 2e-94
295913466214 transcription factor [Lycoris longituba] 0.989 0.859 0.876 2e-94
356543233216 PREDICTED: BAH and coiled-coil domain-co 1.0 0.861 0.860 2e-93
>gi|449453529|ref|XP_004144509.1| PREDICTED: BAH and coiled-coil domain-containing protein 1-like [Cucumis sativus] gi|449493160|ref|XP_004159209.1| PREDICTED: BAH and coiled-coil domain-containing protein 1-like [Cucumis sativus] Back     alignment and taxonomy information
 Score =  379 bits (973), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 178/186 (95%), Positives = 182/186 (97%)

Query: 1   MRPADSDKPPYVARVEKIEADHRNNVKVRVRWYYRPEESIGGRRQFHGAKELFLSDHYDV 60
           MRP+DSDKPPYVARVEKIEADHRNNVKVRVRWYYRPEESIGGRRQFHGAKELFLSDH+DV
Sbjct: 31  MRPSDSDKPPYVARVEKIEADHRNNVKVRVRWYYRPEESIGGRRQFHGAKELFLSDHFDV 90

Query: 61  QSAHTIEGKCTVHTFKNYTKLENVGAEDYFCRFEYKAATGGFTPDRVAVYCKCEMPYNPD 120
           QSAHTIEGKCTVHTFKNYTKLENVGAEDYFCRFEYKAATGGFTPDRVAVYCKCEMPYNPD
Sbjct: 91  QSAHTIEGKCTVHTFKNYTKLENVGAEDYFCRFEYKAATGGFTPDRVAVYCKCEMPYNPD 150

Query: 121 DLMVQCEGCKDWFHPSCMGMTIEEAKKLDHFLCSDCSSDVDAKRSLNTFSVSPSVEAKVE 180
           DLMVQCEGCKDWFHPSCMGMTIEEAKKLDHFLCSDCSS+ +AKRSLN F VSPS EAKVE
Sbjct: 151 DLMVQCEGCKDWFHPSCMGMTIEEAKKLDHFLCSDCSSENEAKRSLNAFPVSPSAEAKVE 210

Query: 181 PKRRKR 186
           PKRRKR
Sbjct: 211 PKRRKR 216

Source: Cucumis sativus

Species: Cucumis sativus

Genus: Cucumis

Family: Cucurbitaceae

Order: Cucurbitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225447109|ref|XP_002273680.1| PREDICTED: BAH and coiled-coil domain-containing protein 1 isoform 1 [Vitis vinifera] gi|359485509|ref|XP_003633285.1| PREDICTED: BAH and coiled-coil domain-containing protein 1 isoform 2 [Vitis vinifera] gi|297739198|emb|CBI28849.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224131658|ref|XP_002321145.1| ebs-bah-phd domain-containing protein [Populus trichocarpa] gi|222861918|gb|EEE99460.1| ebs-bah-phd domain-containing protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255568693|ref|XP_002525318.1| phd finger transcription factor, putative [Ricinus communis] gi|223535377|gb|EEF37051.1| phd finger transcription factor, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224064916|ref|XP_002301607.1| ebs-bah-phd domain-containing protein [Populus trichocarpa] gi|222843333|gb|EEE80880.1| ebs-bah-phd domain-containing protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|147773160|emb|CAN75916.1| hypothetical protein VITISV_022159 [Vitis vinifera] Back     alignment and taxonomy information
>gi|363814276|ref|NP_001242778.1| uncharacterized protein LOC100800993 [Glycine max] gi|255641326|gb|ACU20940.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|359494828|ref|XP_003634849.1| PREDICTED: BAH and coiled-coil domain-containing protein 1-like [Vitis vinifera] gi|297741765|emb|CBI32994.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|295913466|gb|ADG57983.1| transcription factor [Lycoris longituba] Back     alignment and taxonomy information
>gi|356543233|ref|XP_003540067.1| PREDICTED: BAH and coiled-coil domain-containing protein 1-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query186
TAIR|locus:2120693234 EBS "EARLY BOLTING IN SHORT DA 0.962 0.764 0.837 8.9e-86
TAIR|locus:2120252228 SHL1 "short life" [Arabidopsis 0.967 0.789 0.670 3.6e-66
TAIR|locus:2137256193 AT4G04260 [Arabidopsis thalian 0.951 0.917 0.715 5.8e-66
UNIPROTKB|E7ET14 327 PHF2 "Lysine-specific demethyl 0.397 0.226 0.382 3.5e-11
MGI|MGI:1338034 1096 Phf2 "PHD finger protein 2" [M 0.387 0.065 0.376 1.3e-10
UNIPROTKB|B0QZE1148 PHF8 "Histone lysine demethyla 0.268 0.337 0.44 2e-10
UNIPROTKB|B0QZZ2115 PHF8 "Histone lysine demethyla 0.268 0.434 0.44 2e-10
UNIPROTKB|B0QZZ3126 PHF8 "Histone lysine demethyla 0.268 0.396 0.44 2e-10
UNIPROTKB|B0QZZ497 PHF8 "Histone lysine demethyla 0.268 0.515 0.44 2e-10
UNIPROTKB|Q5JPR8114 PHF8 "Histone lysine demethyla 0.268 0.438 0.44 2e-10
TAIR|locus:2120693 EBS "EARLY BOLTING IN SHORT DAYS" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 858 (307.1 bits), Expect = 8.9e-86, P = 8.9e-86
 Identities = 150/179 (83%), Positives = 166/179 (92%)

Query:     1 MRPADSDKPPYVARVEKIEADHRNNVKVRVRWYYRPEESIGGRRQFHGAKELFLSDHYDV 60
             MRP+D+ KPPYVARVEKIEAD RNNVKV  RWYYRPEES+GGRRQFHGAKELFLSDH+DV
Sbjct:    39 MRPSDAGKPPYVARVEKIEADARNNVKVHCRWYYRPEESLGGRRQFHGAKELFLSDHFDV 98

Query:    61 QSAHTIEGKCTVHTFKNYTKLENVGAEDYFCRFEYKAATGGFTPDRVAVYCKCEMPYNPD 120
             QSAHTIEGKC VHTFKNYT+LENVGAEDY+CRFEYKAATG FTPDRVAVYCKCEMPYNPD
Sbjct:    99 QSAHTIEGKCIVHTFKNYTRLENVGAEDYYCRFEYKAATGAFTPDRVAVYCKCEMPYNPD 158

