Citrus Sinensis ID: 029926
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 185 | ||||||
| 13173434 | 623 | phosphoribosylaminoimidazole carboxylase | 0.475 | 0.141 | 0.545 | 7e-19 | |
| 37983592 | 621 | phosphoribosylaminoimidazole carboxylase | 0.475 | 0.141 | 0.545 | 8e-19 | |
| 14590237 | 177 | phosphoribosylaminoimidazole carboxylase | 0.410 | 0.429 | 0.578 | 2e-17 | |
| 410667200 | 164 | phosphoribosylaminoimidazole carboxylase | 0.405 | 0.457 | 0.56 | 1e-16 | |
| 268316597 | 171 | phosphoribosylaminoimidazole carboxylase | 0.416 | 0.450 | 0.545 | 2e-16 | |
| 449490248 | 586 | PREDICTED: phosphoribosylaminoimidazole | 0.421 | 0.133 | 0.548 | 2e-16 | |
| 449442114 | 586 | PREDICTED: phosphoribosylaminoimidazole | 0.421 | 0.133 | 0.548 | 2e-16 | |
| 147859592 | 604 | hypothetical protein VITISV_024806 [Viti | 0.427 | 0.130 | 0.544 | 4e-16 | |
| 345303692 | 171 | phosphoribosylaminoimidazole carboxylase | 0.416 | 0.450 | 0.532 | 8e-16 | |
| 154249773 | 178 | phosphoribosylaminoimidazole carboxylase | 0.394 | 0.410 | 0.575 | 8e-16 |
| >gi|13173434|gb|AAK14408.1| phosphoribosylaminoimidazole carboxylase [Nicotiana tabacum] | Back alignment and taxonomy information |
|---|
Score = 99.0 bits (245), Expect = 7e-19, Method: Compositional matrix adjust.
Identities = 48/88 (54%), Positives = 61/88 (69%)
Query: 98 TVFEEENANGDSTDTPIVGIIMESDSDLPVMNDAARTLSDFGVPYEIKILSPHQNRKGAL 157
+ EE+ NG P VGIIM SDSDLPVM DAA+ L++F VP E+KI+S H+ +
Sbjct: 441 VILNEESVNGHPAVAPRVGIIMGSDSDLPVMKDAAKILNEFDVPAEVKIVSAHRTPEMMF 500
Query: 158 SYALSAKERGIKIIIVGDGVEAHLSGTL 185
SYALSA+ERGI++II G G AHL G +
Sbjct: 501 SYALSARERGIQVIIAGAGGAAHLPGMV 528
|
Source: Nicotiana tabacum Species: Nicotiana tabacum Genus: Nicotiana Family: Solanaceae Order: Solanales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|37983592|gb|AAR06291.1| phosphoribosylaminoimidazole carboxylase, partial [Nicotiana tabacum] | Back alignment and taxonomy information |
|---|
| >gi|14590237|ref|NP_142303.1| phosphoribosylaminoimidazole carboxylase catalytic subunit [Pyrococcus horikoshii OT3] gi|3914493|sp|O58058.1|PURE_PYRHO RecName: Full=N5-carboxyaminoimidazole ribonucleotide mutase; Short=N5-CAIR mutase; AltName: Full=5-(carboxyamino)imidazole ribonucleotide mutase gi|3256711|dbj|BAA29394.1| 177aa long hypothetical phosphoribosylaminoimidazole carboxylase catalytic subunit [Pyrococcus horikoshii OT3] | Back alignment and taxonomy information |
|---|
| >gi|410667200|ref|YP_006919571.1| phosphoribosylaminoimidazole carboxylase catalytic subunit PurE [Thermacetogenium phaeum DSM 12270] gi|409104947|gb|AFV11072.1| phosphoribosylaminoimidazole carboxylase catalytic subunit PurE [Thermacetogenium phaeum DSM 12270] | Back alignment and taxonomy information |
|---|
| >gi|268316597|ref|YP_003290316.1| phosphoribosylaminoimidazole carboxylase catalytic subunit [Rhodothermus marinus DSM 4252] gi|262334131|gb|ACY47928.1| phosphoribosylaminoimidazole carboxylase, catalytic subunit [Rhodothermus marinus DSM 4252] | Back alignment and taxonomy information |
|---|
| >gi|449490248|ref|XP_004158550.1| PREDICTED: phosphoribosylaminoimidazole carboxylase, chloroplastic-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449442114|ref|XP_004138827.1| PREDICTED: phosphoribosylaminoimidazole carboxylase, chloroplastic-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|147859592|emb|CAN83526.1| hypothetical protein VITISV_024806 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|345303692|ref|YP_004825594.1| phosphoribosylaminoimidazole carboxylase, catalytic subunit [Rhodothermus marinus SG0.5JP17-172] gi|345112925|gb|AEN73757.1| phosphoribosylaminoimidazole carboxylase, catalytic subunit [Rhodothermus marinus SG0.5JP17-172] | Back alignment and taxonomy information |
|---|
| >gi|154249773|ref|YP_001410598.1| phosphoribosylaminoimidazole carboxylase, catalytic subunit [Fervidobacterium nodosum Rt17-B1] gi|154153709|gb|ABS60941.1| phosphoribosylaminoimidazole carboxylase, catalytic subunit [Fervidobacterium nodosum Rt17-B1] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 185 | ||||||
| SGD|S000005654 | 571 | ADE2 "Phosphoribosylaminoimida | 0.605 | 0.196 | 0.434 | 3.5e-16 | |
| UNIPROTKB|P96880 | 174 | purE "N5-carboxyaminoimidazole | 0.394 | 0.419 | 0.493 | 1.1e-14 | |
| CGD|CAL0003241 | 568 | ADE2 [Candida albicans (taxid: | 0.583 | 0.190 | 0.442 | 2.4e-14 | |
| UNIPROTKB|Q92210 | 568 | ADE2 "Phosphoribosylaminoimida | 0.583 | 0.190 | 0.442 | 2.4e-14 | |
| TIGR_CMR|GSU_0611 | 169 | GSU_0611 "phosphoribosylaminoi | 0.405 | 0.443 | 0.506 | 3.8e-14 | |
| TAIR|locus:2040771 | 642 | AT2G37690 [Arabidopsis thalian | 0.394 | 0.113 | 0.534 | 6.2e-14 | |
| POMBASE|SPCC1322.13 | 552 | ade6 "phosphoribosylaminoimida | 0.410 | 0.137 | 0.5 | 7.9e-14 | |
| UNIPROTKB|Q9KVT7 | 161 | purE "N5-carboxyaminoimidazole | 0.372 | 0.428 | 0.536 | 5.6e-13 | |
| TIGR_CMR|VC_0052 | 161 | VC_0052 "phosphoribosylaminoim | 0.372 | 0.428 | 0.536 | 5.6e-13 | |
| DICTYBASE|DDB_G0283987 | 997 | purC/E "PAICS" [Dictyostelium | 0.605 | 0.112 | 0.373 | 2.9e-12 |
| SGD|S000005654 ADE2 "Phosphoribosylaminoimidazole carboxylase" [Saccharomyces cerevisiae (taxid:4932)] | Back alignment and assigned GO terms |
|---|
Score = 210 (79.0 bits), Expect = 3.5e-16, P = 3.5e-16
Identities = 50/115 (43%), Positives = 68/115 (59%)
Query: 71 GTIPVLASSNGSATSTRKDYSSVRE--PSTVFEEENANGDSTDTPIVGIIMESDSDLPVM 128
G I ++ASS R +Y + R P + + + ++ P+VGIIM SDSDLPVM
Sbjct: 360 GHINIIASSMAECEQ-RLNYITGRTDIPIKISVAQKLDLEAMVKPLVGIIMGSDSDLPVM 418
Query: 129 NDAARTLSDFGVPYEIKILSPHQNRKGALSYALSAKERGIKIIIVGDGVEAHLSG 183
+ A L DFGVP+E+ I+S H+ +YA+SA +RGIK II G G AHL G
Sbjct: 419 SAACAVLKDFGVPFEVTIVSAHRTPHRMSAYAISASKRGIKTIIAGAGGAAHLPG 473
|
|
| UNIPROTKB|P96880 purE "N5-carboxyaminoimidazole ribonucleotide mutase" [Mycobacterium tuberculosis (taxid:1773)] | Back alignment and assigned GO terms |
|---|
| CGD|CAL0003241 ADE2 [Candida albicans (taxid:5476)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q92210 ADE2 "Phosphoribosylaminoimidazole carboxylase" [Candida albicans SC5314 (taxid:237561)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|GSU_0611 GSU_0611 "phosphoribosylaminoimidazole carboxylase, catalytic subunit" [Geobacter sulfurreducens PCA (taxid:243231)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2040771 AT2G37690 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| POMBASE|SPCC1322.13 ade6 "phosphoribosylaminoimidazole carboxylase Ade6" [Schizosaccharomyces pombe (taxid:4896)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9KVT7 purE "N5-carboxyaminoimidazole ribonucleotide mutase" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|VC_0052 VC_0052 "phosphoribosylaminoimidazole carboxylase, catalytic subunit" [Vibrio cholerae O1 biovar El Tor (taxid:686)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0283987 purC/E "PAICS" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 185 | |||
| PLN02948 | 577 | PLN02948, PLN02948, phosphoribosylaminoimidazole c | 8e-27 | |
| pfam00731 | 150 | pfam00731, AIRC, AIR carboxylase | 6e-25 | |
| smart01001 | 152 | smart01001, AIRC, AIR carboxylase | 8e-25 | |
| COG0041 | 162 | COG0041, PurE, Phosphoribosylcarboxyaminoimidazole | 2e-24 | |
| TIGR01162 | 156 | TIGR01162, purE, phosphoribosylaminoimidazole carb | 4e-22 |
| >gnl|CDD|178534 PLN02948, PLN02948, phosphoribosylaminoimidazole carboxylase | Back alignment and domain information |
|---|
Score = 105 bits (264), Expect = 8e-27
Identities = 42/73 (57%), Positives = 50/73 (68%)
Query: 111 DTPIVGIIMESDSDLPVMNDAARTLSDFGVPYEIKILSPHQNRKGALSYALSAKERGIKI 170
TP+VGIIM SDSDLP M DAA L FGVPYE+ I+S H+ + SYA SA RG+++
Sbjct: 409 GTPLVGIIMGSDSDLPTMKDAAEILDSFGVPYEVTIVSAHRTPERMFSYARSAHSRGLQV 468
Query: 171 IIVGDGVEAHLSG 183
II G G AHL G
Sbjct: 469 IIAGAGGAAHLPG 481
|
Length = 577 |
| >gnl|CDD|144362 pfam00731, AIRC, AIR carboxylase | Back alignment and domain information |
|---|
| >gnl|CDD|214965 smart01001, AIRC, AIR carboxylase | Back alignment and domain information |
|---|
| >gnl|CDD|223119 COG0041, PurE, Phosphoribosylcarboxyaminoimidazole (NCAIR) mutase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|130230 TIGR01162, purE, phosphoribosylaminoimidazole carboxylase, PurE protein | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 185 | |||
| COG0041 | 162 | PurE Phosphoribosylcarboxyaminoimidazole (NCAIR) m | 99.97 | |
| TIGR01162 | 156 | purE phosphoribosylaminoimidazole carboxylase, Pur | 99.94 | |
| PLN02948 | 577 | phosphoribosylaminoimidazole carboxylase | 99.93 | |
| PF00731 | 150 | AIRC: AIR carboxylase; InterPro: IPR000031 Phospho | 99.93 | |
| COG1691 | 254 | NCAIR mutase (PurE)-related proteins [General func | 99.43 | |
| KOG2835 | 373 | consensus Phosphoribosylamidoimidazole-succinocarb | 98.96 | |
| cd08170 | 351 | GlyDH Glycerol dehydrogenases (GlyDH) catalyzes ox | 95.88 | |
| cd08550 | 349 | GlyDH-like Glycerol_dehydrogenase-like. Families o | 95.81 | |