Query:   121 DLMVQCEGCKDWFHPSCMGMTIEEAKKLDHFLCSDCSSDVDAKRSLNTFSVSPSVEAKV 179
             DLMVQCEGCKDW+HP+C+GMTIEEAKKLDHF+C++CSSD D K+S N F+ SP+ + KV
Sbjct:   159 DLMVQCEGCKDWYHPACVGMTIEEAKKLDHFVCAECSSDDDVKKSQNGFTSSPADDVKV 217
GO:0003677 "DNA binding" evidence=IEA;ISS
GO:0005634 "nucleus" evidence=ISM
GO:0006355 "regulation of transcription, DNA-dependent" evidence=ISS
GO:0008270 "zinc ion binding" evidence=IEA
GO:0009845 "seed germination" evidence=IMP
GO:0009911 "positive regulation of flower development" evidence=IGI
GO:0006333 "chromatin assembly or disassembly" evidence=RCA
TAIR|locus:2120252 SHL1 "short life" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2137256 AT4G04260 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|E7ET14 PHF2 "Lysine-specific demethylase PHF2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1338034 Phf2 "PHD finger protein 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|B0QZE1 PHF8 "Histone lysine demethylase PHF8" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|B0QZZ2 PHF8 "Histone lysine demethylase PHF8" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|B0QZZ3 PHF8 "Histone lysine demethylase PHF8" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|B0QZZ4 PHF8 "Histone lysine demethylase PHF8" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q5JPR8 PHF8 "Histone lysine demethylase PHF8" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query186
cd04714121 cd04714, BAH_BAHCC1, BAH, or Bromo Adjacent Homolo 2e-46
smart00439121 smart00439, BAH, Bromo adjacent homology domain 9e-30
pfam01426120 pfam01426, BAH, BAH domain 2e-29
cd04370123 cd04370, BAH, BAH, or Bromo Adjacent Homology doma 3e-19
pfam0062851 pfam00628, PHD, PHD-finger 4e-11
cd04713146 cd04713, BAH_plant_3, BAH, or Bromo Adjacent Homol 1e-09
cd04717121 cd04717, BAH_polybromo, BAH, or Bromo Adjacent Hom 2e-09
smart0024947 smart00249, PHD, PHD zinc finger 4e-08
cd04718148 cd04718, BAH_plant_2, BAH, or Bromo Adjacent Homol 4e-08
cd04721130 cd04721, BAH_plant_1, BAH, or Bromo Adjacent Homol 3e-06
cd04709164 cd04709, BAH_MTA, BAH, or Bromo Adjacent Homology 7e-06
cd04710135 cd04710, BAH_fungalPHD, BAH, or Bromo Adjacent Hom 6e-04
cd04716122 cd04716, BAH_plantDCM_I, BAH, or Bromo Adjacent Ho 0.001
>gnl|CDD|240065 cd04714, BAH_BAHCC1, BAH, or Bromo Adjacent Homology domain, as present in mammalian BAHCC1 and similar proteins Back     alignment and domain information 
 Score =  147 bits (374), Expect = 2e-46
 Identities = 51/126 (40%), Positives = 62/126 (49%), Gaps = 16/126 (12%)

Query: 1   MRPADSDKPPYVARVEKIEADHRNNVKVRVRWYYRPEESIGGRRQFHGAKELFLSDHYDV 60
            +       PYVAR+E +  D   N+ VRV+WYYRPEE+ GGR+  HG KELF SDH D 
Sbjct: 12  FKSPGRPSLPYVARIESLWEDPEGNMVVRVKWYYRPEETKGGRKPNHGEKELFASDHQDE 71

Query: 61  QSAHTIEGKCTVHTFKNYTKLENVGAEDYFCRFEYKAATGGFTPDRVAVYCKCEMPYNPD 120
            S  TIE KC V TF  Y +L  V                   P     +  C   YNPD
Sbjct: 72  NSVQTIEHKCYVLTFAEYERLARVKK----------------KPQDGVDFYYCAGTYNPD 115

Query: 121 DLMVQC 126
             M++C
Sbjct: 116 TGMLKC 121

BAHCC1 stands for BAH domain and coiled-coil containing 1. BAH domains are found in a variety of proteins playing roles in transcriptional silencing and the remodeling of chromatin. It is assumed that in most or all of these instances the BAH domain mediates protein-protein interactions. Length = 121
>gnl|CDD|214664 smart00439, BAH, Bromo adjacent homology domain Back     alignment and domain information
>gnl|CDD|216495 pfam01426, BAH, BAH domain Back     alignment and domain information
>gnl|CDD|239835 cd04370, BAH, BAH, or Bromo Adjacent Homology domain (also called ELM1 and BAM for Bromo Adjacent Motif) Back     alignment and domain information
>gnl|CDD|201356 pfam00628, PHD, PHD-finger Back     alignment and domain information
>gnl|CDD|240064 cd04713, BAH_plant_3, BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function Back     alignment and domain information
>gnl|CDD|240068 cd04717, BAH_polybromo, BAH, or Bromo Adjacent Homology domain, as present in polybromo and yeast RSC1/2 Back     alignment and domain information
>gnl|CDD|214584 smart00249, PHD, PHD zinc finger Back     alignment and domain information
>gnl|CDD|240069 cd04718, BAH_plant_2, BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function Back     alignment and domain information
>gnl|CDD|240072 cd04721, BAH_plant_1, BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function Back     alignment and domain information
>gnl|CDD|240060 cd04709, BAH_MTA, BAH, or Bromo Adjacent Homology domain, as present in MTA1 and similar proteins Back     alignment and domain information
>gnl|CDD|240061 cd04710, BAH_fungalPHD, BAH, or Bromo Adjacent Homology domain, as present in fungal proteins containing PHD domains Back     alignment and domain information
>gnl|CDD|240067 cd04716, BAH_plantDCM_I, BAH, or Bromo Adjacent Homology domain, first copy present in DNA (Cytosine-5)-methyltransferases (DCM) from plants Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 186
cd04714121 BAH_BAHCC1 BAH, or Bromo Adjacent Homology domain, 99.97
cd04716122 BAH_plantDCM_I BAH, or Bromo Adjacent Homology dom 99.96
cd04718148 BAH_plant_2 BAH, or Bromo Adjacent Homology domain 99.95
cd04717121 BAH_polybromo BAH, or Bromo Adjacent Homology doma 99.94
smart00439120 BAH Bromo adjacent homology domain. 99.92
cd04709164 BAH_MTA BAH, or Bromo Adjacent Homology domain, as 99.92
cd04370123 BAH BAH, or Bromo Adjacent Homology domain (also c 99.92
cd04710135 BAH_fungalPHD BAH, or Bromo Adjacent Homology doma 99.91
cd04713146 BAH_plant_3 BAH, or Bromo Adjacent Homology domain 99.91
PF01426119 BAH: BAH domain; InterPro: IPR001025 The BAH (brom 99.91
cd04711137 BAH_Dnmt1_II BAH, or Bromo Adjacent Homology domai 99.9
cd04721130 BAH_plant_1 BAH, or Bromo Adjacent Homology domain 99.9
KOG1886 464 consensus BAH domain proteins [Transcription] 99.88
cd04760124 BAH_Dnmt1_I BAH, or Bromo Adjacent Homology domain 99.87
cd04712130 BAH_DCM_I BAH, or Bromo Adjacent Homology domain, 99.86
cd04708202 BAH_plantDCM_II BAH, or Bromo Adjacent Homology do 99.85
cd04720179 BAH_Orc1p_Yeast BAH, or Bromo Adjacent Homology do 99.83
cd04715159 BAH_Orc1p_like BAH, or Bromo Adjacent Homology dom 99.8
cd04719128 BAH_Orc1p_animal BAH, or Bromo Adjacent Homology d 99.8
KOG1827 629 consensus Chromatin remodeling complex RSC, subuni 99.37
PF0062851 PHD: PHD-finger; InterPro: IPR019787 Zinc finger ( 99.21
KOG1973274 consensus Chromatin remodeling protein, contains P 99.14
smart0024947 PHD PHD zinc finger. The plant homeodomain (PHD) f 99.01
COG5034271 TNG2 Chromatin remodeling protein, contains PhD zi 99.01
KOG1632 345 consensus Uncharacterized PHD Zn-finger protein [G 98.69
KOG4323 464 consensus Polycomb-like PHD Zn-finger protein [Gen 98.42
KOG3554 693 consensus Histone deacetylase complex, MTA1 compon 98.03
PF1383136 PHD_2: PHD-finger; PDB: 2L43_A 2KU3_A. 97.48
KOG1512381 consensus PHD Zn-finger protein [General function 97.43
KOG0825 1134 consensus PHD Zn-finger protein [General function 97.38
KOG2752 345 consensus Uncharacterized conserved protein, conta 97.23
KOG1244336 consensus Predicted transcription factor Requiem/N 97.18
KOG1844 508 consensus PHD Zn-finger proteins [General function 97.06
KOG0955 1051 consensus PHD finger protein BR140/LIN-49 [General 96.99
KOG1632345 consensus Uncharacterized PHD Zn-finger protein [G 96.61
KOG0954 893 consensus PHD finger protein [General function pre 96.4
KOG4299 613 consensus PHD Zn-finger protein [General function 96.18
KOG0957707 consensus PHD finger protein [General function pre 95.85
cd04718148 BAH_plant_2 BAH, or Bromo Adjacent Homology domain 95.43
KOG1245 1404 consensus Chromatin remodeling complex WSTF-ISWI, 94.27
KOG0383 696 consensus Predicted helicase [General function pre 94.24
KOG0957 707 consensus PHD finger protein [General function pre 92.96
PF0749650 zf-CW: CW-type Zinc Finger; InterPro: IPR011124 Zi 92.56
PF1444654 Prok-RING_1: Prokaryotic RING finger family 1 92.21
KOG2626 544 consensus Histone H3 (Lys4) methyltransferase comp 91.74
KOG1512381 consensus PHD Zn-finger protein [General function 91.1
PF07227 446 DUF1423: Protein of unknown function (DUF1423); In 90.05
COG5141 669 PHD zinc finger-containing protein [General functi 87.02
KOG0956 900 consensus PHD finger protein AF10 [General functio 86.62
PF13832110 zf-HC5HC2H_2: PHD-zinc-finger like domain 86.52
COG5076371 Transcription factor involved in chromatin remodel 85.04
KOG4443 694 consensus Putative transcription factor HALR/MLL3, 84.96
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 82.82
PF0764930 C1_3: C1-like domain; InterPro: IPR011424 This sho 82.05
KOG4443 694 consensus Putative transcription factor HALR/MLL3, 80.39
>cd04714 BAH_BAHCC1 BAH, or Bromo Adjacent Homology domain, as present in mammalian BAHCC1 and similar proteins Back     alignment and domain information 
Probab=99.97  E-value=2.4e-30  Score=187.98  Aligned_cols=109  Identities=47%  Similarity=0.820  Sum_probs=96.6

Q ss_pred             CCCCCCCCCeEEEEeEEeecCCCCEEEEEEEEeccccccCcccccCCCCeeEeeCCcceeeeceeeeeeEEEeeeccccc
Q 029867            2 RPADSDKPPYVARVEKIEADHRNNVKVRVRWYYRPEESIGGRRQFHGAKELFLSDHYDVQSAHTIEGKCTVHTFKNYTKL   81 (186)
Q Consensus         2 ~~~~~~~~~~iarI~~i~~~~~~~~~v~v~Wfyrp~d~~~~~~~~~~~~ELf~S~~~d~~~~~~I~gkc~V~~~~e~~~~   81 (186)
                      .+++.+++||||+|++||++.+|+++|+|+|||||+||.+++++.++++|||+|+|.|++++++|.|||.|+++++|.++
T Consensus        13 ~~~~~~~~pyIgrI~~i~e~~~g~~~~~v~WfyrPeEt~~~~~~~~~~~EvF~S~~~d~~~~~~I~gkc~V~~~~ey~~~   92 (121)
T cd04714          13 KSPGRPSLPYVARIESLWEDPEGNMVVRVKWYYRPEETKGGRKPNHGEKELFASDHQDENSVQTIEHKCYVLTFAEYERL   92 (121)
T ss_pred             eCCCCCCCCEEEEEEEEEEcCCCCEEEEEEEEEcHHHccCcccccCCCCceEecCCcccccHHHhCcccEEEehhHheec
Confidence            45555588999999999999889999999999999999999888899999999999999999999999999999999877


Q ss_pred             cccCCcceeEeeeeccccCcccCCCcceEEecCCCCCCCCceEeC
Q 029867           82 ENVGAEDYFCRFEYKAATGGFTPDRVAVYCKCEMPYNPDDLMVQC  126 (186)
Q Consensus        82 ~~~~~~~ffcr~~Yd~~~~~f~p~~~~~~C~C~~~~~~~~~~i~C  126 (186)
                      ....+                ++..+...|+|..+|||+..||||
T Consensus        93 ~~~~~----------------~~~~~~d~~~Ce~~yn~~~~~~~c  121 (121)
T cd04714          93 ARVKK----------------KPQDGVDFYYCAGTYNPDTGMLKC  121 (121)
T ss_pred             ccccC----------------CCCcCCCEEEEeccCCCCcCcccC
Confidence            65322                334567789999999999999998