| cd08185 | 380 | Fe-ADH1 Iron-containing alcohol dehydrogenases-lik | 95.23 | |
| cd08183 | 374 | Fe-ADH2 Iron-containing alcohol dehydrogenases-lik | 95.05 | |
| cd08551 | 370 | Fe-ADH iron-containing alcohol dehydrogenases (Fe- | 94.85 | |
| PRK09423 | 366 | gldA glycerol dehydrogenase; Provisional | 94.64 | |
| cd08171 | 345 | GlyDH-like2 Glycerol dehydrogenase-like. Glycerol | 94.64 | |
| cd08195 | 345 | DHQS Dehydroquinate synthase (DHQS) catalyzes the | 94.55 | |
| cd08175 | 348 | G1PDH Glycerol-1-phosphate dehydrogenase (G1PDH) c | 94.49 | |
| TIGR01357 | 344 | aroB 3-dehydroquinate synthase. This model represe | 94.24 | |
| PRK00843 | 350 | egsA NAD(P)-dependent glycerol-1-phosphate dehydro | 94.23 | |
| cd08182 | 367 | HEPD Hydroxyethylphosphoate dehydrogenase (HEPD) c | 94.2 | |
| cd08194 | 375 | Fe-ADH6 Iron-containing alcohol dehydrogenases-lik | 94.1 | |
| cd08186 | 383 | Fe-ADH8 Iron-containing alcohol dehydrogenase. Typ | 94.02 | |
| cd08176 | 377 | LPO Lactadehyde:propanediol oxidoreductase (LPO) c | 93.98 | |
| PF00465 | 366 | Fe-ADH: Iron-containing alcohol dehydrogenase ; In | 93.9 | |
| cd08178 | 398 | AAD_C C-terminal alcohol dehydrogenase domain of t | 93.79 | |
| cd08187 | 382 | BDH Butanol dehydrogenase catalyzes the conversion | 93.6 | |
| cd08192 | 370 | Fe-ADH7 Iron-containing alcohol dehydrogenases-lik | 93.48 | |
| PRK00002 | 358 | aroB 3-dehydroquinate synthase; Reviewed | 93.41 | |
| cd08181 | 357 | PPD-like 1,3-propanediol dehydrogenase-like (PPD). | 93.37 | |
| TIGR02638 | 379 | lactal_redase lactaldehyde reductase. This clade o | 93.36 | |
| cd08197 | 355 | DOIS 2-deoxy-scyllo-inosose synthase (DOIS) cataly | 93.14 | |
| cd08173 | 339 | Gro1PDH Sn-glycerol-1-phosphate dehydrogenase (Gro | 93.1 | |
| cd08179 | 375 | NADPH_BDH NADPH-dependent butanol dehydrogenase in | 93.08 | |
| cd08188 | 377 | Fe-ADH4 Iron-containing alcohol dehydrogenases-lik | 93.02 | |
| cd08189 | 374 | Fe-ADH5 Iron-containing alcohol dehydrogenases-lik | 92.89 | |
| PRK10624 | 382 | L-1,2-propanediol oxidoreductase; Provisional | 92.88 | |
| cd07766 | 332 | DHQ_Fe-ADH Dehydroquinate synthase-like (DHQ-like) | 92.46 | |
| cd08193 | 376 | HVD 5-hydroxyvalerate dehydrogenase (HVD) catalyze | 92.41 | |
| cd08190 | 414 | HOT Hydroxyacid-oxoacid transhydrogenase (HOT) inv | 92.28 | |
| PRK15454 | 395 | ethanol dehydrogenase EutG; Provisional | 92.28 | |
| cd08199 | 354 | EEVS 2-epi-5-epi-valiolone synthase (EEVS). 2-epi- | 92.11 | |
| PRK09860 | 383 | putative alcohol dehydrogenase; Provisional | 91.73 | |
| cd08549 | 332 | G1PDH_related Glycerol-1-phosphate_dehydrogenase a | 91.48 | |
| PF04392 | 294 | ABC_sub_bind: ABC transporter substrate binding pr | 91.05 | |
| PRK15138 | 387 | aldehyde reductase; Provisional | 90.79 | |
| PF10096 | 243 | DUF2334: Uncharacterized protein conserved in bact | 90.67 | |
| cd03028 | 90 | GRX_PICOT_like Glutaredoxin (GRX) family, PKC-inte | 90.59 | |
| PRK01372 | 304 | ddl D-alanine--D-alanine ligase; Reviewed | 90.52 | |
| cd08191 | 386 | HHD 6-hydroxyhexanoate dehydrogenase (HHD) catalyz | 89.95 | |
| cd03786 | 363 | GT1_UDP-GlcNAc_2-Epimerase Bacterial members of th | 89.62 | |
| PLN02834 | 433 | 3-dehydroquinate synthase | 89.27 | |
| PRK11914 | 306 | diacylglycerol kinase; Reviewed | 89.12 | |
| PRK13055 | 334 | putative lipid kinase; Reviewed | 88.65 | |
| PRK10703 | 341 | DNA-binding transcriptional repressor PurR; Provis | 88.62 | |
| cd08180 | 332 | PDD 1,3-propanediol dehydrogenase (PPD) catalyzes | 88.55 | |
| cd08177 | 337 | MAR Maleylacetate reductase is involved in many ar | 88.48 | |
| TIGR00365 | 97 | monothiol glutaredoxin, Grx4 family. The gene for | 88.23 | |
| TIGR03702 | 293 | lip_kinase_YegS lipid kinase YegS. Members of this | 87.25 | |
| PRK00861 | 300 | putative lipid kinase; Reviewed | 87.19 | |
| PF13407 | 257 | Peripla_BP_4: Periplasmic binding protein domain; | 86.17 | |
| COG2984 | 322 | ABC-type uncharacterized transport system, peripla | 85.52 | |
| cd01391 | 269 | Periplasmic_Binding_Protein_Type_1 Type 1 periplas | 85.27 | |
| PRK10727 | 343 | DNA-binding transcriptional regulator GalR; Provis | 85.26 | |
| cd01539 | 303 | PBP1_GGBP Periplasmic glucose/galactose-binding pr | 84.73 | |
| cd08172 | 347 | GlyDH-like1 Glycerol dehydrogenases-like. Glycerol | 84.46 | |
| cd08169 | 344 | DHQ-like Dehydroquinate synthase-like which includ | 84.33 | |
| cd06318 | 282 | PBP1_ABC_sugar_binding_like_9 Periplasmic sugar-bi | 84.3 | |
| PRK14987 | 331 | gluconate operon transcriptional regulator; Provis | 84.17 | |
| PRK13054 | 300 | lipid kinase; Reviewed | 84.12 | |
| COG1454 | 377 | EutG Alcohol dehydrogenase, class IV [Energy produ | 84.05 | |
| PRK13337 | 304 | putative lipid kinase; Reviewed | 83.83 | |
| PRK10586 | 362 | putative oxidoreductase; Provisional | 83.83 | |
| PRK13805 | 862 | bifunctional acetaldehyde-CoA/alcohol dehydrogenas | 83.68 | |
| cd08184 | 347 | Fe-ADH3 Iron-containing alcohol dehydrogenases-lik | 83.66 | |
| TIGR00147 | 293 | lipid kinase, YegS/Rv2252/BmrU family. The E. coli | 83.61 | |
| cd06321 | 271 | PBP1_ABC_sugar_binding_like_11 Periplasmic sugar-b | 83.06 | |
| PRK10653 | 295 | D-ribose transporter subunit RbsB; Provisional | 83.0 | |
| COG0695 | 80 | GrxC Glutaredoxin and related proteins [Posttransl | 82.87 | |
| PF00763 | 117 | THF_DHG_CYH: Tetrahydrofolate dehydrogenase/cycloh | 82.86 | |
| cd06273 | 268 | PBP1_GntR_like_1 This group includes the ligand-bi | 82.63 | |
| cd01542 | 259 | PBP1_TreR_like Ligand-binding domain of DNA transc | 82.61 | |
| cd01988 | 132 | Na_H_Antiporter_C The C-terminal domain of a subfa | 82.29 | |
| PRK10014 | 342 | DNA-binding transcriptional repressor MalI; Provis | 82.22 | |
| cd06305 | 273 | PBP1_methylthioribose_binding_like Methylthioribos | 82.07 | |
| cd00860 | 91 | ThrRS_anticodon ThrRS Threonyl-anticodon binding d | 81.78 | |
| PRK10076 | 213 | pyruvate formate lyase II activase; Provisional | 81.04 | |
| cd01537 | 264 | PBP1_Repressors_Sugar_Binding_like Ligand-binding | 80.85 | |
| COG1597 | 301 | LCB5 Sphingosine kinase and enzymes related to euk | 80.78 | |
| PRK09492 | 315 | treR trehalose repressor; Provisional | 80.58 | |
| cd06296 | 270 | PBP1_CatR_like Ligand-binding domain of a LacI-lik | 80.45 | |
| cd06283 | 267 | PBP1_RegR_EndR_KdgR_like Ligand-binding domain of | 80.38 | |
| PF03358 | 152 | FMN_red: NADPH-dependent FMN reductase; InterPro: | 80.33 | |
| PRK08862 | 227 | short chain dehydrogenase; Provisional | 80.26 | |
| TIGR01481 | 329 | ccpA catabolite control protein A. Catabolite cont | 80.18 | |
| PRK08195 | 337 | 4-hyroxy-2-oxovalerate/4-hydroxy-2-oxopentanoic ac | 80.14 |
| >COG0041 PurE Phosphoribosylcarboxyaminoimidazole (NCAIR) mutase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
Probab=99.97 E-value=1.6e-31 Score=219.17 Aligned_cols=73 Identities=49% Similarity=0.840 Sum_probs=71.5
Q ss_pred CeEEEEeccCCCHHHHHHHHHHHHHhCCCeeEEEEcCCCCchHHHHHHHHHhhCCCeEEEEecCccCcCcCCC
Q 029926 113 PIVGIIMESDSDLPVMNDAARTLSDFGVPYEIKILSPHQNRKGALSYALSAKERGIKIIIVGDGVEAHLSGTL 185 (185)
Q Consensus 113 ~kVaIIMGS~SDl~vmekA~~vLeefGIpyEvrVaSAHRtPe~l~ey~k~ae~~GikVIIAvAG~AAhLPGVV 185 (185)
++|+|||||+|||++|++|.++|++|||+||++|+||||||+++.+|+++++++|++||||+||+||||||||
T Consensus 3 ~~V~IIMGS~SD~~~mk~Aa~~L~~fgi~ye~~VvSAHRTPe~m~~ya~~a~~~g~~viIAgAGgAAHLPGmv 75 (162)
T COG0041 3 PKVGIIMGSKSDWDTMKKAAEILEEFGVPYEVRVVSAHRTPEKMFEYAEEAEERGVKVIIAGAGGAAHLPGMV 75 (162)
T ss_pred ceEEEEecCcchHHHHHHHHHHHHHcCCCeEEEEEeccCCHHHHHHHHHHHHHCCCeEEEecCcchhhcchhh
Confidence 3799999999999999999999999999999999999999999999999999999999999999999999986
|
|
| >TIGR01162 purE phosphoribosylaminoimidazole carboxylase, PurE protein | Back alignment and domain information |
|---|
| >PLN02948 phosphoribosylaminoimidazole carboxylase | Back alignment and domain information |
|---|
| >PF00731 AIRC: AIR carboxylase; InterPro: IPR000031 Phosphoribosylaminoimidazole carboxylase is a fusion protein in plants and fungi, but consists of two non-interacting proteins in bacteria, PurK and PurE | Back alignment and domain information |
|---|
| >COG1691 NCAIR mutase (PurE)-related proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2835 consensus Phosphoribosylamidoimidazole-succinocarboxamide synthase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >cd08170 GlyDH Glycerol dehydrogenases (GlyDH) catalyzes oxidation of glycerol to dihydroxyacetone in glycerol dissmilation | Back alignment and domain information |
|---|
| >cd08550 GlyDH-like Glycerol_dehydrogenase-like | Back alignment and domain information |
|---|
| >cd08185 Fe-ADH1 Iron-containing alcohol dehydrogenases-like | Back alignment and domain information |
|---|
| >cd08183 Fe-ADH2 Iron-containing alcohol dehydrogenases-like | Back alignment and domain information |
|---|
| >cd08551 Fe-ADH iron-containing alcohol dehydrogenases (Fe-ADH)-like | Back alignment and domain information |