BAHCC1 stands for BAH domain and coiled-coil containing 1. BAH domains are found in a variety of proteins playing roles in transcriptional silencing and the remodeling of chromatin. It is assumed that in most or all of these instances the BAH domain mediates protein-protein interactions.
>cd04716 BAH_plantDCM_I BAH, or Bromo Adjacent Homology domain, first copy present in DNA (Cytosine-5)-methyltransferases (DCM) from plants Back     alignment and domain information
>cd04718 BAH_plant_2 BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function Back     alignment and domain information
>cd04717 BAH_polybromo BAH, or Bromo Adjacent Homology domain, as present in polybromo and yeast RSC1/2 Back     alignment and domain information
>smart00439 BAH Bromo adjacent homology domain Back     alignment and domain information
>cd04709 BAH_MTA BAH, or Bromo Adjacent Homology domain, as present in MTA1 and similar proteins Back     alignment and domain information
>cd04370 BAH BAH, or Bromo Adjacent Homology domain (also called ELM1 and BAM for Bromo Adjacent Motif) Back     alignment and domain information
>cd04710 BAH_fungalPHD BAH, or Bromo Adjacent Homology domain, as present in fungal proteins containing PHD domains Back     alignment and domain information
>cd04713 BAH_plant_3 BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function Back     alignment and domain information
>PF01426 BAH: BAH domain; InterPro: IPR001025 The BAH (bromo-adjacent homology) family contains proteins such as eukaryotic DNA (cytosine-5) methyltransferases IPR001525 from INTERPRO, the origin recognition complex 1 (Orc1) proteins, as well as several proteins involved in transcriptional regulation Back     alignment and domain information
>cd04711 BAH_Dnmt1_II BAH, or Bromo Adjacent Homology domain, second copy present in DNA (Cytosine-5)-methyltransferases from Bilateria, Dnmt1 and similar proteins Back     alignment and domain information
>cd04721 BAH_plant_1 BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function Back     alignment and domain information
>KOG1886 consensus BAH domain proteins [Transcription] Back     alignment and domain information
>cd04760 BAH_Dnmt1_I BAH, or Bromo Adjacent Homology domain, first copy present in DNA (Cytosine-5)-methyltransferases from Bilateria, Dnmt1 and similar proteins Back     alignment and domain information
>cd04712 BAH_DCM_I BAH, or Bromo Adjacent Homology domain, as present in DNA (Cytosine-5)-methyltransferases (DCM) 1 Back     alignment and domain information
>cd04708 BAH_plantDCM_II BAH, or Bromo Adjacent Homology domain, second copy present in DNA (Cytosine-5)-methyltransferases (DCM) from plants Back     alignment and domain information
>cd04720 BAH_Orc1p_Yeast BAH, or Bromo Adjacent Homology domain, as present in Orc1p, which again is part of the Saccharomyces cerevisiae Sir1-origin recognition complex, and as present in Sir3p Back     alignment and domain information
>cd04715 BAH_Orc1p_like BAH, or Bromo Adjacent Homology domain, as present in the Schizosaccharomyces pombe homolog of Saccharomyces cerevisiae Orc1p and similar proteins Back     alignment and domain information
>cd04719 BAH_Orc1p_animal BAH, or Bromo Adjacent Homology domain, as present in animal homologs of Saccharomyces cerevisiae Orc1p Back     alignment and domain information
>KOG1827 consensus Chromatin remodeling complex RSC, subunit RSC1/Polybromo and related proteins [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>PF00628 PHD: PHD-finger; InterPro: IPR019787 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG1973 consensus Chromatin remodeling protein, contains PHD Zn-finger [Chromatin structure and dynamics] Back     alignment and domain information
>smart00249 PHD PHD zinc finger Back     alignment and domain information
>COG5034 TNG2 Chromatin remodeling protein, contains PhD zinc finger [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1632 consensus Uncharacterized PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG4323 consensus Polycomb-like PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG3554 consensus Histone deacetylase complex, MTA1 component [Chromatin structure and dynamics] Back     alignment and domain information
>PF13831 PHD_2: PHD-finger; PDB: 2L43_A 2KU3_A Back     alignment and domain information
>KOG1512 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG2752 consensus Uncharacterized conserved protein, contains N-recognin-type Zn-finger [General function prediction only] Back     alignment and domain information
>KOG1244 consensus Predicted transcription factor Requiem/NEURO-D4 [Transcription] Back     alignment and domain information
>KOG1844 consensus PHD Zn-finger proteins [General function prediction only] Back     alignment and domain information
>KOG0955 consensus PHD finger protein BR140/LIN-49 [General function prediction only] Back     alignment and domain information
>KOG1632 consensus Uncharacterized PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG0954 consensus PHD finger protein [General function prediction only] Back     alignment and domain information
>KOG4299 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG0957 consensus PHD finger protein [General function prediction only] Back     alignment and domain information
>cd04718 BAH_plant_2 BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function Back     alignment and domain information
>KOG1245 consensus Chromatin remodeling complex WSTF-ISWI, large subunit (contains heterochromatin localization, PHD and BROMO domains) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0383 consensus Predicted helicase [General function prediction only] Back     alignment and domain information
>KOG0957 consensus PHD finger protein [General function prediction only] Back     alignment and domain information
>PF07496 zf-CW: CW-type Zinc Finger; InterPro: IPR011124 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF14446 Prok-RING_1: Prokaryotic RING finger family 1 Back     alignment and domain information
>KOG2626 consensus Histone H3 (Lys4) methyltransferase complex, subunit CPS60/ASH2/BRE2 [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG1512 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>PF07227 DUF1423: Protein of unknown function (DUF1423); InterPro: IPR004082 A total of 715 potential protein-coding genes have been identified in the nucleotide sequence of Arabidopsis thaliana chromosome 5, with an average gene density of 1 gene per 4001 bp [] Back     alignment and domain information
>COG5141 PHD zinc finger-containing protein [General function prediction only] Back     alignment and domain information
>KOG0956 consensus PHD finger protein AF10 [General function prediction only] Back     alignment and domain information
>PF13832 zf-HC5HC2H_2: PHD-zinc-finger like domain Back     alignment and domain information
>COG5076 Transcription factor involved in chromatin remodeling, contains bromodomain [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>KOG4443 consensus Putative transcription factor HALR/MLL3, involved in embryonic development [General function prediction only] Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>PF07649 C1_3: C1-like domain; InterPro: IPR011424 This short domain is rich in cysteines and histidines Back     alignment and domain information
>KOG4443 consensus Putative transcription factor HALR/MLL3, involved in embryonic development [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query186
3kqi_A75 Crystal Structure Of Phf2 Phd Domain Complexed With 1e-09
3kv4_A 447 Structure Of Phf8 In Complex With Histone H3 Length 1e-09
1wep_A79 Solution Structure Of Phd Domain In Phf8 Length = 7 3e-09
3kv5_D 488 Structure Of Kiaa1718, Human Jumonji Demethylase, I 1e-08
2f6j_A174 Crystal Structure Of Phd Finger-Linker-Bromodomain 2e-08
1w4s_A174 Crystal Structure Of The Proximal Bah Domain Of Pol 3e-08
3qzv_A174 Crystal Structure Of Bptf Phd-Linker-Bromo In Compl 3e-08
2fui_A62 Nmr Solution Structure Of Phd Finger Fragment Of Hu 4e-07
2ri7_A174 Crystal Structure Of Phd Finger-Linker-Bromodomain 4e-07
1wem_A76 Solution Structure Of Phd Domain In Death Inducer- 4e-04
>pdb|3KQI|A Chain A, Crystal Structure Of Phf2 Phd Domain Complexed With H3k4me3 Peptide Length = 75 Back     alignment and structure 
Iteration: 1

 Score = 59.7 bits (143), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 34/50 (68%)
Query: 107 VAVYCKCEMPYNPDDLMVQCEGCKDWFHPSCMGMTIEEAKKLDHFLCSDC 156
           V VYC C +PY+    M++C+ CKDWFH SC+G+  EEA  +D + C +C
Sbjct: 9   VPVYCVCRLPYDVTRFMIECDACKDWFHGSCVGVEEEEAPDIDIYHCPNC 58
>pdb|3KV4|A Chain A, Structure Of Phf8 In Complex With Histone H3 Length = 447 Back     alignment and structure
>pdb|1WEP|A Chain A, Solution Structure Of Phd Domain In Phf8 Length = 79 Back     alignment and structure
>pdb|3KV5|D Chain D, Structure Of Kiaa1718, Human Jumonji Demethylase, In Complex With N-Oxalylglycine Length = 488 Back     alignment and structure
>pdb|2F6J|A Chain A, Crystal Structure Of Phd Finger-Linker-Bromodomain Fragment Of Human Bptf In The H3(1-15)k4me3 Bound State Length = 174 Back     alignment and structure
>pdb|3QZV|A Chain A, Crystal Structure Of Bptf Phd-Linker-Bromo In Complex With Histone H4k12ac Peptide Length = 174 Back     alignment and structure
>pdb|2FUI|A Chain A, Nmr Solution Structure Of Phd Finger Fragment Of Human Bptf In Free State Length = 62 Back     alignment and structure
>pdb|2RI7|A Chain A, Crystal Structure Of Phd Finger-Linker-Bromodomain Y17e Mutant From Human Bptf In The H3(1-9)k4me2 Bound State Length = 174 Back     alignment and structure
>pdb|1WEM|A Chain A, Solution Structure Of Phd Domain In Death Inducer- Obliterator 1(Dio-1) Length = 76 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query186
1w4s_A174 Polybromo, polybromo 1 protein; BAH, bromo-associa 2e-39
1wep_A79 PHF8; structural genomics, PHD domain, riken struc 7e-23
3kqi_A75 GRC5, PHD finger protein 2; metal-binding, zinc-fi 2e-19
3kv5_D 488 JMJC domain-containing histone demethylation prote 2e-18
3kv4_A 447 PHD finger protein 8; epigenetics, histone CODE, c 9e-18
4dov_A163 ORC1, origin recognition complex subunit 1; DNA re 3e-17
1we9_A64 PHD finger family protein; structural genomics, PH 2e-16
1wem_A76 Death associated transcription factor 1; structura 4e-16
1wee_A72 PHD finger family protein; structural genomics, PH 2e-13
3o70_A68 PHD finger protein 13; PHF13, structural genomics 2e-13
3o7a_A52 PHD finger protein 13 variant; PHF13, zinc finger, 9e-13
2kgg_A52 Histone demethylase jarid1A; PHD finger, histone m 9e-13
3pur_A 528 Lysine-specific demethylase 7 homolog; oxidoreduct 2e-11
3swr_A 1002 DNA (cytosine-5)-methyltransferase 1; epigenetics, 2e-11
3swr_A 1002 DNA (cytosine-5)-methyltransferase 1; epigenetics, 2e-08
3av4_A 1330 DNA (cytosine-5)-methyltransferase 1; CXXC-type zi 3e-11
3av4_A 1330 DNA (cytosine-5)-methyltransferase 1; CXXC-type zi 2e-08
2ri7_A174 Nucleosome-remodeling factor subunit BPTF; zinc fi 7e-10
2k16_A75 Transcription initiation factor TFIID subunit 3; p 2e-09
2xb1_A105 Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; 6e-09
3rsn_A177 SET1/ASH2 histone methyltransferase complex subun; 4e-08
1wew_A78 DNA-binding family protein; structural genomics, P 5e-08
2rsd_A68 E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant 2e-07
3lqh_A183 Histone-lysine N-methyltransferase MLL; PHD finger 7e-07
2vpb_A65 Hpygo1, pygopus homolog 1; gene regulation, WNT si 1e-06
1x4i_A70 Inhibitor of growth protein 3; structural genomics 8e-06
3c6w_A59 P28ING5, inhibitor of growth protein 5; chromatin, 4e-05
1wen_A71 Inhibitor of growth family, member 4; ING1-like pr 4e-05
2vnf_A60 ING 4, P29ING4, inhibitor of growth protein 4; ace 1e-04
1weu_A91 Inhibitor of growth family, member 4; structural g 1e-04
>1wep_A PHF8; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: g.50.1.2 Length = 79 Back     alignment and structure
>3kqi_A GRC5, PHD finger protein 2; metal-binding, zinc-finger, histone-binding, NUC protein; HET: M3L; 1.78A {Homo sapiens} Length = 75 Back     alignment and structure
>3kv5_D JMJC domain-containing histone demethylation protein 1D; epigenetics, histone CODE, jumonji lysine demethylase, metal-binding, zinc, zinc-finger; HET: OGA; 2.39A {Homo sapiens} PDB: 3kv6_A* Length = 488 Back     alignment and structure
>3kv4_A PHD finger protein 8; epigenetics, histone CODE, covalent histone modifications, jumonji demethylase, mental retardation, metal-binding, zinc; HET: M3L MLY OGA; 2.19A {Homo sapiens} Length = 447 Back     alignment and structure
>4dov_A ORC1, origin recognition complex subunit 1; DNA replication, replication; 1.70A {Mus musculus} PDB: 4dow_A* Length = 163 Back     alignment and structure
>1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Length = 64 Back     alignment and structure
>1wem_A Death associated transcription factor 1; structural genomics, PHD domain, death inducer- obliterator 1(DIO-1); NMR {Mus musculus} SCOP: g.50.1.2 Length = 76 Back     alignment and structure
>1wee_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Length = 72 Back     alignment and structure
>3o70_A PHD finger protein 13; PHF13, structural genomics consortium, SGC, structural genom type zinc finger, protein binding, zinc ION binding; 1.85A {Homo sapiens} Length = 68 Back     alignment and structure
>3o7a_A PHD finger protein 13 variant; PHF13, zinc finger, PHD domain, nuclear protein, structural structural genomics consortium, SGC, protein binding; HET: M3L; 1.67A {Homo sapiens} Length = 52 Back     alignment and structure
>2kgg_A Histone demethylase jarid1A; PHD finger, histone modification, leukemia, alternative splicing, chromatin regulator, developmental protein; NMR {Homo sapiens} PDB: 2kgi_A* 3gl6_A* Length = 52 Back     alignment and structure
>3pur_A Lysine-specific demethylase 7 homolog; oxidoreductase-oxidoreductase inhibitor complex; HET: 2HG; 2.10A {Caenorhabditis elegans} PDB: 3n9l_A 3n9m_A* 3n9o_A* 3n9p_A* 3n9q_A* 3n9n_A* 3puq_A* Length = 528 Back     alignment and structure
>3swr_A DNA (cytosine-5)-methyltransferase 1; epigenetics, DNA methyltransferase fold, maintenance methyla transferase; HET: DNA SFG MES; 2.49A {Homo sapiens} PDB: 3pta_A* 3pt6_A* 3pt9_A* 4da4_A* Length = 1002 Back     alignment and structure
>3swr_A DNA (cytosine-5)-methyltransferase 1; epigenetics, DNA methyltransferase fold, maintenance methyla transferase; HET: DNA SFG MES; 2.49A {Homo sapiens} PDB: 3pta_A* 3pt6_A* 3pt9_A* 4da4_A* Length = 1002 Back     alignment and structure
>3av4_A DNA (cytosine-5)-methyltransferase 1; CXXC-type zinc finger/C5-methyltransferase family; HET: DNA; 2.75A {Mus musculus} PDB: 3av5_A* 3av6_A* Length = 1330 Back     alignment and structure
>3av4_A DNA (cytosine-5)-methyltransferase 1; CXXC-type zinc finger/C5-methyltransferase family; HET: DNA; 2.75A {Mus musculus} PDB: 3av5_A* 3av6_A* Length = 1330 Back     alignment and structure
>2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* Length = 174 Back     alignment and structure
>2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Length = 75 Back     alignment and structure
>2xb1_A Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; fusion protein, signal transduction, transcription, metal BI WNT proteins; 1.90A {Homo sapiens} Length = 105 Back     alignment and structure
>3rsn_A SET1/ASH2 histone methyltransferase complex subun; PHD domain, winged helix domain, binding, transcription; 2.10A {Homo sapiens} PDB: 3s32_A Length = 177 Back     alignment and structure
>1wew_A DNA-binding family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Length = 78 Back     alignment and structure
>2rsd_A E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant homeodomain (PHD), histone binding; NMR {Oryza sativa japonica group} Length = 68 Back     alignment and structure
>3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A Length = 183 Back     alignment and structure
>2vpb_A Hpygo1, pygopus homolog 1; gene regulation, WNT signaling pathway, WNT signaling complex, chromosomal rearrangement, signaling protein; 1.59A {Homo sapiens} PDB: 2vpd_A 2yyr_A* 2dx8_A* 2vp7_A 2vpg_A* 2vpe_A* Length = 65 Back     alignment and structure