|---|
| >PRK09423 gldA glycerol dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd08171 GlyDH-like2 Glycerol dehydrogenase-like | Back alignment and domain information |
|---|
| >cd08195 DHQS Dehydroquinate synthase (DHQS) catalyzes the conversion of DAHP to DHQ in shikimate pathway for aromatic compounds synthesis | Back alignment and domain information |
|---|
| >cd08175 G1PDH Glycerol-1-phosphate dehydrogenase (G1PDH) catalyzes the reversible reduction of dihydroxyacetone phosphate (DHAP) to glycerol-1-phosphate (G1P) in an NADH-dependent manner | Back alignment and domain information |
|---|
| >TIGR01357 aroB 3-dehydroquinate synthase | Back alignment and domain information |
|---|
| >PRK00843 egsA NAD(P)-dependent glycerol-1-phosphate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >cd08182 HEPD Hydroxyethylphosphoate dehydrogenase (HEPD) catalyzes the reduction of phosphonoacetaldehyde (PnAA) to hydroxyethylphosphoate (HEP) | Back alignment and domain information |
|---|
| >cd08194 Fe-ADH6 Iron-containing alcohol dehydrogenases-like | Back alignment and domain information |
|---|
| >cd08186 Fe-ADH8 Iron-containing alcohol dehydrogenase | Back alignment and domain information |
|---|
| >cd08176 LPO Lactadehyde:propanediol oxidoreductase (LPO) catalyzes the interconversion between L-lactaldehyde and L-1,2-propanediol in Escherichia coli and other enterobacteria | Back alignment and domain information |
|---|
| >PF00465 Fe-ADH: Iron-containing alcohol dehydrogenase ; InterPro: IPR001670 Alcohol dehydrogenase (1 | Back alignment and domain information |
|---|
| >cd08178 AAD_C C-terminal alcohol dehydrogenase domain of the acetaldehyde dehydrogenase-alcohol dehydrogenase bifunctional two-domain protein (AAD) | Back alignment and domain information |
|---|
| >cd08187 BDH Butanol dehydrogenase catalyzes the conversion of butyraldehyde to butanol with the cofactor NAD(P)H being oxidized in the process | Back alignment and domain information |
|---|
| >cd08192 Fe-ADH7 Iron-containing alcohol dehydrogenases-like, involved in the linear alkylbenzenesulfonate (LAS) degradation pathway | Back alignment and domain information |
|---|
| >PRK00002 aroB 3-dehydroquinate synthase; Reviewed | Back alignment and domain information |
|---|
| >cd08181 PPD-like 1,3-propanediol dehydrogenase-like (PPD) | Back alignment and domain information |
|---|
| >TIGR02638 lactal_redase lactaldehyde reductase | Back alignment and domain information |
|---|
| >cd08197 DOIS 2-deoxy-scyllo-inosose synthase (DOIS) catalyzes carbocycle formation from D-glucose-6-phosphate to 2-deoxy-scyllo-inosose through a multistep reaction in the biosynthesis of aminoglycoside antibiotics | Back alignment and domain information |
|---|
| >cd08173 Gro1PDH Sn-glycerol-1-phosphate dehydrogenase (Gro1PDH) catalyzes the reversible conversion between dihydroxyacetone phosphate and glycerol-1-phosphate using either NADH or NADPH as a coenzyme | Back alignment and domain information |
|---|
| >cd08179 NADPH_BDH NADPH-dependent butanol dehydrogenase involved in the butanol and ethanol formation pathway in bacteria | Back alignment and domain information |
|---|
| >cd08188 Fe-ADH4 Iron-containing alcohol dehydrogenases-like | Back alignment and domain information |
|---|
| >cd08189 Fe-ADH5 Iron-containing alcohol dehydrogenases-like | Back alignment and domain information |
|---|
| >PRK10624 L-1,2-propanediol oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >cd07766 DHQ_Fe-ADH Dehydroquinate synthase-like (DHQ-like) and iron-containing alcohol dehydrogenases (Fe-ADH) | Back alignment and domain information |
|---|
| >cd08193 HVD 5-hydroxyvalerate dehydrogenase (HVD) catalyzes the oxidation of 5-hydroxyvalerate to 5-oxovalerate with NAD+ as cofactor | Back alignment and domain information |
|---|
| >cd08190 HOT Hydroxyacid-oxoacid transhydrogenase (HOT) involved in gamma-hydroxybutyrate metabolism | Back alignment and domain information |
|---|
| >PRK15454 ethanol dehydrogenase EutG; Provisional | Back alignment and domain information |
|---|
| >cd08199 EEVS 2-epi-5-epi-valiolone synthase (EEVS) | Back alignment and domain information |
|---|
| >PRK09860 putative alcohol dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd08549 G1PDH_related Glycerol-1-phosphate_dehydrogenase and related proteins | Back alignment and domain information |
|---|
| >PF04392 ABC_sub_bind: ABC transporter substrate binding protein; InterPro: IPR007487 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems | Back alignment and domain information |
|---|
| >PRK15138 aldehyde reductase; Provisional | Back alignment and domain information |
|---|
| >PF10096 DUF2334: Uncharacterized protein conserved in bacteria (DUF2334); InterPro: IPR018763 This group of proteins has no known function | Back alignment and domain information |
|---|
| >cd03028 GRX_PICOT_like Glutaredoxin (GRX) family, PKC-interacting cousin of TRX (PICOT)-like subfamily; composed of PICOT and GRX-PICOT-like proteins | Back alignment and domain information |
|---|
| >PRK01372 ddl D-alanine--D-alanine ligase; Reviewed | Back alignment and domain information |
|---|
| >cd08191 HHD 6-hydroxyhexanoate dehydrogenase (HHD) catalyzes the oxidation of 6-hydroxyhexanoate to 6-oxohexanoate | Back alignment and domain information |
|---|
| >cd03786 GT1_UDP-GlcNAc_2-Epimerase Bacterial members of the UDP-N-Acetylglucosamine (GlcNAc) 2-Epimerase family are known to catalyze the reversible interconversion of UDP-GlcNAc and UDP-N-acetylmannosamine (UDP-ManNAc) | Back alignment and domain information |
|---|
| >PLN02834 3-dehydroquinate synthase | Back alignment and domain information |
|---|
| >PRK11914 diacylglycerol kinase; Reviewed | Back alignment and domain information |
|---|
| >PRK13055 putative lipid kinase; Reviewed | Back alignment and domain information |
|---|
| >PRK10703 DNA-binding transcriptional repressor PurR; Provisional | Back alignment and domain information |
|---|
| >cd08180 PDD 1,3-propanediol dehydrogenase (PPD) catalyzes the reduction of 3-hydroxypropionaldehyde (3-HPA) to 1,3-propanediol in glycerol metabolism | Back alignment and domain information |
|---|
| >cd08177 MAR Maleylacetate reductase is involved in many aromatic compounds degradation pathways of aerobic microbes | Back alignment and domain information |
|---|
| >TIGR00365 monothiol glutaredoxin, Grx4 family | Back alignment and domain information |
|---|
| >TIGR03702 lip_kinase_YegS lipid kinase YegS | Back alignment and domain information |
|---|
| >PRK00861 putative lipid kinase; Reviewed | Back alignment and domain information |
|---|
| >PF13407 Peripla_BP_4: Periplasmic binding protein domain; PDB: 3BRS_B 3GBP_A 3GA5_A 1GCG_A 1GCA_A 3H75_A 3D02_A 3L49_B 3EJW_B 3T95_A | Back alignment and domain information |
|---|
| >COG2984 ABC-type uncharacterized transport system, periplasmic component [General function prediction only] | Back alignment and domain information |
|---|
| >cd01391 Periplasmic_Binding_Protein_Type_1 Type 1 periplasmic binding fold superfamily | Back alignment and domain information |
|---|
| >PRK10727 DNA-binding transcriptional regulator GalR; Provisional | Back alignment and domain information |
|---|
| >cd01539 PBP1_GGBP Periplasmic glucose/galactose-binding protein (GGBP) involved in chemotaxis towards, and active transport of, glucose and galactose in various bacterial species | Back alignment and domain information |
|---|
| >cd08172 GlyDH-like1 Glycerol dehydrogenases-like | Back alignment and domain information |
|---|
| >cd08169 DHQ-like Dehydroquinate synthase-like which includes dehydroquinate synthase, 2-deoxy-scyllo-inosose synthase, and 2-epi-5-epi-valiolone synthase | Back alignment and domain information |
|---|
| >cd06318 PBP1_ABC_sugar_binding_like_9 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems | Back alignment and domain information |
|---|
| >PRK14987 gluconate operon transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >PRK13054 lipid kinase; Reviewed | Back alignment and domain information |
|---|
| >COG1454 EutG Alcohol dehydrogenase, class IV [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK13337 putative lipid kinase; Reviewed | Back alignment and domain information |
|---|
| >PRK10586 putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK13805 bifunctional acetaldehyde-CoA/alcohol dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd08184 Fe-ADH3 Iron-containing alcohol dehydrogenases-like | Back alignment and domain information |
|---|
| >TIGR00147 lipid kinase, YegS/Rv2252/BmrU family | Back alignment and domain information |
|---|
| >cd06321 PBP1_ABC_sugar_binding_like_11 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems | Back alignment and domain information |
|---|
| >PRK10653 D-ribose transporter subunit RbsB; Provisional | Back alignment and domain information |