>1x4i_A Inhibitor of growth protein 3; structural genomics, PHD domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>3c6w_A P28ING5, inhibitor of growth protein 5; chromatin, PHD, ING, epigenetics, alternative splicing, metal-binding, phosphoprotein, zinc; HET: M3L; 1.75A {Homo sapiens} PDB: 2pnx_A* Length = 59 Back     alignment and structure
>1wen_A Inhibitor of growth family, member 4; ING1-like protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.50.1.2 PDB: 1wes_A Length = 71 Back     alignment and structure
>2vnf_A ING 4, P29ING4, inhibitor of growth protein 4; acetylation, alternative splicing, anti-oncogene, cell cycle, coiled C nucleus, zinc, zinc-finger, ING4; HET: M3L; 1.76A {Homo sapiens} SCOP: g.50.1.2 PDB: 2k1j_A 2jmq_A 2qic_A* Length = 60 Back     alignment and structure
>1weu_A Inhibitor of growth family, member 4; structural genomics, PHD domain, ING1-like protein, DNA binding protein, NPPSFA; NMR {Mus musculus} SCOP: g.50.1.2 Length = 91 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query186
1w4s_A174 Polybromo, polybromo 1 protein; BAH, bromo-associa 99.93
3swr_A 1002 DNA (cytosine-5)-methyltransferase 1; epigenetics, 99.82
3av4_A 1330 DNA (cytosine-5)-methyltransferase 1; CXXC-type zi 99.8
1wep_A79 PHF8; structural genomics, PHD domain, riken struc 99.79
4dov_A163 ORC1, origin recognition complex subunit 1; DNA re 99.78
3kqi_A75 GRC5, PHD finger protein 2; metal-binding, zinc-fi 99.75
1we9_A64 PHD finger family protein; structural genomics, PH 99.69
3swr_A 1002 DNA (cytosine-5)-methyltransferase 1; epigenetics, 99.69
3o7a_A52 PHD finger protein 13 variant; PHF13, zinc finger, 99.62
3o70_A68 PHD finger protein 13; PHF13, structural genomics 99.61
4ft4_B 784 DNA (cytosine-5)-methyltransferase 1; chromodomain 99.6
1wee_A72 PHD finger family protein; structural genomics, PH 99.6
2kgg_A52 Histone demethylase jarid1A; PHD finger, histone m 99.59
3av4_A 1330 DNA (cytosine-5)-methyltransferase 1; CXXC-type zi 99.56
1wem_A76 Death associated transcription factor 1; structura 99.55
1wew_A78 DNA-binding family protein; structural genomics, P 99.54
2rsd_A68 E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant 99.52
2vpb_A65 Hpygo1, pygopus homolog 1; gene regulation, WNT si 99.5
3kv5_D 488 JMJC domain-containing histone demethylation prote 99.48
2xb1_A105 Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; 99.47
3kv4_A 447 PHD finger protein 8; epigenetics, histone CODE, c 99.47
2jmi_A90 Protein YNG1, ING1 homolog 1; PHD, histone, recogn 99.46
1wen_A71 Inhibitor of growth family, member 4; ING1-like pr 99.45
1x4i_A70 Inhibitor of growth protein 3; structural genomics 99.42
3c6w_A59 P28ING5, inhibitor of growth protein 5; chromatin, 99.41
2ri7_A174 Nucleosome-remodeling factor subunit BPTF; zinc fi 99.41
2k16_A75 Transcription initiation factor TFIID subunit 3; p 99.39
2g6q_A62 Inhibitor of growth protein 2; protein-peptide com 99.38
1weu_A91 Inhibitor of growth family, member 4; structural g 99.38
2vnf_A60 ING 4, P29ING4, inhibitor of growth protein 4; ace 99.36
2lv9_A98 Histone-lysine N-methyltransferase MLL5; zinc fing 99.35
3lqh_A183 Histone-lysine N-methyltransferase MLL; PHD finger 99.35
3pur_A 528 Lysine-specific demethylase 7 homolog; oxidoreduct 99.27
2fl7_A232 Regulatory protein SIR3; ORC, silencing, chromatin 99.03
1m4z_A238 Origin recognition complex subunit 1; DNA replicat 99.01
3rsn_A177 SET1/ASH2 histone methyltransferase complex subun; 98.93
1f62_A51 Transcription factor WSTF; Zn-finger; NMR {Homo sa 98.79
2yt5_A66 Metal-response element-binding transcription facto 98.73
2yql_A56 PHD finger protein 21A; PHD domain, structural gen 98.68
2l5u_A61 Chromodomain-helicase-DNA-binding protein 4; CHD4, 98.67
3asl_A70 E3 ubiquitin-protein ligase UHRF1; histone reader 98.67
2e6r_A92 Jumonji/ARID domain-containing protein 1D; PHD dom 98.67
2puy_A60 PHD finger protein 21A; PHD finger, histone CODE, 98.66
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 98.62
1xwh_A66 Autoimmune regulator; PHD domain, Zn binding domai 98.61
1wev_A88 Riken cDNA 1110020M19; structural genomics, PHD do 98.61
1mm2_A61 MI2-beta; PHD, zinc finger, protein scaffold, DNA 98.6
2e6s_A77 E3 ubiquitin-protein ligase UHRF2; PHD domain, str 98.59
1fp0_A88 KAP-1 corepressor; PHD domain, C3HC4 type zinc bin 98.57
2ku3_A71 Bromodomain-containing protein 1; PHD finger, chro 98.49
3shb_A77 E3 ubiquitin-protein ligase UHRF1; unmodified hist 98.48
3ask_A226 E3 ubiquitin-protein ligase UHRF1; histone reader 98.38
2l43_A88 N-teminal domain from histone H3.3, linker, PHD1 f 98.34
2lri_C66 Autoimmune regulator; Zn binding protein domain, a 98.29
2kwj_A114 Zinc finger protein DPF3; acetyl-lysine, transcrip 98.23
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 98.22
3o36_A 184 Transcription intermediary factor 1-alpha; TRIM24, 98.2
4gne_A107 Histone-lysine N-methyltransferase NSD3; zinc fing 98.17
3u5n_A 207 E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b 98.16
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 98.09
4bbq_A117 Lysine-specific demethylase 2A; oxidoreductase, ub 97.87
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 97.72
2ro1_A 189 Transcription intermediary factor 1-beta; KAP, TIF 97.52
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 97.22
2kwj_A114 Zinc finger protein DPF3; acetyl-lysine, transcrip 97.21
2lbm_A142 Transcriptional regulator ATRX; metal binding prot 96.8
3ql9_A129 Transcriptional regulator ATRX; zinc finger, trans 96.22
1wil_A89 KIAA1045 protein; ring finger domain, structural g 90.36
1weq_A85 PHD finger protein 7; structural genomics, PHD dom 86.89
2l7p_A100 Histone-lysine N-methyltransferase ASHH2; CW-domai 86.14
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 85.63
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 84.99
2pv0_B 386 DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, 81.09
>3swr_A DNA (cytosine-5)-methyltransferase 1; epigenetics, DNA methyltransferase fold, maintenance methyla transferase; HET: DNA SFG MES; 2.49A {Homo sapiens} PDB: 3pta_A* 3pt6_A* 3pt9_A* 4da4_A* Back     alignment and structure
>3av4_A DNA (cytosine-5)-methyltransferase 1; CXXC-type zinc finger/C5-methyltransferase family; HET: DNA; 2.75A {Mus musculus} PDB: 3av5_A* 3av6_A* Back     alignment and structure
>1wep_A PHF8; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>4dov_A ORC1, origin recognition complex subunit 1; DNA replication, replication; 1.70A {Mus musculus} PDB: 4dow_A* Back     alignment and structure
>3kqi_A GRC5, PHD finger protein 2; metal-binding, zinc-finger, histone-binding, NUC protein; HET: M3L; 1.78A {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>3swr_A DNA (cytosine-5)-methyltransferase 1; epigenetics, DNA methyltransferase fold, maintenance methyla transferase; HET: DNA SFG MES; 2.49A {Homo sapiens} PDB: 3pta_A* 3pt6_A* 3pt9_A* 4da4_A* Back     alignment and structure
>3o7a_A PHD finger protein 13 variant; PHF13, zinc finger, PHD domain, nuclear protein, structural structural genomics consortium, SGC, protein binding; HET: M3L; 1.67A {Homo sapiens} Back     alignment and structure
>3o70_A PHD finger protein 13; PHF13, structural genomics consortium, SGC, structural genom type zinc finger, protein binding, zinc ION binding; 1.85A {Homo sapiens} Back     alignment and structure
>4ft4_B DNA (cytosine-5)-methyltransferase 1; chromodomain, BAH domain, DNA methyltransferase domain, H3K9 binding, methylation, transferase; HET: DNA MLY SAH; 2.70A {Zea mays} PDB: 4ft2_A* 4fsx_A* Back     alignment and structure
>1wee_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>2kgg_A Histone demethylase jarid1A; PHD finger, histone modification, leukemia, alternative splicing, chromatin regulator, developmental protein; NMR {Homo sapiens} PDB: 2kgi_A* 3gl6_A* Back     alignment and structure
>3av4_A DNA (cytosine-5)-methyltransferase 1; CXXC-type zinc finger/C5-methyltransferase family; HET: DNA; 2.75A {Mus musculus} PDB: 3av5_A* 3av6_A* Back     alignment and structure
>1wem_A Death associated transcription factor 1; structural genomics, PHD domain, death inducer- obliterator 1(DIO-1); NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>1wew_A DNA-binding family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>2rsd_A E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant homeodomain (PHD), histone binding; NMR {Oryza sativa japonica group} Back     alignment and structure
>2vpb_A Hpygo1, pygopus homolog 1; gene regulation, WNT signaling pathway, WNT signaling complex, chromosomal rearrangement, signaling protein; 1.59A {Homo sapiens} PDB: 2vpd_A 2yyr_A* 2dx8_A* 2vp7_A 2vpg_A* 2vpe_A* Back     alignment and structure
>3kv5_D JMJC domain-containing histone demethylation protein 1D; epigenetics, histone CODE, jumonji lysine demethylase, metal-binding, zinc, zinc-finger; HET: OGA; 2.39A {Homo sapiens} PDB: 3kv6_A* Back     alignment and structure
>2xb1_A Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; fusion protein, signal transduction, transcription, metal BI WNT proteins; 1.90A {Homo sapiens} Back     alignment and structure
>3kv4_A PHD finger protein 8; epigenetics, histone CODE, covalent histone modifications, jumonji demethylase, mental retardation, metal-binding, zinc; HET: M3L MLY OGA; 2.19A {Homo sapiens} Back     alignment and structure
>2jmi_A Protein YNG1, ING1 homolog 1; PHD, histone, recognition, yeast, protein binding; NMR {Saccharomyces cerevisiae} PDB: 2jmj_A* Back     alignment and structure
>1wen_A Inhibitor of growth family, member 4; ING1-like protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.50.1.2 PDB: 1wes_A Back     alignment and structure
>1x4i_A Inhibitor of growth protein 3; structural genomics, PHD domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3c6w_A P28ING5, inhibitor of growth protein 5; chromatin, PHD, ING, epigenetics, alternative splicing, metal-binding, phosphoprotein, zinc; HET: M3L; 1.75A {Homo sapiens} PDB: 2pnx_A* Back     alignment and structure
>2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* Back     alignment and structure
>2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Back     alignment and structure
>2g6q_A Inhibitor of growth protein 2; protein-peptide complex, gene regulation, apoptosis; HET: M3L; 2.00A {Mus musculus} Back     alignment and structure
>1weu_A Inhibitor of growth family, member 4; structural genomics, PHD domain, ING1-like protein, DNA binding protein, NPPSFA; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>2vnf_A ING 4, P29ING4, inhibitor of growth protein 4; acetylation, alternative splicing, anti-oncogene, cell cycle, coiled C nucleus, zinc, zinc-finger, ING4; HET: M3L; 1.76A {Homo sapiens} SCOP: g.50.1.2 PDB: 2k1j_A 2jmq_A 2qic_A* Back     alignment and structure
>2lv9_A Histone-lysine N-methyltransferase MLL5; zinc finger, transcription, protein binding, NESG, northeast structural genomics consortium, SGC; NMR {Homo sapiens} Back     alignment and structure
>3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A Back     alignment and structure
>3pur_A Lysine-specific demethylase 7 homolog; oxidoreductase-oxidoreductase inhibitor complex; HET: 2HG; 2.10A {Caenorhabditis elegans} PDB: 3n9l_A 3n9m_A* 3n9o_A* 3n9p_A* 3n9q_A* 3n9n_A* 3puq_A* Back     alignment and structure
>2fl7_A Regulatory protein SIR3; ORC, silencing, chromatin, transcription; 1.85A {Saccharomyces cerevisiae} PDB: 2fvu_A 3tu4_K* Back     alignment and structure
>1m4z_A Origin recognition complex subunit 1; DNA replication, transcriptional silencing, chromatin, BAH D gene regulation; 2.20A {Saccharomyces cerevisiae} SCOP: b.34.12.1 PDB: 1zhi_A 1zbx_A Back     alignment and structure
>3rsn_A SET1/ASH2 histone methyltransferase complex subun; PHD domain, winged helix domain, binding, transcription; 2.10A {Homo sapiens} PDB: 3s32_A Back     alignment and structure
>1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} Back     alignment and structure
>2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>3asl_A E3 ubiquitin-protein ligase UHRF1; histone reader module, epigenetic regulation, LI binding protein complex; 1.41A {Homo sapiens} PDB: 3sou_A 3sow_A* 3sox_A 3zvy_A 2lgg_A 2lgk_A* 2lgl_A 3t6r_A 3zvz_B Back     alignment and structure
>2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A Back     alignment and structure
>1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A Back     alignment and structure
>2e6s_A E3 ubiquitin-protein ligase UHRF2; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>3shb_A E3 ubiquitin-protein ligase UHRF1; unmodified histone, methylation, UHRF1, PHD, ligase-NUCL protein complex; 1.80A {Homo sapiens} Back     alignment and structure
>3ask_A E3 ubiquitin-protein ligase UHRF1; histone reader modules, epigenetic regulation, trimethylaion of lysine residue, ligase-DNA binding protein; HET: M3L; 2.90A {Homo sapiens} Back     alignment and structure
>2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Back     alignment and structure
>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Back     alignment and structure
>4gne_A Histone-lysine N-methyltransferase NSD3; zinc finger, transcription, nuclear protein, transf nuclear protein complex; 1.47A {Homo sapiens} PDB: 4gnd_A 4gnf_A 4gng_A* Back     alignment and structure
>3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Back     alignment and structure
>4bbq_A Lysine-specific demethylase 2A; oxidoreductase, ubiquitin, ligase, ubiquitination, demethyla ZF-CXXC DNA binding domain, CPG island, chromatin; 2.24A {Homo sapiens} Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Back     alignment and structure
>2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Back     alignment and structure
>2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Back     alignment and structure
>2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A Back     alignment and structure
>3ql9_A Transcriptional regulator ATRX; zinc finger, transcription, lysine trimethylation, protein, histone-binding protein, transcription-structural complex; HET: M3L; 0.93A {Homo sapiens} PDB: 3qla_A* 3qlc_A 3qln_A 2jm1_A Back     alignment and structure
>1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3 Back     alignment and structure
>1weq_A PHD finger protein 7; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>2l7p_A Histone-lysine N-methyltransferase ASHH2; CW-domain; NMR {Arabidopsis thaliana} Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>2pv0_B DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, unmethylated H3K4, de novo DNA methylation, transferase regulator; HET: DNA; 3.30A {Homo sapiens} PDB: 2pvc_B* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 186
d1m4za_217 b.34.12.1 (A:) Origin-recognition complex protein 6e-19
d1wepa_79 g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus mus 4e-18
d1we9a_64 g.50.1.2 (A:) PHD finger protein At5g26210 {Thale 8e-13
d1weea_72 g.50.1.2 (A:) PHD finger protein At1g33420 {Thale 5e-12
d1wema_76 g.50.1.2 (A:) Death associated transcription facto 7e-11
d1wewa_78 g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale c 5e-09
d2pnxa151 g.50.1.2 (A:195-245) Inhibitor of growth protein 4 3e-07
d1wesa_71 g.50.1.2 (A:) PHD Inhibitor of growth protein 2, I 3e-06
d1weva_88 g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus mu 1e-04
d1mm2a_61 g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens 3e-04
d1f62a_51 g.50.1.2 (A:) Williams-Beuren syndrome transcripti 0.002
>d1m4za_ b.34.12.1 (A:) Origin-recognition complex protein 120kDa subunit, Orc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 217 Back     information, alignment and structure