|---|
| >COG0695 GrxC Glutaredoxin and related proteins [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF00763 THF_DHG_CYH: Tetrahydrofolate dehydrogenase/cyclohydrolase, catalytic domain; InterPro: IPR020630 Enzymes that participate in the transfer of one-carbon units require the coenzyme tetrahydrofolate (THF) | Back alignment and domain information |
|---|
| >cd06273 PBP1_GntR_like_1 This group includes the ligand-binding domain of putative DNA transcription repressors which are highly similar to that of the repressor specific for gluconate (GntR), a member of the LacI-GalR family of bacterial transcription regulators | Back alignment and domain information |
|---|
| >cd01542 PBP1_TreR_like Ligand-binding domain of DNA transcription repressor specific for trehalose (TreR) which is a member of the LacI-GalR family of bacterial transcription regulators | Back alignment and domain information |
|---|
| >cd01988 Na_H_Antiporter_C The C-terminal domain of a subfamily of Na+ /H+ antiporter existed in bacteria and archea | Back alignment and domain information |
|---|
| >PRK10014 DNA-binding transcriptional repressor MalI; Provisional | Back alignment and domain information |
|---|
| >cd06305 PBP1_methylthioribose_binding_like Methylthioribose-binding protein-like of ABC-type transport systems that belong to a family of pentose/hexose sugar-binding proteins of the type I periplasmic binding protein (PBP1) superfamily | Back alignment and domain information |
|---|
| >cd00860 ThrRS_anticodon ThrRS Threonyl-anticodon binding domain | Back alignment and domain information |
|---|
| >PRK10076 pyruvate formate lyase II activase; Provisional | Back alignment and domain information |
|---|
| >cd01537 PBP1_Repressors_Sugar_Binding_like Ligand-binding domain of the LacI-GalR family of transcription regulators and the sugar-binding domain of ABC-type transport systems | Back alignment and domain information |
|---|
| >COG1597 LCB5 Sphingosine kinase and enzymes related to eukaryotic diacylglycerol kinase [Lipid metabolism / General function prediction only] | Back alignment and domain information |
|---|
| >PRK09492 treR trehalose repressor; Provisional | Back alignment and domain information |
|---|
| >cd06296 PBP1_CatR_like Ligand-binding domain of a LacI-like transcriptional regulator, CatR which is involved in catechol degradation | Back alignment and domain information |
|---|
| >cd06283 PBP1_RegR_EndR_KdgR_like Ligand-binding domain of DNA transcription repressor RegR and other putative regulators such as KdgR and EndR | Back alignment and domain information |
|---|
| >PF03358 FMN_red: NADPH-dependent FMN reductase; InterPro: IPR005025 NADPH-dependent FMN reductase (1 | Back alignment and domain information |
|---|
| >PRK08862 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01481 ccpA catabolite control protein A | Back alignment and domain information |
|---|
| >PRK08195 4-hyroxy-2-oxovalerate/4-hydroxy-2-oxopentanoic acid aldolase,; Validated | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 185 | ||||
| 1o4v_A | 183 | Crystal Structure Of The Catalytic Subunit Of A Pho | 8e-16 | ||
| 3lp6_A | 174 | Crystal Structure Of Rv3275c-E60a From Mycobacteriu | 5e-12 | ||
| 1xmp_A | 170 | Crystal Structure Of Pure (Ba0288) From Bacillus An | 9e-11 | ||
| 4b4k_A | 181 | Crystal Structure Of Bacillus Anthracis Pure Length | 1e-10 | ||
| 1u11_A | 182 | Pure (N5-Carboxyaminoimidazole Ribonucleotide Mutas | 2e-10 | ||
| 2fw1_A | 183 | Structure Of Pure (n5-carboxyaminoimidazole Ribonuc | 2e-10 | ||
| 4grd_A | 173 | Crystal Structure Of Phosphoribosylaminoimidazole C | 2e-10 | ||
| 2fwa_A | 183 | Structure Of Pure (n5-carboxyaminoimidazole Ribonuc | 2e-09 | ||
| 2fw6_A | 183 | Structure Of Pure (N5-Carboxyaminoimidazole Ribonuc | 2e-09 | ||
| 3opq_A | 163 | Phosphoribosylaminoimidazole Carboxylase With Fruct | 2e-09 | ||
| 3oow_A | 166 | Octameric Structure Of The Phosphoribosylaminoimida | 2e-09 | ||
| 2fwi_A | 183 | Structure Of Pure (n5-carboxyaminoimidazole Ribonuc | 3e-09 | ||
| 2fwb_A | 183 | Structure Of Pure (N5-Carboxyaminoimidazole Ribonuc | 4e-09 | ||
| 2fw9_A | 183 | Structure Of Pure (n5-carboxyaminoimidazole Ribonuc | 4e-09 | ||
| 2fw8_A | 183 | Structure Of Pure (N5-Carboxyaminoimidazole Ribonuc | 4e-07 | ||
| 2nsl_A | 169 | E. Coli Pure H45n Mutant Complexed With Cair Length | 5e-07 | ||
| 2nsh_A | 169 | E. Coli Pure H45q Mutant Complexed With Nitro-Air L | 5e-07 | ||
| 3kuu_A | 174 | Structure Of The Pure Phosphoribosylaminoimidazole | 1e-06 | ||
| 1qcz_A | 169 | Crystal Structure Of E. Coli Pure, An Unusual Mutas | 2e-06 | ||
| 2ate_A | 169 | Structure Of The Complex Of Pure With Nitroair Leng | 2e-06 | ||
| 1d7a_A | 161 | Crystal Structure Of E. Coli Pure-Mononucleotide Co | 2e-06 | ||
| 3ors_A | 163 | Crystal Structure Of N5-Carboxyaminoimidazole Ribon | 4e-05 | ||
| 3trh_A | 169 | Structure Of A Phosphoribosylaminoimidazole Carboxy | 2e-04 |
| >pdb|1O4V|A Chain A, Crystal Structure Of The Catalytic Subunit Of A Phosphoribosylaminoimidazole Mutase (Tm0446) From Thermotoga Maritima At 1.77 A Resolution Length = 183 | Back alignment and structure |
|
| >pdb|3LP6|A Chain A, Crystal Structure Of Rv3275c-E60a From Mycobacterium Tubercu 1.7a Resolution Length = 174 | Back alignment and structure |
| >pdb|1XMP|A Chain A, Crystal Structure Of Pure (Ba0288) From Bacillus Anthracis At 1.8 Resolution Length = 170 | Back alignment and structure |
| >pdb|4B4K|A Chain A, Crystal Structure Of Bacillus Anthracis Pure Length = 181 | Back alignment and structure |
| >pdb|1U11|A Chain A, Pure (N5-Carboxyaminoimidazole Ribonucleotide Mutase) From The Acidophile Acetobacter Aceti Length = 182 | Back alignment and structure |
| >pdb|2FW1|A Chain A, Structure Of Pure (n5-carboxyaminoimidazole Ribonucleotide Mutase) From The Acidophilic Bacterium Acetobacter Aceti, At Ph 8.5 Length = 183 | Back alignment and structure |
| >pdb|4GRD|A Chain A, Crystal Structure Of Phosphoribosylaminoimidazole Carboxylase Catalytic Subunit From Burkholderia Cenocepacia J2315 Length = 173 | Back alignment and structure |
| >pdb|2FWA|A Chain A, Structure Of Pure (n5-carboxyaminoimidazole Ribonucleotide Mutase) H89n From The Acidophilic Bacterium Acetobacter Aceti, At Ph 7 Length = 183 | Back alignment and structure |
| >pdb|2FW6|A Chain A, Structure Of Pure (N5-Carboxyaminoimidazole Ribonucleotide Mutase) Mutant H59n From The Acidophilic Bacterium Acetobacter Aceti, At Ph 5.4 Length = 183 | Back alignment and structure |
| >pdb|3OPQ|A Chain A, Phosphoribosylaminoimidazole Carboxylase With Fructose-6-Phosphate Bound To The Central Channel Of The Octameric Protein Structure. Length = 163 | Back alignment and structure |
| >pdb|3OOW|A Chain A, Octameric Structure Of The Phosphoribosylaminoimidazole Carboxylase Catalytic Subunit From Francisella Tularensis Subsp. Tularensis Schu S4. Length = 166 | Back alignment and structure |
| >pdb|2FWI|A Chain A, Structure Of Pure (n5-carboxyaminoimidazole Ribonucleotide Mutase) H59d, From The Acidophilic Bacterium Acetobacter Aceti, Complexed With 5-aminoimidazole Ribonucleotide (air) Length = 183 | Back alignment and structure |
| >pdb|2FWB|A Chain A, Structure Of Pure (N5-Carboxyaminoimidazole Ribonucleotide Mutase) H89f From The Acidophilic Bacterium Acetobacter Aceti, At Ph 8 Length = 183 | Back alignment and structure |
| >pdb|2FW9|A Chain A, Structure Of Pure (n5-carboxyaminoimidazole Ribonucleotide Mutase) H59f From The Acidophilic Bacterium Acetobacter Aceti, At Ph 8 Length = 183 | Back alignment and structure |
| >pdb|2FW8|A Chain A, Structure Of Pure (N5-Carboxyaminoimidazole Ribonucleotide Mutase) H89g From The Acidophilic Bacterium Acetobacter Aceti, At Ph 8 Length = 183 | Back alignment and structure |
| >pdb|2NSL|A Chain A, E. Coli Pure H45n Mutant Complexed With Cair Length = 169 | Back alignment and structure |
| >pdb|2NSH|A Chain A, E. Coli Pure H45q Mutant Complexed With Nitro-Air Length = 169 | Back alignment and structure |
| >pdb|3KUU|A Chain A, Structure Of The Pure Phosphoribosylaminoimidazole Carboxylase Catalytic Subunit From Yersinia Pestis Length = 174 | Back alignment and structure |
| >pdb|1QCZ|A Chain A, Crystal Structure Of E. Coli Pure, An Unusual Mutase That Catalyzes The Conversion Of N5-carboxyaminoimidazole Ribonucleotide (n5-cair) To 4-carboxyaminoimidazole Ribonucleotide (cair) In The Purine Biosynthetic Pathway Length = 169 | Back alignment and structure |
| >pdb|2ATE|A Chain A, Structure Of The Complex Of Pure With Nitroair Length = 169 | Back alignment and structure |
| >pdb|1D7A|A Chain A, Crystal Structure Of E. Coli Pure-Mononucleotide Complex. Length = 161 | Back alignment and structure |
| >pdb|3ORS|A Chain A, Crystal Structure Of N5-Carboxyaminoimidazole Ribonucleotide Mutase From Staphylococcus Aureus Length = 163 | Back alignment and structure |
| >pdb|3TRH|A Chain A, Structure Of A Phosphoribosylaminoimidazole Carboxylase Catalytic Subunit (Pure) From Coxiella Burnetii Length = 169 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 185 | |||
| 1o4v_A | 183 | Phosphoribosylaminoimidazole mutase PURE; structur | 1e-29 | |
| 3lp6_A | 174 | Phosphoribosylaminoimidazole carboxylase catalyti; | 2e-28 | |
| 3trh_A | 169 | Phosphoribosylaminoimidazole carboxylase carboxylt | 1e-26 | |
| 3rg8_A | 159 | Phosphoribosylaminoimidazole carboxylase, PURE PR; | 2e-26 | |
| 4b4k_A | 181 | N5-carboxyaminoimidazole ribonucleotide mutase; is | 4e-26 | |
| 3ors_A | 163 | N5-carboxyaminoimidazole ribonucleotide mutase; is | 4e-26 | |
| 1xmp_A | 170 | PURE, phosphoribosylaminoimidazole carboxylase; pu | 4e-26 | |
| 3kuu_A | 174 | Phosphoribosylaminoimidazole carboxylase catalyti | 3e-25 | |
| 3oow_A | 166 | Phosphoribosylaminoimidazole carboxylase,catalyic; | 3e-25 | |
| 1u11_A | 182 | PURE (N5-carboxyaminoimidazole ribonucleotide MUT; | 3e-25 | |
| 2ywx_A | 157 | Phosphoribosylaminoimidazole carboxylase catalyti; | 8e-22 | |
| 2h31_A | 425 | Multifunctional protein ADE2; alpha-beta-alpha, li | 1e-14 |
| >1o4v_A Phosphoribosylaminoimidazole mutase PURE; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; 1.77A {Thermotoga maritima} SCOP: c.23.8.1 Length = 183 | Back alignment and structure |
|---|
Score = 106 bits (266), Expect = 1e-29
Identities = 40/82 (48%), Positives = 50/82 (60%)
Query: 102 EENANGDSTDTPIVGIIMESDSDLPVMNDAARTLSDFGVPYEIKILSPHQNRKGALSYAL 161
+ + P VGIIM SDSDLPVM AA L +FG+ YEI I+S H+ YA
Sbjct: 3 SDKIHHHHHHVPRVGIIMGSDSDLPVMKQAAEILEEFGIDYEITIVSAHRTPDRMFEYAK 62
Query: 162 SAKERGIKIIIVGDGVEAHLSG 183
+A+ERGI++II G G AHL G
Sbjct: 63 NAEERGIEVIIAGAGGAAHLPG 84
|
| >3lp6_A Phosphoribosylaminoimidazole carboxylase catalyti; alpha and beta protein, structural genomics, PSI-2, protein initiative; 1.70A {Mycobacterium tuberculosis} Length = 174 | Back alignment and structure |
|---|
| >3trh_A Phosphoribosylaminoimidazole carboxylase carboxyltransferase subunit; purines, pyrimidines, nucleosides, nucleotides, lyase; 2.20A {Coxiella burnetii} Length = 169 | Back alignment and structure |
|---|
| >3rg8_A Phosphoribosylaminoimidazole carboxylase, PURE PR; purine biosynthesis, lyase; 1.74A {Treponema denticola} PDB: 3rgg_A* Length = 159 | Back alignment and structure |
|---|
| >4b4k_A N5-carboxyaminoimidazole ribonucleotide mutase; isomerase; 2.50A {Bacillus anthracis} Length = 181 | Back alignment and structure |
|---|
| >3ors_A N5-carboxyaminoimidazole ribonucleotide mutase; isomerase, isomerase,biosynthetic protein; 1.45A {Staphylococcus aureus subsp} Length = 163 | Back alignment and structure |
|---|
| >1xmp_A PURE, phosphoribosylaminoimidazole carboxylase; purine biosynthesis, spine, lyase; 1.80A {Bacillus anthracis} SCOP: c.23.8.1 Length = 170 | Back alignment and structure |
|---|
| >3kuu_A Phosphoribosylaminoimidazole carboxylase catalyti PURE; 3-layer (ABA) sandwich, rossmann fold, csgid, lyase, structu genomics; 1.41A {Yersinia pestis} PDB: 1d7a_A* 1qcz_A 2ate_A* 2nsl_A* 2nsh_A* 2nsj_A* Length = 174 | Back alignment and structure |
|---|
| >3oow_A Phosphoribosylaminoimidazole carboxylase,catalyic; structural genomics, center for structural genomics of infec diseases, csgid; HET: MSE; 1.75A {Francisella tularensis subsp} PDB: 3opq_A* Length = 166 | Back alignment and structure |
|---|
| >1u11_A PURE (N5-carboxyaminoimidazole ribonucleotide MUT; acidophIle, protein stability, lyase; HET: CIT; 1.55A {Acetobacter aceti} SCOP: c.23.8.1 PDB: 2fwj_A* 2fw1_A* 2fwb_A 2fwa_A 2fw9_A 2fw7_A 2fw6_A 2fwp_A* 2fwi_A* 2fw8_A Length = 182 | Back alignment and structure |
|---|
| >2ywx_A Phosphoribosylaminoimidazole carboxylase catalyti; rossmann fold, structural genomics, NPPSFA; 2.31A {Methanocaldococcus jannaschii} Length = 157 | Back alignment and structure |
|---|
| >2h31_A Multifunctional protein ADE2; alpha-beta-alpha, ligase, lyase; 2.80A {Homo sapiens} Length = 425 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 185 | |||
| 4b4k_A | 181 | N5-carboxyaminoimidazole ribonucleotide mutase; is | 99.96 | |
| 4grd_A | 173 | N5-CAIR mutase, phosphoribosylaminoimidazole carbo | 99.96 | |
| 1xmp_A | 170 | PURE, phosphoribosylaminoimidazole carboxylase; pu | 99.95 | |
| 3rg8_A | 159 | Phosphoribosylaminoimidazole carboxylase, PURE PR; | 99.95 | |
| 3oow_A | 166 | Phosphoribosylaminoimidazole carboxylase,catalyic; | 99.95 | |
| 3kuu_A | 174 | Phosphoribosylaminoimidazole carboxylase catalyti | 99.95 | |
| 3trh_A | 169 | Phosphoribosylaminoimidazole carboxylase carboxylt | 99.95 | |
| 3ors_A | 163 | N5-carboxyaminoimidazole ribonucleotide mutase; is | 99.95 | |
| 3lp6_A | 174 | Phosphoribosylaminoimidazole carboxylase catalyti; | 99.95 | |
| 1u11_A | 182 | PURE (N5-carboxyaminoimidazole ribonucleotide MUT; | 99.94 | |
| 1o4v_A | 183 | Phosphoribosylaminoimidazole mutase PURE; structur | 99.94 | |
| 2ywx_A | 157 | Phosphoribosylaminoimidazole carboxylase catalyti; | 99.92 | |
| 2h31_A | 425 | Multifunctional protein ADE2; alpha-beta-alpha, li | 99.91 | |
| 3uhj_A | 387 | Probable glycerol dehydrogenase; structural genomi | 94.98 | |
| 1jq5_A | 370 | Glycerol dehydrogenase; oxidoreductase, NAD, glyce | 94.83 | |
| 3bfj_A | 387 | 1,3-propanediol oxidoreductase; opportunistic path | 94.13 | |
| 1o2d_A | 371 | Alcohol dehydrogenase, iron-containing; TM0920, st | 93.67 | |
| 3ce9_A | 354 | Glycerol dehydrogenase; NP_348253.1, 3-dehydroquin | 93.51 | |
| 3okf_A | 390 | 3-dehydroquinate synthase; structural genomics, ce | 93.31 | |
| 3ox4_A | 383 | Alcohol dehydrogenase 2; iron, NAD, oxidoreductase | 92.87 | |
| 1rrm_A | 386 | Lactaldehyde reductase; structural genomics, dehyd | 92.47 | |
| 1vlj_A | 407 | NADH-dependent butanol dehydrogenase; TM0820, stru | 92.21 | |
| 1ta9_A | 450 | Glycerol dehydrogenase; oxidoredu; 1.90A {Schizosa | 92.07 | |
| 1sg6_A | 393 | Pentafunctional AROM polypeptide; shikimate pathwa | 91.87 | |
| 3h5o_A | 339 | Transcriptional regulator GNTR; transcription regu | 91.71 | |
| 3dbi_A | 338 | Sugar-binding transcriptional regulator, LACI FAM; | 91.59 | |
| 3jvd_A | 333 | Transcriptional regulators; structural genomics, P | 89.74 | |
| 3e3m_A | 355 | Transcriptional regulator, LACI family; structural | 89.7 | |
| 1oj7_A | 408 | Hypothetical oxidoreductase YQHD; structural genom | 89.53 | |
| 3l49_A | 291 | ABC sugar (ribose) transporter, periplasmic substr | 88.97 | |
| 2gru_A | 368 | 2-deoxy-scyllo-inosose synthase; aminoglycoside, 2 | 88.93 | |
| 3lft_A | 295 | Uncharacterized protein; ABC, ATPase, cassette, L- | 88.72 | |
| 3ctp_A | 330 | Periplasmic binding protein/LACI transcriptional; | 88.7 | |
| 3hl0_A | 353 | Maleylacetate reductase; structur genomics, PSI-2, | 88.68 | |
| 2o20_A | 332 | Catabolite control protein A; CCPA, transcriptiona | 88.65 | |
| 3s99_A | 356 | Basic membrane lipoprotein; ssgcid, structural gen | 88.44 | |
| 3egc_A | 291 | Putative ribose operon repressor; structural genom | 88.29 | |
| 2fn9_A | 290 | Ribose ABC transporter, periplasmic ribose-bindin; | 88.16 | |
| 2iks_A | 293 | DNA-binding transcriptional dual regulator; escher | 87.59 | |
| 3hs3_A | 277 | Ribose operon repressor; PSI-II, NYSGXRC, periplas | 87.46 | |
| 3bil_A | 348 | Probable LACI-family transcriptional regulator; st | 86.96 | |
| 3jzd_A | 358 | Iron-containing alcohol dehydrogenase; YP_298327.1 | 86.72 | |
| 3qbe_A | 368 | 3-dehydroquinate synthase; shikimate pathway, myco | 86.66 | |
| 3kke_A | 303 | LACI family transcriptional regulator; structural | 86.56 | |
| 3miz_A | 301 | Putative transcriptional regulator protein, LACI f | 86.5 | |
| 3kjx_A | 344 | Transcriptional regulator, LACI family; LACL famil | 86.49 | |
| 1xah_A | 354 | Sadhqs, 3-dehydroquinate synthase; shikimate pathw | 86.36 | |
| 3l6u_A | 293 | ABC-type sugar transport system periplasmic compo; | 85.96 | |
| 3o1i_D | 304 | Periplasmic protein TORT; ligand free, two compone | 85.3 | |
| 3msz_A | 89 | Glutaredoxin 1; alpha-beta sandwich, center for st | 85.1 | |
| 3brq_A | 296 | HTH-type transcriptional regulator ASCG; transcrip | 85.03 | |
| 4fn4_A | 254 | Short chain dehydrogenase; NADH-binding, rossmann | 84.39 | |
| 1byk_A | 255 | Protein (trehalose operon repressor); LACI family, | 84.35 | |
| 1jye_A | 349 | Lactose operon repressor; gene regulation, protein | 84.03 | |
| 3m9w_A | 313 | D-xylose-binding periplasmic protein; xylose bindi | 83.92 | |
| 2hqb_A | 296 | Transcriptional activator of COMK gene; berkeley s | 83.39 | |
| 3dlo_A | 155 | Universal stress protein; unknown function, struct | 83.37 | |
| 1dbq_A | 289 | Purine repressor; transcription regulation, DNA-bi | 83.2 | |
| 3jy6_A | 276 | Transcriptional regulator, LACI family; NYSGXRC, P | 82.81 | |
| 3zyw_A | 111 | Glutaredoxin-3; metal binding protein; 1.84A {Homo | 82.64 | |
| 3c3k_A | 285 | Alanine racemase; structural genomics, protein str | 82.46 | |
| 3o74_A | 272 | Fructose transport system repressor FRUR; dual tra | 82.21 | |
| 1ujn_A | 348 | Dehydroquinate synthase; riken structu genomics/pr | 81.87 | |
| 3ipz_A | 109 | Monothiol glutaredoxin-S14, chloroplastic; electro | 81.58 | |
| 1tjy_A | 316 | Sugar transport protein; protein-ligand complex, s | 81.5 | |
| 3huu_A | 305 | Transcription regulator like protein; PSI-II, NYSG | 81.43 | |
| 3h75_A | 350 | Periplasmic sugar-binding domain protein; protein | 81.43 | |
| 2vzf_A | 197 | NADH-dependent FMN reductase; oxidoreductase; 2.50 | 81.05 | |
| 2b99_A | 156 | Riboflavin synthase; lumazine riboflavin, transfer | 81.03 | |
| 1aba_A | 87 | Glutaredoxin; electron transport; HET: MES; 1.45A | 80.8 | |
| 2dri_A | 271 | D-ribose-binding protein; sugar transport; HET: RI | 80.77 | |
| 1nvm_A | 345 | HOA, 4-hydroxy-2-oxovalerate aldolase; sequestered | 80.74 | |
| 2fvy_A | 309 | D-galactose-binding periplasmic protein; periplasm | 80.69 | |
| 1x60_A | 79 | Sporulation-specific N-acetylmuramoyl-L-alanine am | 80.5 | |
| 3ksm_A | 276 | ABC-type sugar transport system, periplasmic COMP; | 80.24 | |
| 2qh8_A | 302 | Uncharacterized protein; conserved domain protein, | 80.2 | |
| 3gyb_A | 280 | Transcriptional regulators (LACI-family transcript | 80.2 |
| >4b4k_A N5-carboxyaminoimidazole ribonucleotide mutase; isomerase; 2.50A {Bacillus anthracis} | Back alignment and structure |
|---|
Probab=99.96 E-value=2.5e-30 Score=214.05 Aligned_cols=77 Identities=42% Similarity=0.678 Sum_probs=72.8
Q ss_pred CCCCCeEEEEeccCCCHHHHHHHHHHHHHhCCCeeEEEEcCCCCchHHHHHHHHHhhCCCeEEEEecCccCcCcCCC
Q 029926 109 STDTPIVGIIMESDSDLPVMNDAARTLSDFGVPYEIKILSPHQNRKGALSYALSAKERGIKIIIVGDGVEAHLSGTL 185 (185)
Q Consensus 109 ~~~~~kVaIIMGS~SDl~vmekA~~vLeefGIpyEvrVaSAHRtPe~l~ey~k~ae~~GikVIIAvAG~AAhLPGVV 185 (185)
..|+|.|+|||||+|||++|++|.++|++|||+||++|+||||+|+++.+|+++++++|++||||+||++|||||||
T Consensus 19 ~~mkp~V~IimGS~SD~~v~~~a~~~L~~~gI~~e~~V~SAHRtp~~l~~~~~~a~~~g~~ViIa~AG~aahLpGvv 95 (181)
T 4b4k_A 19 SHMKSLVGVIMGSTSDWETMKYACDILDELNIPYEKKVVSAHRTPDYMFEYAETARERGLKVIIAGAGGAAHLPGMV 95 (181)
T ss_dssp ---CCSEEEEESSGGGHHHHHHHHHHHHHTTCCEEEEECCTTTSHHHHHHHHHHTTTTTCCEEEEEECSSCCHHHHH
T ss_pred CCCCccEEEEECCHhHHHHHHHHHHHHHHcCCCeeEEEEccccChHHHHHHHHHHHhcCceEEEEeccccccchhhH
Confidence 56789999999999999999999999999999999999999999999999999999999999999999999999985
|
| >4grd_A N5-CAIR mutase, phosphoribosylaminoimidazole carboxylase catalyti; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures; 1.85A {Burkholderia cenocepacia} | Back alignment and structure |
|---|
| >1xmp_A PURE, phosphoribosylaminoimidazole carboxylase; purine biosynthesis, spine, lyase; 1.80A {Bacillus anthracis} SCOP: c.23.8.1 | Back alignment and structure |
|---|
| >3rg8_A Phosphoribosylaminoimidazole carboxylase, PURE PR; purine biosynthesis, lyase; 1.74A {Treponema denticola} SCOP: c.23.8.0 PDB: 3rgg_A* | Back alignment and structure |
|---|
| >3oow_A Phosphoribosylaminoimidazole carboxylase,catalyic; structural genomics, center for structural genomics of infec diseases, csgid; HET: MSE; 1.75A {Francisella tularensis subsp} SCOP: c.23.8.1 PDB: 3opq_A* | Back alignment and structure |
|---|
| >3kuu_A Phosphoribosylaminoimidazole carboxylase catalyti PURE; 3-layer (ABA) sandwich, rossmann fold, csgid, lyase, structu genomics; 1.41A {Yersinia pestis} SCOP: c.23.8.1 PDB: 1d7a_A* 1qcz_A 2ate_A* 2nsl_A* 2nsh_A* 2nsj_A* | Back alignment and structure |
|---|
| >3trh_A Phosphoribosylaminoimidazole carboxylase carboxyltransferase subunit; purines, pyrimidines, nucleosides, nucleotides, lyase; 2.20A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3ors_A N5-carboxyaminoimidazole ribonucleotide mutase; isomerase, isomerase,biosynthetic protein; 1.45A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >3lp6_A Phosphoribosylaminoimidazole carboxylase catalyti; alpha and beta protein, structural genomics, PSI-2, protein initiative; 1.70A {Mycobacterium tuberculosis} SCOP: c.23.8.0 | Back alignment and structure |
|---|
| >1u11_A PURE (N5-carboxyaminoimidazole ribonucleotide MUT; acidophIle, protein stability, lyase; HET: CIT; 1.55A {Acetobacter aceti} SCOP: c.23.8.1 PDB: 2fwj_A* 2fw1_A* 2fwb_A 2fwa_A 2fw9_A 2fw7_A 2fw6_A 2fwp_A* 2fwi_A* 2fw8_A | Back alignment and structure |
|---|
| >1o4v_A Phosphoribosylaminoimidazole mutase PURE; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; 1.77A {Thermotoga maritima} SCOP: c.23.8.1 | Back alignment and structure |
|---|
| >2ywx_A Phosphoribosylaminoimidazole carboxylase catalyti; rossmann fold, structural genomics, NPPSFA; 2.31A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >2h31_A Multifunctional protein ADE2; alpha-beta-alpha, ligase, lyase; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3uhj_A Probable glycerol dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.34A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1jq5_A Glycerol dehydrogenase; oxidoreductase, NAD, glycerol metabolism; HET: NAD; 1.70A {Geobacillus stearothermophilus} SCOP: e.22.1.2 PDB: 1jpu_A* 1jqa_A* | Back alignment and structure |
|---|
| >3bfj_A 1,3-propanediol oxidoreductase; opportunistic pathogens, decamer, structural genomics,struct proteomics in europe, spine; 2.70A {Klebsiella pneumoniae} | Back alignment and structure |
|---|
| >1o2d_A Alcohol dehydrogenase, iron-containing; TM0920, structural genomics, JCSG, PSI, protein structure initiative; HET: MSE NAP TRS; 1.30A {Thermotoga maritima} SCOP: e.22.1.2 PDB: 1vhd_A* | Back alignment and structure |
|---|
| >3ce9_A Glycerol dehydrogenase; NP_348253.1, 3-dehydroquinate syntha structural genomics, joint center for structural genomics; HET: MSE; 2.37A {Clostridium acetobutylicum atcc 824} | Back alignment and structure |
|---|
| >3okf_A 3-dehydroquinate synthase; structural genomics, center for structural genomics of infec diseases, csgid, NAD, lyase; HET: NAD; 2.50A {Vibrio cholerae o1 biovar eltor} | Back alignment and structure |
|---|
| >3ox4_A Alcohol dehydrogenase 2; iron, NAD, oxidoreductase; HET: NAD; 2.00A {Zymomonas mobilis} PDB: 3owo_A* | Back alignment and structure |
|---|
| >1rrm_A Lactaldehyde reductase; structural genomics, dehydrogenase, PSI, protein structure initiative; HET: APR; 1.60A {Escherichia coli} SCOP: e.22.1.2 PDB: 2bi4_A* 2bl4_A* | Back alignment and structure |
|---|
| >1vlj_A NADH-dependent butanol dehydrogenase; TM0820, structural G JCSG, protein structure initiative, PSI, joint center for S genomics; HET: NAP; 1.78A {Thermotoga maritima} SCOP: e.22.1.2 | Back alignment and structure |
|---|
| >1ta9_A Glycerol dehydrogenase; oxidoredu; 1.90A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >1sg6_A Pentafunctional AROM polypeptide; shikimate pathway, aromatic amino acid biosynthesis, DHQS, O form J, domain movement, cyclase, lyase; HET: NAD; 1.70A {Emericella nidulans} SCOP: e.22.1.1 PDB: 1nr5_A* 1nrx_A* 1nua_A 1nva_A* 1nvb_A* 1nvd_A* 1nve_A* 1nvf_A* 1dqs_A* | Back alignment and structure |
|---|
| >3h5o_A Transcriptional regulator GNTR; transcription regulator, GNTR,chromobacterium violaceum, PSI, SGX, DNA-binding; 2.30A {Chromobacterium violaceum} | Back alignment and structure |
|---|
| >3dbi_A Sugar-binding transcriptional regulator, LACI FAM; structural genomics, sugar-binding transcriptional regulator structure initiative, PSI-2; HET: MSE; 2.45A {Escherichia coli K12} | Back alignment and structure |
|---|
| >3jvd_A Transcriptional regulators; structural genomics, PSI-2, sugar binding protein, transcrip regulation, protein structure initiative; 2.30A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >3e3m_A Transcriptional regulator, LACI family; structural genomics, DNA-binding, plasmid, transcription regulation, PSI-2; 1.60A {Silicibacter pomeroyi} | Back alignment and structure |
|---|
| >1oj7_A Hypothetical oxidoreductase YQHD; structural genomics; HET: NZQ; 2.0A {Escherichia coli} SCOP: e.22.1.2 | Back alignment and structure |
|---|
| >3l49_A ABC sugar (ribose) transporter, periplasmic substrate-binding subunit; sugar binding/transporter, structural genomics, PSI; HET: UNL; 2.30A {Rhodobacter sphaeroides} | Back alignment and structure |
|---|
| >2gru_A 2-deoxy-scyllo-inosose synthase; aminoglycoside, 2-deoxystreptamine, dehydroquinate synthase, lyase; HET: NAD EXO CAK; 2.15A {Bacillus circulans} PDB: 2d2x_A* | Back alignment and structure |
|---|
| >3lft_A Uncharacterized protein; ABC, ATPase, cassette, L-Trp, PSI, MCSG, structural genomics center for structural genomics; HET: MSE TRP; 1.35A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >3ctp_A Periplasmic binding protein/LACI transcriptional; structural genomics, protein structure initiative; HET: XLF; 1.41A {Alkaliphilus metalliredigens} | Back alignment and structure |
|---|
| >3hl0_A Maleylacetate reductase; structur genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; HET: MSE NAD EPE; 1.60A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >2o20_A Catabolite control protein A; CCPA, transcriptional regulator, helix-turn-helix, transcrip; 1.90A {Lactococcus lactis} | Back alignment and structure |
|---|
| >3s99_A Basic membrane lipoprotein; ssgcid, structural genomics, SEA structural genomics center for infectious disease, adenine; HET: ADE; 2.05A {Brucella melitensis biovar abortus} | Back alignment and structure |
|---|
| >3egc_A Putative ribose operon repressor; structural genomics, unknown function, DNA-binding, transcri transcription regulation, PSI-2; 2.35A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >2fn9_A Ribose ABC transporter, periplasmic ribose-bindin; RBP, ribose binding protein, periplasmic binding protein, thermophilic proteins; 1.40A {Thermotoga maritima} PDB: 2fn8_A* | Back alignment and structure |
|---|
| >2iks_A DNA-binding transcriptional dual regulator; escherichia coli structural genomics, PSI-2, protein structure initiative; 1.85A {Escherichia coli} | Back alignment and structure |
|---|
| >3hs3_A Ribose operon repressor; PSI-II, NYSGXRC, periplasmic binding protein, structural genomics, protein structure initiative; 1.60A {Lactobacillus acidophilus} | Back alignment and structure |
|---|
| >3bil_A Probable LACI-family transcriptional regulator; structural genomics, unknown function, PSI-2, protein structure initiative; 2.50A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >3jzd_A Iron-containing alcohol dehydrogenase; YP_298327.1, putative alcohol dehedrogenase, structural GENO joint center for structural genomics; HET: MSE NAD PG4 P6G PGE; 2.10A {Ralstonia eutropha} | Back alignment and structure |
|---|
| >3qbe_A 3-dehydroquinate synthase; shikimate pathway, mycobacte tuberculosis, nicotinamide adenine dinucleotide (NAD)-depen enzyme; 2.07A {Mycobacterium tuberculosis} PDB: 3qbd_A | Back alignment and structure |
|---|
| >3kke_A LACI family transcriptional regulator; structural genomics, DNA-binding, transcription regulation, PSI-2; 2.20A {Mycobacterium smegmatis str} | Back alignment and structure |
|---|
| >3miz_A Putative transcriptional regulator protein, LACI family; LACL family, protein structure initiative II (PSI II), NYSGXRC, structural genomics; 1.91A {Rhizobium etli} | Back alignment and structure |
|---|
| >3kjx_A Transcriptional regulator, LACI family; LACL family, protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.33A {Silicibacter pomeroyi} | Back alignment and structure |
|---|
| >1xah_A Sadhqs, 3-dehydroquinate synthase; shikimate pathway, aromatic amino acid biosynthesis, open form, form B, domain movement, cyclase; HET: NAD; 2.20A {Staphylococcus aureus} PDB: 1xag_A* 1xai_A* 1xaj_A* 1xal_A* | Back alignment and structure |
|---|
| >3l6u_A ABC-type sugar transport system periplasmic compo; structural genomics, nysgrc, target 11006S, PSI-2, protein S initiative; 1.90A {Exiguobacterium sibiricum} | Back alignment and structure |
|---|
| >3o1i_D Periplasmic protein TORT; ligand free, two component sensor, periplasmic binding prote signaling protein; HET: PE4; 2.80A {Vibrio parahaemolyticus} PDB: 3o1h_B* 3o1j_C | Back alignment and structure |
|---|
| >3msz_A Glutaredoxin 1; alpha-beta sandwich, center for structural genomics of infec diseases, csgid, oxidoreductase; HET: GSH; 2.05A {Francisella tularensis subsp} PDB: 3lgc_A* | Back alignment and structure |
|---|
| >3brq_A HTH-type transcriptional regulator ASCG; transcriptional repressor structure escherichia coli, struct genomics, PSI-2; HET: FRU; 2.00A {Escherichia coli} | Back alignment and structure |
|---|
| >4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} | Back alignment and structure |
|---|
| >1byk_A Protein (trehalose operon repressor); LACI family, phosphate binding, protein structure, trehalose repressor, gene regulation; HET: T6P; 2.50A {Escherichia coli} SCOP: c.93.1.1 | Back alignment and structure |
|---|
| >1jye_A Lactose operon repressor; gene regulation, protein stability, protein DNA-binding, transcription; 1.70A {Escherichia coli} SCOP: c.93.1.1 PDB: 1lbi_A 1lbg_A* 1lbh_A 1jyf_A 3edc_A 1efa_A* 1jwl_A* 2pe5_A* 1tlf_A* 2p9h_A* 2paf_A* 1cjg_A* 1l1m_A 1osl_A 2kei_A* 2kej_A* 2kek_A* 2bjc_A 1lqc_A 1lcc_A* ... | Back alignment and structure |
|---|
| >3m9w_A D-xylose-binding periplasmic protein; xylose binding protein, conformational changes, SUGA protein; 2.15A {Escherichia coli} PDB: 3m9x_A* 3ma0_A* | Back alignment and structure |
|---|
| >2hqb_A Transcriptional activator of COMK gene; berkeley structure genomics center target 1957B, structural genomics, PSI; 2.70A {Bacillus halodurans} | Back alignment and structure |
|---|
| >3dlo_A Universal stress protein; unknown function, structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics; HET: MSE; 1.97A {Archaeoglobus fulgidus} PDB: 3qtb_A* | Back alignment and structure |
|---|
| >1dbq_A Purine repressor; transcription regulation, DNA-binding regulatory protein; 2.20A {Escherichia coli} SCOP: c.93.1.1 PDB: 1jhz_A | Back alignment and structure |
|---|
| >3jy6_A Transcriptional regulator, LACI family; NYSGXRC, PSI-II, protein S initiative, structural genomics; 1.97A {Lactobacillus brevis} | Back alignment and structure |
|---|
| >3zyw_A Glutaredoxin-3; metal binding protein; 1.84A {Homo sapiens} | Back alignment and structure |
|---|
| >3c3k_A Alanine racemase; structural genomics, protein structure initiative, NEW YORK research center for structural genomics, nysgxrc; 1.99A {Actinobacillus succinogenes} | Back alignment and structure |
|---|
| >3o74_A Fructose transport system repressor FRUR; dual transcriptional regulator, DNA, transcription; 2.00A {Pseudomonas putida} PDB: 3o75_A* | Back alignment and structure |
|---|
| >1ujn_A Dehydroquinate synthase; riken structu genomics/proteomics initiative, RSGI, structural genomics,; 1.80A {Thermus thermophilus} SCOP: e.22.1.1 | Back alignment and structure |
|---|
| >3ipz_A Monothiol glutaredoxin-S14, chloroplastic; electron transport, PL redox-active center, transit peptide, transport, oxidoreduc; 2.40A {Arabidopsis thaliana} PDB: 2lku_A | Back alignment and structure |
|---|
| >1tjy_A Sugar transport protein; protein-ligand complex, signaling protein; HET: PAV; 1.30A {Salmonella typhimurium} SCOP: c.93.1.1 PDB: 1tm2_A 3t95_A* 3ejw_A* | Back alignment and structure |
|---|
| >3huu_A Transcription regulator like protein; PSI-II, NYSGXRC, LAC I, STR genomics, protein structure initiative; 1.95A {Staphylococcus haemolyticus} | Back alignment and structure |
|---|
| >3h75_A Periplasmic sugar-binding domain protein; protein structure initiative II (PSI II), sugar binding PROT alpha/beta fold; 1.60A {Pseudomonas fluorescens pf-5} | Back alignment and structure |
|---|
| >2vzf_A NADH-dependent FMN reductase; oxidoreductase; 2.50A {Edta-degrading bacterium BNC1} PDB: 2vzh_A* 2vzj_A* | Back alignment and structure |
|---|
| >2b99_A Riboflavin synthase; lumazine riboflavin, transferase; HET: RDL; 2.22A {Methanocaldococcus jannaschii} PDB: 2b98_A* | Back alignment and structure |
|---|
| >1aba_A Glutaredoxin; electron transport; HET: MES; 1.45A {Enterobacteria phage T4} SCOP: c.47.1.1 PDB: 1aaz_A 1de1_A 1de2_A | Back alignment and structure |
|---|
| >2dri_A D-ribose-binding protein; sugar transport; HET: RIP; 1.60A {Escherichia coli} SCOP: c.93.1.1 PDB: 1urp_A* 1ba2_A 1dbp_A* 1drj_A* 1drk_A* 2gx6_A* | Back alignment and structure |
|---|
| >1nvm_A HOA, 4-hydroxy-2-oxovalerate aldolase; sequestered tunnel, substrate channeling; HET: NAD; 1.70A {Pseudomonas SP} SCOP: a.5.7.1 c.1.10.5 | Back alignment and structure |
|---|
| >2fvy_A D-galactose-binding periplasmic protein; periplasmic binding protien, hinge, chemotaxis, transport,; HET: BGC; 0.92A {Escherichia coli} SCOP: c.93.1.1 PDB: 1glg_A* 2fw0_A* 2gbp_A* 2qw1_A* 2hph_A* 2ipn_A* 2ipm_A* 2ipl_A* 1gca_A* 1gcg_A 3ga5_A* 3gbp_A* | Back alignment and structure |
|---|
| >1x60_A Sporulation-specific N-acetylmuramoyl-L-alanine amidase; CWLC, CWLCR, peptidoglycan, cell WALL lytic amidase, tandem repeats, hydrolase; NMR {Bacillus subtilis} | Back alignment and structure |
|---|
| >3ksm_A ABC-type sugar transport system, periplasmic COMP; periplasmic component, PSI- 11023L, structural genomics, protein structure initiative; HET: BDR; 1.90A {Hahella chejuensis} | Back alignment and structure |
|---|
| >3gyb_A Transcriptional regulators (LACI-family transcriptional regulatory protein); protein structure initiative II(PSI II), nysgxrc; 1.60A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 185 | ||||
| d1qcza_ | 163 | c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoi | 1e-18 | |
| d1o4va_ | 169 | c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoi | 2e-18 | |
| d1xmpa_ | 155 | c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoi | 4e-18 | |
| d1u11a_ | 159 | c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoi | 1e-16 |
| >d1qcza_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Escherichia coli [TaxId: 562]} Length = 163 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Flavodoxin-like superfamily: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) family: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) domain: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) species: Escherichia coli [TaxId: 562]
Score = 76.5 bits (188), Expect = 1e-18
Identities = 27/73 (36%), Positives = 39/73 (53%)
Query: 113 PIVGIIMESDSDLPVMNDAARTLSDFGVPYEIKILSPHQNRKGALSYALSAKERGIKIII 172
V I+M S SD M AA VP+ ++++S H+ S+A SA+E G ++II
Sbjct: 2 ARVAIVMGSKSDWATMQFAAEIFEILNVPHHVEVVSAHRTPDKLFSFAESAEENGYQVII 61
Query: 173 VGDGVEAHLSGTL 185
G G AHL G +
Sbjct: 62 AGAGGAAHLPGMI 74
|
| >d1o4va_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Thermotoga maritima [TaxId: 2336]} Length = 169 | Back information, alignment and structure |
|---|
| >d1xmpa_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Bacillus anthracis [TaxId: 1392]} Length = 155 | Back information, alignment and structure |
|---|
| >d1u11a_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Acetobacter aceti [TaxId: 435]} Length = 159 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 185 | |||
| d1qcza_ | 163 | N5-CAIR mutase (phosphoribosylaminoimidazole carbo | 99.95 | |
| d1u11a_ | 159 | N5-CAIR mutase (phosphoribosylaminoimidazole carbo | 99.95 | |
| d1xmpa_ | 155 | N5-CAIR mutase (phosphoribosylaminoimidazole carbo | 99.94 | |
| d1o4va_ | 169 | N5-CAIR mutase (phosphoribosylaminoimidazole carbo | 99.93 | |
| d1jq5a_ | 366 | Glycerol dehydrogenase {Bacillus stearothermophilu | 95.28 | |
| d1o2da_ | 359 | Alcohol dehydrogenase TM0920 {Thermotoga maritima | 94.47 | |
| d2dria_ | 271 | D-ribose-binding protein {Escherichia coli, strain | 93.88 | |
| d1vlja_ | 398 | NADH-dependent butanol dehydrogenase A (TM0820) {T | 93.21 | |
| d2bona1 | 295 | Lipid kinase YegS {Escherichia coli [TaxId: 562]} | 92.73 | |
| d1rrma_ | 385 | Lactaldehyde reductase FucO {Escherichia coli [Tax | 92.49 | |
| d1byka_ | 255 | Trehalose repressor, C-terminal domain {Escherichi | 91.46 | |
| d1aisa1 | 92 | TATA-box binding protein (TBP), C-terminal domain | 90.42 | |
| d2qv7a1 | 312 | Diacylglycerol kinase DgkB {Staphylococcus aureus | 90.23 | |
| d1tjya_ | 316 | AI-2 receptor LsrB {Salmonella typhi [TaxId: 90370 | 90.07 | |
| d1guda_ | 288 | D-allose-binding protein {Escherichia coli [TaxId: | 89.29 | |
| d1mp9a1 | 92 | TATA-box binding protein (TBP), C-terminal domain | 88.89 | |
| d1utaa_ | 77 | Cell division protein FtsN {Escherichia coli [TaxI | 87.02 | |
| d1qnaa1 | 99 | TATA-box binding protein (TBP), C-terminal domain | 86.91 | |
| d2bd0a1 | 240 | Bacterial sepiapterin reductase {Chlorobium tepidu | 86.79 | |
| d1dbqa_ | 282 | Purine repressor (PurR), C-terminal domain {Escher | 86.03 | |
| d2rhca1 | 257 | beta-keto acyl carrier protein reductase {Streptom | 85.93 | |
| d2nzug1 | 275 | Glucose-resistance amylase regulator CcpA, C-termi | 84.83 | |
| d1g94a2 | 354 | Bacterial alpha-amylase {Pseudoalteromonas halopla | 84.7 | |
| d2pjua1 | 186 | Propionate catabolism operon regulatory protein Pr | 84.23 | |
| d1fmca_ | 255 | 7-alpha-hydroxysteroid dehydrogenase {Escherichia | 84.22 | |
| d1oaaa_ | 259 | Sepiapterin reductase {Mouse (Mus musculus) [TaxId | 83.51 | |
| d1zema1 | 260 | Xylitol dehydrogenase {Gluconobacter oxydans [TaxI | 83.43 | |
| d1xq1a_ | 259 | Tropinone reductase {Thale cress (Arabidopsis thal | 82.45 | |
| d1gega_ | 255 | meso-2,3-butanediol dehydrogenase {Klebsiella pneu | 82.07 | |
| d1oj7a_ | 390 | Hypothetical oxidoreductase yqhD {Escherichia coli | 81.89 | |
| d1jx6a_ | 338 | Quorum-sensing signal (autoinducer-2) binding prot | 81.72 | |
| d2c07a1 | 251 | beta-keto acyl carrier protein reductase {Malaria | 81.64 | |
| d1gpua3 | 146 | Transketolase (TK), C-domain {Baker's yeast (Sacch | 81.39 | |
| d1g0oa_ | 272 | 1,3,8-trihydroxynaphtalene reductase (THNR, naphto | 80.92 | |
| d1iowa1 | 96 | D-Ala-D-Ala ligase, N-domain {Escherichia coli, ge | 80.63 | |
| d1yb1a_ | 244 | 17-beta-hydroxysteroid dehydrogenase type XI {Huma | 80.31 |
| >d1qcza_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Flavodoxin-like superfamily: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) family: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) domain: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) species: Escherichia coli [TaxId: 562]
Probab=99.95 E-value=8.5e-29 Score=199.31 Aligned_cols=73 Identities=37% Similarity=0.558 Sum_probs=71.3
Q ss_pred CeEEEEeccCCCHHHHHHHHHHHHHhCCCeeEEEEcCCCCchHHHHHHHHHhhCCCeEEEEecCccCcCcCCC
Q 029926 113 PIVGIIMESDSDLPVMNDAARTLSDFGVPYEIKILSPHQNRKGALSYALSAKERGIKIIIVGDGVEAHLSGTL 185 (185)
Q Consensus 113 ~kVaIIMGS~SDl~vmekA~~vLeefGIpyEvrVaSAHRtPe~l~ey~k~ae~~GikVIIAvAG~AAhLPGVV 185 (185)
++|+|||||+||+++|+++.++|++|||+||++|+||||+|+++.+|+++++++|++||||+||+||||||+|
T Consensus 2 aKV~IImGS~SD~~~~~~a~~~L~~~gI~~e~~v~SAHRtp~~l~~~~~~~~~~~~~ViIa~AG~aa~Lpgvv 74 (163)
T d1qcza_ 2 ARVAIVMGSKSDWATMQFAAEIFEILNVPHHVEVVSAHRTPDKLFSFAESAEENGYQVIIAGAGGAAHLPGMI 74 (163)
T ss_dssp CCEEEEESSGGGHHHHHHHHHHHHHHTCCEEEEECCTTTCHHHHHHHHHHTTTTTCSEEEEEECSSCCHHHHH
T ss_pred CeEEEEECcHhhHHHHHHHHHHHHHcCCCeEEEEeccccCHHHHHHHHHHHHHcCCeEEEEeccCCCcccchh
Confidence 5799999999999999999999999999999999999999999999999999999999999999999999985
|
| >d1u11a_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Acetobacter aceti [TaxId: 435]} | Back information, alignment and structure |
|---|
| >d1xmpa_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Bacillus anthracis [TaxId: 1392]} | Back information, alignment and structure |
|---|
| >d1o4va_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1jq5a_ e.22.1.2 (A:) Glycerol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1o2da_ e.22.1.2 (A:) Alcohol dehydrogenase TM0920 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2dria_ c.93.1.1 (A:) D-ribose-binding protein {Escherichia coli, strain k-12 [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vlja_ e.22.1.2 (A:) NADH-dependent butanol dehydrogenase A (TM0820) {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2bona1 e.52.1.2 (A:5-299) Lipid kinase YegS {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1rrma_ e.22.1.2 (A:) Lactaldehyde reductase FucO {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1byka_ c.93.1.1 (A:) Trehalose repressor, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1aisa1 d.129.1.1 (A:1-92) TATA-box binding protein (TBP), C-terminal domain {Archaeon Pyrococcus woesei [TaxId: 2262]} | Back information, alignment and structure |
|---|
| >d2qv7a1 e.52.1.2 (A:1-312) Diacylglycerol kinase DgkB {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1tjya_ c.93.1.1 (A:) AI-2 receptor LsrB {Salmonella typhi [TaxId: 90370]} | Back information, alignment and structure |
|---|
| >d1guda_ c.93.1.1 (A:) D-allose-binding protein {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1mp9a1 d.129.1.1 (A:5-96) TATA-box binding protein (TBP), C-terminal domain {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} | Back information, alignment and structure |
|---|
| >d1utaa_ d.58.52.1 (A:) Cell division protein FtsN {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qnaa1 d.129.1.1 (A:17-115) TATA-box binding protein (TBP), C-terminal domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} | Back information, alignment and structure |
|---|
| >d1dbqa_ c.93.1.1 (A:) Purine repressor (PurR), C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d2nzug1 c.93.1.1 (G:58-332) Glucose-resistance amylase regulator CcpA, C-terminal domain {Bacillus megaterium [TaxId: 1404]} | Back information, alignment and structure |
|---|
| >d1g94a2 c.1.8.1 (A:1-354) Bacterial alpha-amylase {Pseudoalteromonas haloplanktis (Alteromonas haloplanktis) [TaxId: 228]} | Back information, alignment and structure |
|---|
| >d2pjua1 c.92.3.1 (A:11-196) Propionate catabolism operon regulatory protein PrpR {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} | Back information, alignment and structure |
|---|
| >d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} | Back information, alignment and structure |
|---|
| >d1oj7a_ e.22.1.2 (A:) Hypothetical oxidoreductase yqhD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1jx6a_ c.93.1.1 (A:) Quorum-sensing signal (autoinducer-2) binding protein LuxP {Vibrio harveyi [TaxId: 669]} | Back information, alignment and structure |
|---|
| >d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1gpua3 c.48.1.1 (A:535-680) Transketolase (TK), C-domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} | Back information, alignment and structure |
|---|
| >d1iowa1 c.30.1.2 (A:1-96) D-Ala-D-Ala ligase, N-domain {Escherichia coli, gene ddlB [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|