class: All beta proteins
fold: SH3-like barrel
superfamily: BAH domain
family: BAH domain
domain: Origin-recognition complex protein 120kDa subunit, Orc1p
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

 Score = 78.4 bits (193), Expect = 6e-19
 Identities = 14/116 (12%), Positives = 24/116 (20%), Gaps = 3/116 (2%)

Query: 10  PYVARVEKIEADHRNNVKVRVRWYYRPEESIGGRRQFH-GAKELFLSDHYDVQSAHTIEG 68
            Y+   E     H            RP               EL+L+             
Sbjct: 92  TYLRWFEVNPLAHYRQFNPDANILNRPLNYYNKLFSETANKNELYLTAELAELQLFNFIR 151

Query: 69  KCTVHTFKNYTKLEN--VGAEDYFCRFEYKAATGGFTPDRVAVYCKCEMPYNPDDL 122
              V     +  L+       D+  R+  +     F    +           P + 
Sbjct: 152 VANVMDGSKWEVLKGNVDPERDFTVRYICEPTGEKFVDINIEDVKAYIKKVEPREA 207
>d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} Length = 79 Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 64 Back     information, alignment and structure
>d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 72 Back     information, alignment and structure
>d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 76 Back     information, alignment and structure
>d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 78 Back     information, alignment and structure
>d2pnxa1 g.50.1.2 (A:195-245) Inhibitor of growth protein 4, Ing4 {Homo sapiens [TaxId: 9606]} Length = 51 Back     information, alignment and structure
>d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 71 Back     information, alignment and structure
>d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Length = 88 Back     information, alignment and structure
>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Length = 61 Back     information, alignment and structure
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Length = 51 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query186
d1wepa_79 PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 99.76
d1m4za_217 Origin-recognition complex protein 120kDa subunit, 99.48
d1weea_72 PHD finger protein At1g33420 {Thale cress (Arabido 99.48
d1we9a_64 PHD finger protein At5g26210 {Thale cress (Arabido 99.46
d2pnxa151 Inhibitor of growth protein 4, Ing4 {Homo sapiens 99.35
d1wema_76 Death associated transcription factor 1, Datf1 (DI 99.32
d1wewa_78 Sumoylation ligase E3, SIZ1 {Thale cress (Arabidop 99.31
d1wesa_71 PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mu 99.3
d1weva_88 PHD finger protein 22 {Mouse (Mus musculus) [TaxId 99.1
d1f62a_51 Williams-Beuren syndrome transcription factor, WST 99.01
d1mm2a_61 Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 98.93
d1fp0a170 Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo 98.73
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 92.78
d1weqa_85 PHD finger protein 7 (NYD-SP6) {Mouse (Mus musculu 89.64
d1zbdb_124 Effector domain of rabphilin-3a {Rat (Rattus norve 89.2
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 84.71
>d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Small proteins
fold: FYVE/PHD zinc finger
superfamily: FYVE/PHD zinc finger
family: PHD domain
domain: PHD finger protein 8
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=99.76  E-value=1e-19  Score=120.02  Aligned_cols=76  Identities=37%  Similarity=0.766  Sum_probs=64.9

Q ss_pred             cCcccCCCcceEEecCCCCCCCCceEeCCCCCceecCCCCCCChhhhcCCCeEEcccCccccccccccCCCCCCCC
Q 029867           99 TGGFTPDRVAVYCKCEMPYNPDDLMVQCEGCKDWFHPSCMGMTIEEAKKLDHFLCSDCSSDVDAKRSLNTFSVSPS  174 (186)
Q Consensus        99 ~~~f~p~~~~~~C~C~~~~~~~~~~i~C~~C~~W~H~~Cv~~~~~~~~~~~~~~C~~C~~~~~~~~~~~~~~~~~~  174 (186)
                      ++...+...++||+|+++++++++||+||.|+.|||..|++++...+...+.|+|+.|....+.....+++..++.
T Consensus         3 ~gss~~~~~pv~CiC~~~~~~~~~mI~Cd~C~~W~H~~C~g~~~~~~~~~~~~~C~~C~~~~gp~~~k~~~~~~ss   78 (79)
T d1wepa_           3 SGSSGMALVPVYCLCRQPYNVNHFMIECGLCQDWFHGSCVGIEEENAVDIDIYHCPDCEAVFGPSIMKNWHSGPSS   78 (79)
T ss_dssp             SCCCCCCCCCCCSTTSCSCCSSSCEEEBTTTCCEEEHHHHTCCHHHHTTCSBBCCTTTTTTSCSCBCCCCCCSCCC
T ss_pred             CCcCCCCcCCeEeECCCccCCCCcEEECCCCCCcEeccccCcchhcCCCCCEEECccCcCCcCCccccCCCCCCCC
Confidence            4555566789999999999989999999999999999999999988777789999999988886666677666654
>d1m4za_ b.34.12.1 (A:) Origin-recognition complex protein 120kDa subunit, Orc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2pnxa1 g.50.1.2 (A:195-245) Inhibitor of growth protein 4, Ing4 {Homo sapiens [TaxId: 9606]} Back     information, alignment and structure
>d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1weqa_ g.50.1.2 (A:) PHD finger protein 7 (NYD-SP6) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zbdb_ g.50.1.1 (B:) Effector domain of rabphilin-3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure