Citrus Sinensis ID: 029926

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-----
MALLLPGKVDLGSARRCFTMRTSVLRMQFCEFKFFVTSCLIEPRQKKFVEGKVRMLNNSRRSNSVRTVSQGTIPVLASSNGSATSTRKDYSSVREPSTVFEEENANGDSTDTPIVGIIMESDSDLPVMNDAARTLSDFGVPYEIKILSPHQNRKGALSYALSAKERGIKIIIVGDGVEAHLSGTL
ccccccccccccccccEEEEEccEEEEEcccEEEEEEEccccccccccHHHHHHHHHHHcccccccccccccEEEccccHHHHHHHHHHccccccccccccccccccccccccEEEEEEcccccHHHHHHHHHHHHHHccccccEEEcccccHHHHHHHHHHHHHcccEEEEEcccccccccccc
ccEEcccccccccHHHHHcHHHHHHHHHHHEEEEEEEcccccccHccccccEEEEEcccccccccccccEEEEEEEcccHHHHHHHHHHHHccccccccccccccccccccccEEEEEEccHHHHHHHHHHHHHHHHcccEEEEEEccccccHHHHHHHHHHcccccccEEEEEEEccccHHHcc
malllpgkvdlgsarrcfTMRTSVLRMQFCEFKFFVtsclieprqkKFVEGKVRMlnnsrrsnsvrtvsqgtipvlassngsatstrkdyssvrepstvfeeenangdstdtpivgiimesdsdlpvmndaartlsdfgvpyeikilsphqnrkGALSYALSAKERGIKIIIVGDGVEAHLSGTL
malllpgkvdlgsarrCFTMRTSVLRMQFCEFKFFVTSCLIEPRQKkfvegkvrmlnnsrrsnsvrtvsqgtipvlassngsatstrkdyssvrepstvfeeenangdstdtpIVGIIMESDSDLPVMNDAARTLSDFGVPYEIKilsphqnrKGALSYALSAKERGIKIIIVGDGVEAHLSGTL
MALLLPGKVDLGSARRCFTMRTSVLRMQFCEFKFFVTSCLIEPRQKKFVEGKvrmlnnsrrsnsvrtvsQGTIPVLASSNGSATSTRKDYSSVREPSTVFEEENANGDSTDTPIVGIIMESDSDLPVMNDAARTLSDFGVPYEIKILSPHQNRKGALSYALSAKERGIKIIIVGDGVEAHLSGTL
******GKVDLGSARRCFTMRTSVLRMQFCEFKFFVTSCLIEPRQKKFVEG**************************************************************IVGIIM*****LPVMNDAARTLSDFGVPYEIKILSPHQNRKGALSYALSAKERGIKIIIVGDGVE*******
*A*LLPGKVDLGSARRCFTMRTSVLRMQFCEFKFFVTSCLIEPRQKKFVEGKVRML*************QGTIPVLASSNGSA********************************GIIMESDSDLPVMNDAARTLSDFGVPYEIKILSPHQNRKGALSYALSAKERGIKIIIVGDGVEAHLSGTL
MALLLPGKVDLGSARRCFTMRTSVLRMQFCEFKFFVTSCLIEPRQKKFVEGKVRMLNNSR********SQGTIPVLA*****************************GDSTDTPIVGIIMESDSDLPVMNDAARTLSDFGVPYEIKILSPHQNRKGALSYALSAKERGIKIIIVGDGVEAHLSGTL
*ALLLPGKVDLGSARRCFTMRTSVLRMQFCEFKFFVTSCLIEPRQKKFVEGKVRMLNNSRRSNSVRTVSQGTIPVLASSNGSATSTRKDYSSVRE***************DTPIVGIIMESDSDLPVMNDAARTLSDFGVPYEIKILSPHQNRKGALSYALSAKERGIKIIIVGDGVEAHL****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MALLLPGKVDLGSARRCFTMRTSVLRMQFCEFKFFVTSCLIEPRQKKFVEGKVRMLNNSRRSNSVRTVSQGTIPVLASSNGSATSTRKDYSSVREPSTVFEEENANGDSTDTPIVGIIMESDSDLPVMNDAARTLSDFGVPYEIKILSPHQNRKGALSYALSAKERGIKIIIVGDGVEAHLSGTL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query185 2.2.26 [Sep-21-2011]
O58058177 N5-carboxyaminoimidazole yes no 0.410 0.429 0.578 5e-19
P21264571 Phosphoribosylaminoimidaz yes no 0.616 0.199 0.427 2e-16
Q9UY68174 N5-carboxyaminoimidazole yes no 0.394 0.419 0.561 9e-16
Q9WYS7171 N5-carboxyaminoimidazole yes no 0.394 0.426 0.547 7e-15
Q92210568 Phosphoribosylaminoimidaz N/A no 0.394 0.128 0.534 8e-15
P15567552 Phosphoribosylaminoimidaz yes no 0.421 0.141 0.487 1e-14
P50504557 Phosphoribosylaminoimidaz N/A no 0.405 0.134 0.493 9e-14
O74197570 Phosphoribosylaminoimidaz yes no 0.448 0.145 0.469 1e-13
P55195557 Phosphoribosylaminoimidaz N/A no 0.389 0.129 0.5 1e-13
Q01930543 Phosphoribosylaminoimidaz N/A no 0.454 0.154 0.443 4e-13
>sp|O58058|PURE_PYRHO N5-carboxyaminoimidazole ribonucleotide mutase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=purE PE=3 SV=1 Back     alignment and function desciption
 Score = 94.0 bits (232), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 44/76 (57%), Positives = 56/76 (73%)

Query: 110 TDTPIVGIIMESDSDLPVMNDAARTLSDFGVPYEIKILSPHQNRKGALSYALSAKERGIK 169
           ++ P+VGIIM SDSDLPVM +AAR L +FGVPYEI I+S H+  + A  YA  A+ERGI+
Sbjct: 7   SEKPLVGIIMGSDSDLPVMKEAARILEEFGVPYEITIISAHRTPERAYEYAKKAEERGIE 66

Query: 170 IIIVGDGVEAHLSGTL 185
           +II G G  AHL G +
Sbjct: 67  VIIAGAGGAAHLPGII 82
Catalyzes the conversion of N5-carboxyaminoimidazole ribonucleotide (N5-CAIR) to 4-carboxy-5-aminoimidazole ribonucleotide (CAIR).
Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) (taxid: 70601)
EC: 5EC: .EC: 4EC: .EC: 9EC: 9EC: .EC: 1EC: 8
>sp|P21264|PUR6_YEAST Phosphoribosylaminoimidazole carboxylase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADE2 PE=1 SV=1 Back     alignment and function description
>sp|Q9UY68|PURE_PYRAB N5-carboxyaminoimidazole ribonucleotide mutase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=purE PE=3 SV=1 Back     alignment and function description
>sp|Q9WYS7|PURE_THEMA N5-carboxyaminoimidazole ribonucleotide mutase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=purE PE=1 SV=1 Back     alignment and function description
>sp|Q92210|PUR6_CANAL Phosphoribosylaminoimidazole carboxylase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ADE2 PE=3 SV=2 Back     alignment and function description
>sp|P15567|PUR6_SCHPO Phosphoribosylaminoimidazole carboxylase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ade6 PE=3 SV=1 Back     alignment and function description
>sp|P50504|PUR6_SCHOC Phosphoribosylaminoimidazole carboxylase OS=Schwanniomyces occidentalis GN=ADE2 PE=3 SV=1 Back     alignment and function description
>sp|O74197|PUR6_CANGA Phosphoribosylaminoimidazole carboxylase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ADE2 PE=3 SV=2 Back     alignment and function description
>sp|P55195|PUR6_VIGAC Phosphoribosylaminoimidazole carboxylase, chloroplastic (Fragment) OS=Vigna aconitifolia GN=PURKE PE=2 SV=1 Back     alignment and function description
>sp|Q01930|PUR6_OGAME Phosphoribosylaminoimidazole carboxylase OS=Ogataea methanolica GN=ADE1 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query185
13173434 623 phosphoribosylaminoimidazole carboxylase 0.475 0.141 0.545 7e-19
37983592 621 phosphoribosylaminoimidazole carboxylase 0.475 0.141 0.545 8e-19
14590237177 phosphoribosylaminoimidazole carboxylase 0.410 0.429 0.578 2e-17
410667200164 phosphoribosylaminoimidazole carboxylase 0.405 0.457 0.56 1e-16
268316597171 phosphoribosylaminoimidazole carboxylase 0.416 0.450 0.545 2e-16
449490248 586 PREDICTED: phosphoribosylaminoimidazole 0.421 0.133 0.548 2e-16
449442114 586 PREDICTED: phosphoribosylaminoimidazole 0.421 0.133 0.548 2e-16
147859592 604 hypothetical protein VITISV_024806 [Viti 0.427 0.130 0.544 4e-16
345303692171 phosphoribosylaminoimidazole carboxylase 0.416 0.450 0.532 8e-16
154249773178 phosphoribosylaminoimidazole carboxylase 0.394 0.410 0.575 8e-16
>gi|13173434|gb|AAK14408.1| phosphoribosylaminoimidazole carboxylase [Nicotiana tabacum] Back     alignment and taxonomy information
 Score = 99.0 bits (245), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 48/88 (54%), Positives = 61/88 (69%)

Query: 98  TVFEEENANGDSTDTPIVGIIMESDSDLPVMNDAARTLSDFGVPYEIKILSPHQNRKGAL 157
            +  EE+ NG     P VGIIM SDSDLPVM DAA+ L++F VP E+KI+S H+  +   
Sbjct: 441 VILNEESVNGHPAVAPRVGIIMGSDSDLPVMKDAAKILNEFDVPAEVKIVSAHRTPEMMF 500

Query: 158 SYALSAKERGIKIIIVGDGVEAHLSGTL 185
           SYALSA+ERGI++II G G  AHL G +
Sbjct: 501 SYALSARERGIQVIIAGAGGAAHLPGMV 528

Source: Nicotiana tabacum

Species: Nicotiana tabacum

Genus: Nicotiana

Family: Solanaceae

Order: Solanales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|37983592|gb|AAR06291.1| phosphoribosylaminoimidazole carboxylase, partial [Nicotiana tabacum] Back     alignment and taxonomy information
>gi|14590237|ref|NP_142303.1| phosphoribosylaminoimidazole carboxylase catalytic subunit [Pyrococcus horikoshii OT3] gi|3914493|sp|O58058.1|PURE_PYRHO RecName: Full=N5-carboxyaminoimidazole ribonucleotide mutase; Short=N5-CAIR mutase; AltName: Full=5-(carboxyamino)imidazole ribonucleotide mutase gi|3256711|dbj|BAA29394.1| 177aa long hypothetical phosphoribosylaminoimidazole carboxylase catalytic subunit [Pyrococcus horikoshii OT3] Back     alignment and taxonomy information
>gi|410667200|ref|YP_006919571.1| phosphoribosylaminoimidazole carboxylase catalytic subunit PurE [Thermacetogenium phaeum DSM 12270] gi|409104947|gb|AFV11072.1| phosphoribosylaminoimidazole carboxylase catalytic subunit PurE [Thermacetogenium phaeum DSM 12270] Back     alignment and taxonomy information
>gi|268316597|ref|YP_003290316.1| phosphoribosylaminoimidazole carboxylase catalytic subunit [Rhodothermus marinus DSM 4252] gi|262334131|gb|ACY47928.1| phosphoribosylaminoimidazole carboxylase, catalytic subunit [Rhodothermus marinus DSM 4252] Back     alignment and taxonomy information
>gi|449490248|ref|XP_004158550.1| PREDICTED: phosphoribosylaminoimidazole carboxylase, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449442114|ref|XP_004138827.1| PREDICTED: phosphoribosylaminoimidazole carboxylase, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|147859592|emb|CAN83526.1| hypothetical protein VITISV_024806 [Vitis vinifera] Back     alignment and taxonomy information
>gi|345303692|ref|YP_004825594.1| phosphoribosylaminoimidazole carboxylase, catalytic subunit [Rhodothermus marinus SG0.5JP17-172] gi|345112925|gb|AEN73757.1| phosphoribosylaminoimidazole carboxylase, catalytic subunit [Rhodothermus marinus SG0.5JP17-172] Back     alignment and taxonomy information
>gi|154249773|ref|YP_001410598.1| phosphoribosylaminoimidazole carboxylase, catalytic subunit [Fervidobacterium nodosum Rt17-B1] gi|154153709|gb|ABS60941.1| phosphoribosylaminoimidazole carboxylase, catalytic subunit [Fervidobacterium nodosum Rt17-B1] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query185
SGD|S000005654571 ADE2 "Phosphoribosylaminoimida 0.605 0.196 0.434 3.5e-16
UNIPROTKB|P96880174 purE "N5-carboxyaminoimidazole 0.394 0.419 0.493 1.1e-14
CGD|CAL0003241568 ADE2 [Candida albicans (taxid: 0.583 0.190 0.442 2.4e-14
UNIPROTKB|Q92210568 ADE2 "Phosphoribosylaminoimida 0.583 0.190 0.442 2.4e-14
TIGR_CMR|GSU_0611169 GSU_0611 "phosphoribosylaminoi 0.405 0.443 0.506 3.8e-14
TAIR|locus:2040771642 AT2G37690 [Arabidopsis thalian 0.394 0.113 0.534 6.2e-14
POMBASE|SPCC1322.13552 ade6 "phosphoribosylaminoimida 0.410 0.137 0.5 7.9e-14
UNIPROTKB|Q9KVT7161 purE "N5-carboxyaminoimidazole 0.372 0.428 0.536 5.6e-13
TIGR_CMR|VC_0052161 VC_0052 "phosphoribosylaminoim 0.372 0.428 0.536 5.6e-13
DICTYBASE|DDB_G0283987 997 purC/E "PAICS" [Dictyostelium 0.605 0.112 0.373 2.9e-12
SGD|S000005654 ADE2 "Phosphoribosylaminoimidazole carboxylase" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
 Score = 210 (79.0 bits), Expect = 3.5e-16, P = 3.5e-16
 Identities = 50/115 (43%), Positives = 68/115 (59%)

Query:    71 GTIPVLASSNGSATSTRKDYSSVRE--PSTVFEEENANGDSTDTPIVGIIMESDSDLPVM 128
             G I ++ASS       R +Y + R   P  +   +  + ++   P+VGIIM SDSDLPVM
Sbjct:   360 GHINIIASSMAECEQ-RLNYITGRTDIPIKISVAQKLDLEAMVKPLVGIIMGSDSDLPVM 418

Query:   129 NDAARTLSDFGVPYEIKILSPHQNRKGALSYALSAKERGIKIIIVGDGVEAHLSG 183
             + A   L DFGVP+E+ I+S H+      +YA+SA +RGIK II G G  AHL G
Sbjct:   419 SAACAVLKDFGVPFEVTIVSAHRTPHRMSAYAISASKRGIKTIIAGAGGAAHLPG 473
GO:0006189 "'de novo' IMP biosynthetic process" evidence=IEA;TAS
GO:0006164 "purine nucleotide biosynthetic process" evidence=IEA;TAS
GO:0005524 "ATP binding" evidence=IEA
GO:0034023 "5-(carboxyamino)imidazole ribonucleotide mutase activity" evidence=IEA
GO:0003824 "catalytic activity" evidence=IEA
GO:0004638 "phosphoribosylaminoimidazole carboxylase activity" evidence=IEA;IMP
GO:0046872 "metal ion binding" evidence=IEA
GO:0006144 "purine nucleobase metabolic process" evidence=IMP;TAS
GO:0005737 "cytoplasm" evidence=IDA
GO:0016829 "lyase activity" evidence=IEA
GO:0016831 "carboxy-lyase activity" evidence=IEA
GO:0000166 "nucleotide binding" evidence=IEA
UNIPROTKB|P96880 purE "N5-carboxyaminoimidazole ribonucleotide mutase" [Mycobacterium tuberculosis (taxid:1773)] Back     alignment and assigned GO terms
CGD|CAL0003241 ADE2 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
UNIPROTKB|Q92210 ADE2 "Phosphoribosylaminoimidazole carboxylase" [Candida albicans SC5314 (taxid:237561)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_0611 GSU_0611 "phosphoribosylaminoimidazole carboxylase, catalytic subunit" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
TAIR|locus:2040771 AT2G37690 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
POMBASE|SPCC1322.13 ade6 "phosphoribosylaminoimidazole carboxylase Ade6" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
UNIPROTKB|Q9KVT7 purE "N5-carboxyaminoimidazole ribonucleotide mutase" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] Back     alignment and assigned GO terms
TIGR_CMR|VC_0052 VC_0052 "phosphoribosylaminoimidazole carboxylase, catalytic subunit" [Vibrio cholerae O1 biovar El Tor (taxid:686)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0283987 purC/E "PAICS" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer5.4.99LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query185
PLN02948577 PLN02948, PLN02948, phosphoribosylaminoimidazole c 8e-27
pfam00731150 pfam00731, AIRC, AIR carboxylase 6e-25
smart01001152 smart01001, AIRC, AIR carboxylase 8e-25
COG0041162 COG0041, PurE, Phosphoribosylcarboxyaminoimidazole 2e-24
TIGR01162156 TIGR01162, purE, phosphoribosylaminoimidazole carb 4e-22
>gnl|CDD|178534 PLN02948, PLN02948, phosphoribosylaminoimidazole carboxylase Back     alignment and domain information 
 Score =  105 bits (264), Expect = 8e-27
 Identities = 42/73 (57%), Positives = 50/73 (68%)

Query: 111 DTPIVGIIMESDSDLPVMNDAARTLSDFGVPYEIKILSPHQNRKGALSYALSAKERGIKI 170
            TP+VGIIM SDSDLP M DAA  L  FGVPYE+ I+S H+  +   SYA SA  RG+++
Sbjct: 409 GTPLVGIIMGSDSDLPTMKDAAEILDSFGVPYEVTIVSAHRTPERMFSYARSAHSRGLQV 468

Query: 171 IIVGDGVEAHLSG 183
           II G G  AHL G
Sbjct: 469 IIAGAGGAAHLPG 481

Length = 577
>gnl|CDD|144362 pfam00731, AIRC, AIR carboxylase Back     alignment and domain information
>gnl|CDD|214965 smart01001, AIRC, AIR carboxylase Back     alignment and domain information
>gnl|CDD|223119 COG0041, PurE, Phosphoribosylcarboxyaminoimidazole (NCAIR) mutase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|130230 TIGR01162, purE, phosphoribosylaminoimidazole carboxylase, PurE protein Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 185
COG0041162 PurE Phosphoribosylcarboxyaminoimidazole (NCAIR) m 99.97
TIGR01162156 purE phosphoribosylaminoimidazole carboxylase, Pur 99.94
PLN02948577 phosphoribosylaminoimidazole carboxylase 99.93
PF00731150 AIRC: AIR carboxylase; InterPro: IPR000031 Phospho 99.93
COG1691254 NCAIR mutase (PurE)-related proteins [General func 99.43
KOG2835373 consensus Phosphoribosylamidoimidazole-succinocarb 98.96
cd08170 351 GlyDH Glycerol dehydrogenases (GlyDH) catalyzes ox 95.88
cd08550 349 GlyDH-like Glycerol_dehydrogenase-like. Families o 95.81
cd08185 380 Fe-ADH1 Iron-containing alcohol dehydrogenases-lik 95.23
cd08183 374 Fe-ADH2 Iron-containing alcohol dehydrogenases-lik 95.05
cd08551 370 Fe-ADH iron-containing alcohol dehydrogenases (Fe- 94.85
PRK09423 366 gldA glycerol dehydrogenase; Provisional 94.64
cd08171 345 GlyDH-like2 Glycerol dehydrogenase-like. Glycerol 94.64
cd08195 345 DHQS Dehydroquinate synthase (DHQS) catalyzes the 94.55
cd08175 348 G1PDH Glycerol-1-phosphate dehydrogenase (G1PDH) c 94.49
TIGR01357 344 aroB 3-dehydroquinate synthase. This model represe 94.24
PRK00843 350 egsA NAD(P)-dependent glycerol-1-phosphate dehydro 94.23
cd08182 367 HEPD Hydroxyethylphosphoate dehydrogenase (HEPD) c 94.2
cd08194 375 Fe-ADH6 Iron-containing alcohol dehydrogenases-lik 94.1
cd08186 383 Fe-ADH8 Iron-containing alcohol dehydrogenase. Typ 94.02
cd08176 377 LPO Lactadehyde:propanediol oxidoreductase (LPO) c 93.98
PF00465 366 Fe-ADH: Iron-containing alcohol dehydrogenase ; In 93.9
cd08178 398 AAD_C C-terminal alcohol dehydrogenase domain of t 93.79
cd08187 382 BDH Butanol dehydrogenase catalyzes the conversion 93.6
cd08192 370 Fe-ADH7 Iron-containing alcohol dehydrogenases-lik 93.48
PRK00002 358 aroB 3-dehydroquinate synthase; Reviewed 93.41
cd08181 357 PPD-like 1,3-propanediol dehydrogenase-like (PPD). 93.37
TIGR02638 379 lactal_redase lactaldehyde reductase. This clade o 93.36
cd08197 355 DOIS 2-deoxy-scyllo-inosose synthase (DOIS) cataly 93.14
cd08173 339 Gro1PDH Sn-glycerol-1-phosphate dehydrogenase (Gro 93.1
cd08179 375 NADPH_BDH NADPH-dependent butanol dehydrogenase in 93.08
cd08188 377 Fe-ADH4 Iron-containing alcohol dehydrogenases-lik 93.02
cd08189 374 Fe-ADH5 Iron-containing alcohol dehydrogenases-lik 92.89
PRK10624 382 L-1,2-propanediol oxidoreductase; Provisional 92.88
cd07766 332 DHQ_Fe-ADH Dehydroquinate synthase-like (DHQ-like) 92.46
cd08193 376 HVD 5-hydroxyvalerate dehydrogenase (HVD) catalyze 92.41
cd08190 414 HOT Hydroxyacid-oxoacid transhydrogenase (HOT) inv 92.28
PRK15454 395 ethanol dehydrogenase EutG; Provisional 92.28
cd08199 354 EEVS 2-epi-5-epi-valiolone synthase (EEVS). 2-epi- 92.11
PRK09860 383 putative alcohol dehydrogenase; Provisional 91.73
cd08549 332 G1PDH_related Glycerol-1-phosphate_dehydrogenase a 91.48
PF04392 294 ABC_sub_bind: ABC transporter substrate binding pr 91.05
PRK15138 387 aldehyde reductase; Provisional 90.79
PF10096 243 DUF2334: Uncharacterized protein conserved in bact 90.67
cd0302890 GRX_PICOT_like Glutaredoxin (GRX) family, PKC-inte 90.59
PRK01372 304 ddl D-alanine--D-alanine ligase; Reviewed 90.52
cd08191 386 HHD 6-hydroxyhexanoate dehydrogenase (HHD) catalyz 89.95
cd03786 363 GT1_UDP-GlcNAc_2-Epimerase Bacterial members of th 89.62
PLN02834 433 3-dehydroquinate synthase 89.27
PRK11914 306 diacylglycerol kinase; Reviewed 89.12
PRK13055 334 putative lipid kinase; Reviewed 88.65
PRK10703 341 DNA-binding transcriptional repressor PurR; Provis 88.62
cd08180 332 PDD 1,3-propanediol dehydrogenase (PPD) catalyzes 88.55
cd08177 337 MAR Maleylacetate reductase is involved in many ar 88.48
TIGR0036597 monothiol glutaredoxin, Grx4 family. The gene for 88.23
TIGR03702 293 lip_kinase_YegS lipid kinase YegS. Members of this 87.25
PRK00861 300 putative lipid kinase; Reviewed 87.19
PF13407 257 Peripla_BP_4: Periplasmic binding protein domain; 86.17
COG2984 322 ABC-type uncharacterized transport system, peripla 85.52
cd01391 269 Periplasmic_Binding_Protein_Type_1 Type 1 periplas 85.27
PRK10727 343 DNA-binding transcriptional regulator GalR; Provis 85.26
cd01539 303 PBP1_GGBP Periplasmic glucose/galactose-binding pr 84.73
cd08172 347 GlyDH-like1 Glycerol dehydrogenases-like. Glycerol 84.46
cd08169 344 DHQ-like Dehydroquinate synthase-like which includ 84.33
cd06318 282 PBP1_ABC_sugar_binding_like_9 Periplasmic sugar-bi 84.3
PRK14987 331 gluconate operon transcriptional regulator; Provis 84.17
PRK13054 300 lipid kinase; Reviewed 84.12
COG1454 377 EutG Alcohol dehydrogenase, class IV [Energy produ 84.05
PRK13337 304 putative lipid kinase; Reviewed 83.83
PRK10586 362 putative oxidoreductase; Provisional 83.83
PRK13805 862 bifunctional acetaldehyde-CoA/alcohol dehydrogenas 83.68
cd08184 347 Fe-ADH3 Iron-containing alcohol dehydrogenases-lik 83.66
TIGR00147 293 lipid kinase, YegS/Rv2252/BmrU family. The E. coli 83.61
cd06321 271 PBP1_ABC_sugar_binding_like_11 Periplasmic sugar-b 83.06
PRK10653 295 D-ribose transporter subunit RbsB; Provisional 83.0
COG069580 GrxC Glutaredoxin and related proteins [Posttransl 82.87
PF00763117 THF_DHG_CYH: Tetrahydrofolate dehydrogenase/cycloh 82.86
cd06273 268 PBP1_GntR_like_1 This group includes the ligand-bi 82.63
cd01542 259 PBP1_TreR_like Ligand-binding domain of DNA transc 82.61
cd01988132 Na_H_Antiporter_C The C-terminal domain of a subfa 82.29
PRK10014 342 DNA-binding transcriptional repressor MalI; Provis 82.22
cd06305 273 PBP1_methylthioribose_binding_like Methylthioribos 82.07
cd0086091 ThrRS_anticodon ThrRS Threonyl-anticodon binding d 81.78
PRK10076213 pyruvate formate lyase II activase; Provisional 81.04
cd01537 264 PBP1_Repressors_Sugar_Binding_like Ligand-binding 80.85
COG1597 301 LCB5 Sphingosine kinase and enzymes related to euk 80.78
PRK09492 315 treR trehalose repressor; Provisional 80.58
cd06296 270 PBP1_CatR_like Ligand-binding domain of a LacI-lik 80.45
cd06283 267 PBP1_RegR_EndR_KdgR_like Ligand-binding domain of 80.38
PF03358152 FMN_red: NADPH-dependent FMN reductase; InterPro: 80.33
PRK08862 227 short chain dehydrogenase; Provisional 80.26
TIGR01481 329 ccpA catabolite control protein A. Catabolite cont 80.18
PRK08195 337 4-hyroxy-2-oxovalerate/4-hydroxy-2-oxopentanoic ac 80.14
>COG0041 PurE Phosphoribosylcarboxyaminoimidazole (NCAIR) mutase [Nucleotide transport and metabolism] Back     alignment and domain information 
Probab=99.97  E-value=1.6e-31  Score=219.17  Aligned_cols=73  Identities=49%  Similarity=0.840  Sum_probs=71.5

Q ss_pred             CeEEEEeccCCCHHHHHHHHHHHHHhCCCeeEEEEcCCCCchHHHHHHHHHhhCCCeEEEEecCccCcCcCCC
Q 029926          113 PIVGIIMESDSDLPVMNDAARTLSDFGVPYEIKILSPHQNRKGALSYALSAKERGIKIIIVGDGVEAHLSGTL  185 (185)
Q Consensus       113 ~kVaIIMGS~SDl~vmekA~~vLeefGIpyEvrVaSAHRtPe~l~ey~k~ae~~GikVIIAvAG~AAhLPGVV  185 (185)
                      ++|+|||||+|||++|++|.++|++|||+||++|+||||||+++.+|+++++++|++||||+||+||||||||
T Consensus         3 ~~V~IIMGS~SD~~~mk~Aa~~L~~fgi~ye~~VvSAHRTPe~m~~ya~~a~~~g~~viIAgAGgAAHLPGmv   75 (162)
T COG0041           3 PKVGIIMGSKSDWDTMKKAAEILEEFGVPYEVRVVSAHRTPEKMFEYAEEAEERGVKVIIAGAGGAAHLPGMV   75 (162)
T ss_pred             ceEEEEecCcchHHHHHHHHHHHHHcCCCeEEEEEeccCCHHHHHHHHHHHHHCCCeEEEecCcchhhcchhh
Confidence            3799999999999999999999999999999999999999999999999999999999999999999999986

>TIGR01162 purE phosphoribosylaminoimidazole carboxylase, PurE protein Back     alignment and domain information
>PLN02948 phosphoribosylaminoimidazole carboxylase Back     alignment and domain information
>PF00731 AIRC: AIR carboxylase; InterPro: IPR000031 Phosphoribosylaminoimidazole carboxylase is a fusion protein in plants and fungi, but consists of two non-interacting proteins in bacteria, PurK and PurE Back     alignment and domain information
>COG1691 NCAIR mutase (PurE)-related proteins [General function prediction only] Back     alignment and domain information
>KOG2835 consensus Phosphoribosylamidoimidazole-succinocarboxamide synthase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd08170 GlyDH Glycerol dehydrogenases (GlyDH) catalyzes oxidation of glycerol to dihydroxyacetone in glycerol dissmilation Back     alignment and domain information
>cd08550 GlyDH-like Glycerol_dehydrogenase-like Back     alignment and domain information
>cd08185 Fe-ADH1 Iron-containing alcohol dehydrogenases-like Back     alignment and domain information
>cd08183 Fe-ADH2 Iron-containing alcohol dehydrogenases-like Back     alignment and domain information
>cd08551 Fe-ADH iron-containing alcohol dehydrogenases (Fe-ADH)-like Back     alignment and domain information
>PRK09423 gldA glycerol dehydrogenase; Provisional Back     alignment and domain information
>cd08171 GlyDH-like2 Glycerol dehydrogenase-like Back     alignment and domain information
>cd08195 DHQS Dehydroquinate synthase (DHQS) catalyzes the conversion of DAHP to DHQ in shikimate pathway for aromatic compounds synthesis Back     alignment and domain information
>cd08175 G1PDH Glycerol-1-phosphate dehydrogenase (G1PDH) catalyzes the reversible reduction of dihydroxyacetone phosphate (DHAP) to glycerol-1-phosphate (G1P) in an NADH-dependent manner Back     alignment and domain information
>TIGR01357 aroB 3-dehydroquinate synthase Back     alignment and domain information
>PRK00843 egsA NAD(P)-dependent glycerol-1-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>cd08182 HEPD Hydroxyethylphosphoate dehydrogenase (HEPD) catalyzes the reduction of phosphonoacetaldehyde (PnAA) to hydroxyethylphosphoate (HEP) Back     alignment and domain information
>cd08194 Fe-ADH6 Iron-containing alcohol dehydrogenases-like Back     alignment and domain information
>cd08186 Fe-ADH8 Iron-containing alcohol dehydrogenase Back     alignment and domain information
>cd08176 LPO Lactadehyde:propanediol oxidoreductase (LPO) catalyzes the interconversion between L-lactaldehyde and L-1,2-propanediol in Escherichia coli and other enterobacteria Back     alignment and domain information
>PF00465 Fe-ADH: Iron-containing alcohol dehydrogenase ; InterPro: IPR001670 Alcohol dehydrogenase (1 Back     alignment and domain information
>cd08178 AAD_C C-terminal alcohol dehydrogenase domain of the acetaldehyde dehydrogenase-alcohol dehydrogenase bifunctional two-domain protein (AAD) Back     alignment and domain information
>cd08187 BDH Butanol dehydrogenase catalyzes the conversion of butyraldehyde to butanol with the cofactor NAD(P)H being oxidized in the process Back     alignment and domain information
>cd08192 Fe-ADH7 Iron-containing alcohol dehydrogenases-like, involved in the linear alkylbenzenesulfonate (LAS) degradation pathway Back     alignment and domain information
>PRK00002 aroB 3-dehydroquinate synthase; Reviewed Back     alignment and domain information
>cd08181 PPD-like 1,3-propanediol dehydrogenase-like (PPD) Back     alignment and domain information
>TIGR02638 lactal_redase lactaldehyde reductase Back     alignment and domain information
>cd08197 DOIS 2-deoxy-scyllo-inosose synthase (DOIS) catalyzes carbocycle formation from D-glucose-6-phosphate to 2-deoxy-scyllo-inosose through a multistep reaction in the biosynthesis of aminoglycoside antibiotics Back     alignment and domain information
>cd08173 Gro1PDH Sn-glycerol-1-phosphate dehydrogenase (Gro1PDH) catalyzes the reversible conversion between dihydroxyacetone phosphate and glycerol-1-phosphate using either NADH or NADPH as a coenzyme Back     alignment and domain information
>cd08179 NADPH_BDH NADPH-dependent butanol dehydrogenase involved in the butanol and ethanol formation pathway in bacteria Back     alignment and domain information
>cd08188 Fe-ADH4 Iron-containing alcohol dehydrogenases-like Back     alignment and domain information
>cd08189 Fe-ADH5 Iron-containing alcohol dehydrogenases-like Back     alignment and domain information
>PRK10624 L-1,2-propanediol oxidoreductase; Provisional Back     alignment and domain information
>cd07766 DHQ_Fe-ADH Dehydroquinate synthase-like (DHQ-like) and iron-containing alcohol dehydrogenases (Fe-ADH) Back     alignment and domain information
>cd08193 HVD 5-hydroxyvalerate dehydrogenase (HVD) catalyzes the oxidation of 5-hydroxyvalerate to 5-oxovalerate with NAD+ as cofactor Back     alignment and domain information
>cd08190 HOT Hydroxyacid-oxoacid transhydrogenase (HOT) involved in gamma-hydroxybutyrate metabolism Back     alignment and domain information
>PRK15454 ethanol dehydrogenase EutG; Provisional Back     alignment and domain information
>cd08199 EEVS 2-epi-5-epi-valiolone synthase (EEVS) Back     alignment and domain information
>PRK09860 putative alcohol dehydrogenase; Provisional Back     alignment and domain information
>cd08549 G1PDH_related Glycerol-1-phosphate_dehydrogenase and related proteins Back     alignment and domain information
>PF04392 ABC_sub_bind: ABC transporter substrate binding protein; InterPro: IPR007487 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>PRK15138 aldehyde reductase; Provisional Back     alignment and domain information
>PF10096 DUF2334: Uncharacterized protein conserved in bacteria (DUF2334); InterPro: IPR018763 This group of proteins has no known function Back     alignment and domain information
>cd03028 GRX_PICOT_like Glutaredoxin (GRX) family, PKC-interacting cousin of TRX (PICOT)-like subfamily; composed of PICOT and GRX-PICOT-like proteins Back     alignment and domain information
>PRK01372 ddl D-alanine--D-alanine ligase; Reviewed Back     alignment and domain information
>cd08191 HHD 6-hydroxyhexanoate dehydrogenase (HHD) catalyzes the oxidation of 6-hydroxyhexanoate to 6-oxohexanoate Back     alignment and domain information
>cd03786 GT1_UDP-GlcNAc_2-Epimerase Bacterial members of the UDP-N-Acetylglucosamine (GlcNAc) 2-Epimerase family are known to catalyze the reversible interconversion of UDP-GlcNAc and UDP-N-acetylmannosamine (UDP-ManNAc) Back     alignment and domain information
>PLN02834 3-dehydroquinate synthase Back     alignment and domain information
>PRK11914 diacylglycerol kinase; Reviewed Back     alignment and domain information
>PRK13055 putative lipid kinase; Reviewed Back     alignment and domain information
>PRK10703 DNA-binding transcriptional repressor PurR; Provisional Back     alignment and domain information
>cd08180 PDD 1,3-propanediol dehydrogenase (PPD) catalyzes the reduction of 3-hydroxypropionaldehyde (3-HPA) to 1,3-propanediol in glycerol metabolism Back     alignment and domain information
>cd08177 MAR Maleylacetate reductase is involved in many aromatic compounds degradation pathways of aerobic microbes Back     alignment and domain information
>TIGR00365 monothiol glutaredoxin, Grx4 family Back     alignment and domain information
>TIGR03702 lip_kinase_YegS lipid kinase YegS Back     alignment and domain information
>PRK00861 putative lipid kinase; Reviewed Back     alignment and domain information
>PF13407 Peripla_BP_4: Periplasmic binding protein domain; PDB: 3BRS_B 3GBP_A 3GA5_A 1GCG_A 1GCA_A 3H75_A 3D02_A 3L49_B 3EJW_B 3T95_A Back     alignment and domain information
>COG2984 ABC-type uncharacterized transport system, periplasmic component [General function prediction only] Back     alignment and domain information
>cd01391 Periplasmic_Binding_Protein_Type_1 Type 1 periplasmic binding fold superfamily Back     alignment and domain information
>PRK10727 DNA-binding transcriptional regulator GalR; Provisional Back     alignment and domain information
>cd01539 PBP1_GGBP Periplasmic glucose/galactose-binding protein (GGBP) involved in chemotaxis towards, and active transport of, glucose and galactose in various bacterial species Back     alignment and domain information
>cd08172 GlyDH-like1 Glycerol dehydrogenases-like Back     alignment and domain information
>cd08169 DHQ-like Dehydroquinate synthase-like which includes dehydroquinate synthase, 2-deoxy-scyllo-inosose synthase, and 2-epi-5-epi-valiolone synthase Back     alignment and domain information
>cd06318 PBP1_ABC_sugar_binding_like_9 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems Back     alignment and domain information
>PRK14987 gluconate operon transcriptional regulator; Provisional Back     alignment and domain information
>PRK13054 lipid kinase; Reviewed Back     alignment and domain information
>COG1454 EutG Alcohol dehydrogenase, class IV [Energy production and conversion] Back     alignment and domain information
>PRK13337 putative lipid kinase; Reviewed Back     alignment and domain information
>PRK10586 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK13805 bifunctional acetaldehyde-CoA/alcohol dehydrogenase; Provisional Back     alignment and domain information
>cd08184 Fe-ADH3 Iron-containing alcohol dehydrogenases-like Back     alignment and domain information
>TIGR00147 lipid kinase, YegS/Rv2252/BmrU family Back     alignment and domain information
>cd06321 PBP1_ABC_sugar_binding_like_11 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems Back     alignment and domain information
>PRK10653 D-ribose transporter subunit RbsB; Provisional Back     alignment and domain information
>COG0695 GrxC Glutaredoxin and related proteins [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00763 THF_DHG_CYH: Tetrahydrofolate dehydrogenase/cyclohydrolase, catalytic domain; InterPro: IPR020630 Enzymes that participate in the transfer of one-carbon units require the coenzyme tetrahydrofolate (THF) Back     alignment and domain information
>cd06273 PBP1_GntR_like_1 This group includes the ligand-binding domain of putative DNA transcription repressors which are highly similar to that of the repressor specific for gluconate (GntR), a member of the LacI-GalR family of bacterial transcription regulators Back     alignment and domain information
>cd01542 PBP1_TreR_like Ligand-binding domain of DNA transcription repressor specific for trehalose (TreR) which is a member of the LacI-GalR family of bacterial transcription regulators Back     alignment and domain information
>cd01988 Na_H_Antiporter_C The C-terminal domain of a subfamily of Na+ /H+ antiporter existed in bacteria and archea Back     alignment and domain information
>PRK10014 DNA-binding transcriptional repressor MalI; Provisional Back     alignment and domain information
>cd06305 PBP1_methylthioribose_binding_like Methylthioribose-binding protein-like of ABC-type transport systems that belong to a family of pentose/hexose sugar-binding proteins of the type I periplasmic binding protein (PBP1) superfamily Back     alignment and domain information
>cd00860 ThrRS_anticodon ThrRS Threonyl-anticodon binding domain Back     alignment and domain information
>PRK10076 pyruvate formate lyase II activase; Provisional Back     alignment and domain information
>cd01537 PBP1_Repressors_Sugar_Binding_like Ligand-binding domain of the LacI-GalR family of transcription regulators and the sugar-binding domain of ABC-type transport systems Back     alignment and domain information
>COG1597 LCB5 Sphingosine kinase and enzymes related to eukaryotic diacylglycerol kinase [Lipid metabolism / General function prediction only] Back     alignment and domain information
>PRK09492 treR trehalose repressor; Provisional Back     alignment and domain information
>cd06296 PBP1_CatR_like Ligand-binding domain of a LacI-like transcriptional regulator, CatR which is involved in catechol degradation Back     alignment and domain information
>cd06283 PBP1_RegR_EndR_KdgR_like Ligand-binding domain of DNA transcription repressor RegR and other putative regulators such as KdgR and EndR Back     alignment and domain information
>PF03358 FMN_red: NADPH-dependent FMN reductase; InterPro: IPR005025 NADPH-dependent FMN reductase (1 Back     alignment and domain information
>PRK08862 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01481 ccpA catabolite control protein A Back     alignment and domain information
>PRK08195 4-hyroxy-2-oxovalerate/4-hydroxy-2-oxopentanoic acid aldolase,; Validated Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query185
1o4v_A183 Crystal Structure Of The Catalytic Subunit Of A Pho 8e-16
3lp6_A174 Crystal Structure Of Rv3275c-E60a From Mycobacteriu 5e-12
1xmp_A170 Crystal Structure Of Pure (Ba0288) From Bacillus An 9e-11
4b4k_A181 Crystal Structure Of Bacillus Anthracis Pure Length 1e-10
1u11_A182 Pure (N5-Carboxyaminoimidazole Ribonucleotide Mutas 2e-10
2fw1_A183 Structure Of Pure (n5-carboxyaminoimidazole Ribonuc 2e-10
4grd_A173 Crystal Structure Of Phosphoribosylaminoimidazole C 2e-10
2fwa_A183 Structure Of Pure (n5-carboxyaminoimidazole Ribonuc 2e-09
2fw6_A183 Structure Of Pure (N5-Carboxyaminoimidazole Ribonuc 2e-09
3opq_A163 Phosphoribosylaminoimidazole Carboxylase With Fruct 2e-09
3oow_A166 Octameric Structure Of The Phosphoribosylaminoimida 2e-09
2fwi_A183 Structure Of Pure (n5-carboxyaminoimidazole Ribonuc 3e-09
2fwb_A183 Structure Of Pure (N5-Carboxyaminoimidazole Ribonuc 4e-09
2fw9_A183 Structure Of Pure (n5-carboxyaminoimidazole Ribonuc 4e-09
2fw8_A183 Structure Of Pure (N5-Carboxyaminoimidazole Ribonuc 4e-07
2nsl_A169 E. Coli Pure H45n Mutant Complexed With Cair Length 5e-07
2nsh_A169 E. Coli Pure H45q Mutant Complexed With Nitro-Air L 5e-07
3kuu_A174 Structure Of The Pure Phosphoribosylaminoimidazole 1e-06
1qcz_A169 Crystal Structure Of E. Coli Pure, An Unusual Mutas 2e-06
2ate_A169 Structure Of The Complex Of Pure With Nitroair Leng 2e-06
1d7a_A161 Crystal Structure Of E. Coli Pure-Mononucleotide Co 2e-06
3ors_A163 Crystal Structure Of N5-Carboxyaminoimidazole Ribon 4e-05
3trh_A169 Structure Of A Phosphoribosylaminoimidazole Carboxy 2e-04
>pdb|1O4V|A Chain A, Crystal Structure Of The Catalytic Subunit Of A Phosphoribosylaminoimidazole Mutase (Tm0446) From Thermotoga Maritima At 1.77 A Resolution Length = 183 Back     alignment and structure 
Iteration: 1

 Score = 79.7 bits (195), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 40/74 (54%), Positives = 49/74 (66%)
Query: 112 TPIVGIIMESDSDLPVMNDAARTLSDFGVPYEIKILSPHQNRKGALSYALSAKERGIKII 171
            P VGIIM SDSDLPVM  AA  L +FG+ YEI I+S H+       YA +A+ERGI++I
Sbjct: 13  VPRVGIIMGSDSDLPVMKQAAEILEEFGIDYEITIVSAHRTPDRMFEYAKNAEERGIEVI 72
Query: 172 IVGDGVEAHLSGTL 185
           I G G  AHL G +
Sbjct: 73  IAGAGGAAHLPGMV 86
>pdb|3LP6|A Chain A, Crystal Structure Of Rv3275c-E60a From Mycobacterium Tubercu 1.7a Resolution Length = 174 Back     alignment and structure
>pdb|1XMP|A Chain A, Crystal Structure Of Pure (Ba0288) From Bacillus Anthracis At 1.8 Resolution Length = 170 Back     alignment and structure
>pdb|4B4K|A Chain A, Crystal Structure Of Bacillus Anthracis Pure Length = 181 Back     alignment and structure
>pdb|1U11|A Chain A, Pure (N5-Carboxyaminoimidazole Ribonucleotide Mutase) From The Acidophile Acetobacter Aceti Length = 182 Back     alignment and structure
>pdb|2FW1|A Chain A, Structure Of Pure (n5-carboxyaminoimidazole Ribonucleotide Mutase) From The Acidophilic Bacterium Acetobacter Aceti, At Ph 8.5 Length = 183 Back     alignment and structure
>pdb|4GRD|A Chain A, Crystal Structure Of Phosphoribosylaminoimidazole Carboxylase Catalytic Subunit From Burkholderia Cenocepacia J2315 Length = 173 Back     alignment and structure
>pdb|2FWA|A Chain A, Structure Of Pure (n5-carboxyaminoimidazole Ribonucleotide Mutase) H89n From The Acidophilic Bacterium Acetobacter Aceti, At Ph 7 Length = 183 Back     alignment and structure
>pdb|2FW6|A Chain A, Structure Of Pure (N5-Carboxyaminoimidazole Ribonucleotide Mutase) Mutant H59n From The Acidophilic Bacterium Acetobacter Aceti, At Ph 5.4 Length = 183 Back     alignment and structure
>pdb|3OPQ|A Chain A, Phosphoribosylaminoimidazole Carboxylase With Fructose-6-Phosphate Bound To The Central Channel Of The Octameric Protein Structure. Length = 163 Back     alignment and structure
>pdb|3OOW|A Chain A, Octameric Structure Of The Phosphoribosylaminoimidazole Carboxylase Catalytic Subunit From Francisella Tularensis Subsp. Tularensis Schu S4. Length = 166 Back     alignment and structure
>pdb|2FWI|A Chain A, Structure Of Pure (n5-carboxyaminoimidazole Ribonucleotide Mutase) H59d, From The Acidophilic Bacterium Acetobacter Aceti, Complexed With 5-aminoimidazole Ribonucleotide (air) Length = 183 Back     alignment and structure
>pdb|2FWB|A Chain A, Structure Of Pure (N5-Carboxyaminoimidazole Ribonucleotide Mutase) H89f From The Acidophilic Bacterium Acetobacter Aceti, At Ph 8 Length = 183 Back     alignment and structure
>pdb|2FW9|A Chain A, Structure Of Pure (n5-carboxyaminoimidazole Ribonucleotide Mutase) H59f From The Acidophilic Bacterium Acetobacter Aceti, At Ph 8 Length = 183 Back     alignment and structure
>pdb|2FW8|A Chain A, Structure Of Pure (N5-Carboxyaminoimidazole Ribonucleotide Mutase) H89g From The Acidophilic Bacterium Acetobacter Aceti, At Ph 8 Length = 183 Back     alignment and structure
>pdb|2NSL|A Chain A, E. Coli Pure H45n Mutant Complexed With Cair Length = 169 Back     alignment and structure
>pdb|2NSH|A Chain A, E. Coli Pure H45q Mutant Complexed With Nitro-Air Length = 169 Back     alignment and structure
>pdb|3KUU|A Chain A, Structure Of The Pure Phosphoribosylaminoimidazole Carboxylase Catalytic Subunit From Yersinia Pestis Length = 174 Back     alignment and structure
>pdb|1QCZ|A Chain A, Crystal Structure Of E. Coli Pure, An Unusual Mutase That Catalyzes The Conversion Of N5-carboxyaminoimidazole Ribonucleotide (n5-cair) To 4-carboxyaminoimidazole Ribonucleotide (cair) In The Purine Biosynthetic Pathway Length = 169 Back     alignment and structure
>pdb|2ATE|A Chain A, Structure Of The Complex Of Pure With Nitroair Length = 169 Back     alignment and structure
>pdb|1D7A|A Chain A, Crystal Structure Of E. Coli Pure-Mononucleotide Complex. Length = 161 Back     alignment and structure
>pdb|3ORS|A Chain A, Crystal Structure Of N5-Carboxyaminoimidazole Ribonucleotide Mutase From Staphylococcus Aureus Length = 163 Back     alignment and structure
>pdb|3TRH|A Chain A, Structure Of A Phosphoribosylaminoimidazole Carboxylase Catalytic Subunit (Pure) From Coxiella Burnetii Length = 169 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query185
1o4v_A183 Phosphoribosylaminoimidazole mutase PURE; structur 1e-29
3lp6_A174 Phosphoribosylaminoimidazole carboxylase catalyti; 2e-28
3trh_A169 Phosphoribosylaminoimidazole carboxylase carboxylt 1e-26
3rg8_A159 Phosphoribosylaminoimidazole carboxylase, PURE PR; 2e-26
4b4k_A181 N5-carboxyaminoimidazole ribonucleotide mutase; is 4e-26
3ors_A163 N5-carboxyaminoimidazole ribonucleotide mutase; is 4e-26
1xmp_A170 PURE, phosphoribosylaminoimidazole carboxylase; pu 4e-26
3kuu_A174 Phosphoribosylaminoimidazole carboxylase catalyti 3e-25
3oow_A166 Phosphoribosylaminoimidazole carboxylase,catalyic; 3e-25
1u11_A182 PURE (N5-carboxyaminoimidazole ribonucleotide MUT; 3e-25
2ywx_A157 Phosphoribosylaminoimidazole carboxylase catalyti; 8e-22
2h31_A425 Multifunctional protein ADE2; alpha-beta-alpha, li 1e-14
>1o4v_A Phosphoribosylaminoimidazole mutase PURE; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; 1.77A {Thermotoga maritima} SCOP: c.23.8.1 Length = 183 Back     alignment and structure
 Score =  106 bits (266), Expect = 1e-29
 Identities = 40/82 (48%), Positives = 50/82 (60%)

Query: 102 EENANGDSTDTPIVGIIMESDSDLPVMNDAARTLSDFGVPYEIKILSPHQNRKGALSYAL 161
            +  +      P VGIIM SDSDLPVM  AA  L +FG+ YEI I+S H+       YA 
Sbjct: 3   SDKIHHHHHHVPRVGIIMGSDSDLPVMKQAAEILEEFGIDYEITIVSAHRTPDRMFEYAK 62

Query: 162 SAKERGIKIIIVGDGVEAHLSG 183
           +A+ERGI++II G G  AHL G
Sbjct: 63  NAEERGIEVIIAGAGGAAHLPG 84
>3lp6_A Phosphoribosylaminoimidazole carboxylase catalyti; alpha and beta protein, structural genomics, PSI-2, protein initiative; 1.70A {Mycobacterium tuberculosis} Length = 174 Back     alignment and structure
>3trh_A Phosphoribosylaminoimidazole carboxylase carboxyltransferase subunit; purines, pyrimidines, nucleosides, nucleotides, lyase; 2.20A {Coxiella burnetii} Length = 169 Back     alignment and structure
>3rg8_A Phosphoribosylaminoimidazole carboxylase, PURE PR; purine biosynthesis, lyase; 1.74A {Treponema denticola} PDB: 3rgg_A* Length = 159 Back     alignment and structure
>4b4k_A N5-carboxyaminoimidazole ribonucleotide mutase; isomerase; 2.50A {Bacillus anthracis} Length = 181 Back     alignment and structure
>3ors_A N5-carboxyaminoimidazole ribonucleotide mutase; isomerase, isomerase,biosynthetic protein; 1.45A {Staphylococcus aureus subsp} Length = 163 Back     alignment and structure
>1xmp_A PURE, phosphoribosylaminoimidazole carboxylase; purine biosynthesis, spine, lyase; 1.80A {Bacillus anthracis} SCOP: c.23.8.1 Length = 170 Back     alignment and structure
>3kuu_A Phosphoribosylaminoimidazole carboxylase catalyti PURE; 3-layer (ABA) sandwich, rossmann fold, csgid, lyase, structu genomics; 1.41A {Yersinia pestis} PDB: 1d7a_A* 1qcz_A 2ate_A* 2nsl_A* 2nsh_A* 2nsj_A* Length = 174 Back     alignment and structure
>3oow_A Phosphoribosylaminoimidazole carboxylase,catalyic; structural genomics, center for structural genomics of infec diseases, csgid; HET: MSE; 1.75A {Francisella tularensis subsp} PDB: 3opq_A* Length = 166 Back     alignment and structure
>1u11_A PURE (N5-carboxyaminoimidazole ribonucleotide MUT; acidophIle, protein stability, lyase; HET: CIT; 1.55A {Acetobacter aceti} SCOP: c.23.8.1 PDB: 2fwj_A* 2fw1_A* 2fwb_A 2fwa_A 2fw9_A 2fw7_A 2fw6_A 2fwp_A* 2fwi_A* 2fw8_A Length = 182 Back     alignment and structure
>2ywx_A Phosphoribosylaminoimidazole carboxylase catalyti; rossmann fold, structural genomics, NPPSFA; 2.31A {Methanocaldococcus jannaschii} Length = 157 Back     alignment and structure
>2h31_A Multifunctional protein ADE2; alpha-beta-alpha, ligase, lyase; 2.80A {Homo sapiens} Length = 425 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query185
4b4k_A181 N5-carboxyaminoimidazole ribonucleotide mutase; is 99.96
4grd_A173 N5-CAIR mutase, phosphoribosylaminoimidazole carbo 99.96
1xmp_A170 PURE, phosphoribosylaminoimidazole carboxylase; pu 99.95
3rg8_A159 Phosphoribosylaminoimidazole carboxylase, PURE PR; 99.95
3oow_A166 Phosphoribosylaminoimidazole carboxylase,catalyic; 99.95
3kuu_A174 Phosphoribosylaminoimidazole carboxylase catalyti 99.95
3trh_A169 Phosphoribosylaminoimidazole carboxylase carboxylt 99.95
3ors_A163 N5-carboxyaminoimidazole ribonucleotide mutase; is 99.95
3lp6_A174 Phosphoribosylaminoimidazole carboxylase catalyti; 99.95
1u11_A182 PURE (N5-carboxyaminoimidazole ribonucleotide MUT; 99.94
1o4v_A183 Phosphoribosylaminoimidazole mutase PURE; structur 99.94
2ywx_A157 Phosphoribosylaminoimidazole carboxylase catalyti; 99.92
2h31_A425 Multifunctional protein ADE2; alpha-beta-alpha, li 99.91
3uhj_A 387 Probable glycerol dehydrogenase; structural genomi 94.98
1jq5_A 370 Glycerol dehydrogenase; oxidoreductase, NAD, glyce 94.83
3bfj_A 387 1,3-propanediol oxidoreductase; opportunistic path 94.13
1o2d_A 371 Alcohol dehydrogenase, iron-containing; TM0920, st 93.67
3ce9_A 354 Glycerol dehydrogenase; NP_348253.1, 3-dehydroquin 93.51
3okf_A 390 3-dehydroquinate synthase; structural genomics, ce 93.31
3ox4_A 383 Alcohol dehydrogenase 2; iron, NAD, oxidoreductase 92.87
1rrm_A 386 Lactaldehyde reductase; structural genomics, dehyd 92.47
1vlj_A 407 NADH-dependent butanol dehydrogenase; TM0820, stru 92.21
1ta9_A 450 Glycerol dehydrogenase; oxidoredu; 1.90A {Schizosa 92.07
1sg6_A 393 Pentafunctional AROM polypeptide; shikimate pathwa 91.87
3h5o_A 339 Transcriptional regulator GNTR; transcription regu 91.71
3dbi_A 338 Sugar-binding transcriptional regulator, LACI FAM; 91.59
3jvd_A 333 Transcriptional regulators; structural genomics, P 89.74
3e3m_A 355 Transcriptional regulator, LACI family; structural 89.7
1oj7_A 408 Hypothetical oxidoreductase YQHD; structural genom 89.53
3l49_A 291 ABC sugar (ribose) transporter, periplasmic substr 88.97
2gru_A 368 2-deoxy-scyllo-inosose synthase; aminoglycoside, 2 88.93
3lft_A 295 Uncharacterized protein; ABC, ATPase, cassette, L- 88.72
3ctp_A 330 Periplasmic binding protein/LACI transcriptional; 88.7
3hl0_A 353 Maleylacetate reductase; structur genomics, PSI-2, 88.68
2o20_A 332 Catabolite control protein A; CCPA, transcriptiona 88.65
3s99_A 356 Basic membrane lipoprotein; ssgcid, structural gen 88.44
3egc_A 291 Putative ribose operon repressor; structural genom 88.29
2fn9_A 290 Ribose ABC transporter, periplasmic ribose-bindin; 88.16
2iks_A 293 DNA-binding transcriptional dual regulator; escher 87.59
3hs3_A 277 Ribose operon repressor; PSI-II, NYSGXRC, periplas 87.46
3bil_A 348 Probable LACI-family transcriptional regulator; st 86.96
3jzd_A 358 Iron-containing alcohol dehydrogenase; YP_298327.1 86.72
3qbe_A 368 3-dehydroquinate synthase; shikimate pathway, myco 86.66
3kke_A 303 LACI family transcriptional regulator; structural 86.56
3miz_A 301 Putative transcriptional regulator protein, LACI f 86.5
3kjx_A 344 Transcriptional regulator, LACI family; LACL famil 86.49
1xah_A 354 Sadhqs, 3-dehydroquinate synthase; shikimate pathw 86.36
3l6u_A 293 ABC-type sugar transport system periplasmic compo; 85.96
3o1i_D 304 Periplasmic protein TORT; ligand free, two compone 85.3
3msz_A89 Glutaredoxin 1; alpha-beta sandwich, center for st 85.1
3brq_A 296 HTH-type transcriptional regulator ASCG; transcrip 85.03
4fn4_A 254 Short chain dehydrogenase; NADH-binding, rossmann 84.39
1byk_A 255 Protein (trehalose operon repressor); LACI family, 84.35
1jye_A 349 Lactose operon repressor; gene regulation, protein 84.03
3m9w_A 313 D-xylose-binding periplasmic protein; xylose bindi 83.92
2hqb_A 296 Transcriptional activator of COMK gene; berkeley s 83.39
3dlo_A155 Universal stress protein; unknown function, struct 83.37
1dbq_A 289 Purine repressor; transcription regulation, DNA-bi 83.2
3jy6_A 276 Transcriptional regulator, LACI family; NYSGXRC, P 82.81
3zyw_A111 Glutaredoxin-3; metal binding protein; 1.84A {Homo 82.64
3c3k_A 285 Alanine racemase; structural genomics, protein str 82.46
3o74_A 272 Fructose transport system repressor FRUR; dual tra 82.21
1ujn_A 348 Dehydroquinate synthase; riken structu genomics/pr 81.87
3ipz_A109 Monothiol glutaredoxin-S14, chloroplastic; electro 81.58
1tjy_A 316 Sugar transport protein; protein-ligand complex, s 81.5
3huu_A 305 Transcription regulator like protein; PSI-II, NYSG 81.43
3h75_A 350 Periplasmic sugar-binding domain protein; protein 81.43
2vzf_A 197 NADH-dependent FMN reductase; oxidoreductase; 2.50 81.05
2b99_A156 Riboflavin synthase; lumazine riboflavin, transfer 81.03
1aba_A87 Glutaredoxin; electron transport; HET: MES; 1.45A 80.8
2dri_A 271 D-ribose-binding protein; sugar transport; HET: RI 80.77
1nvm_A 345 HOA, 4-hydroxy-2-oxovalerate aldolase; sequestered 80.74
2fvy_A 309 D-galactose-binding periplasmic protein; periplasm 80.69
1x60_A79 Sporulation-specific N-acetylmuramoyl-L-alanine am 80.5
3ksm_A 276 ABC-type sugar transport system, periplasmic COMP; 80.24
2qh8_A 302 Uncharacterized protein; conserved domain protein, 80.2
3gyb_A 280 Transcriptional regulators (LACI-family transcript 80.2
>4b4k_A N5-carboxyaminoimidazole ribonucleotide mutase; isomerase; 2.50A {Bacillus anthracis} Back     alignment and structure
Probab=99.96  E-value=2.5e-30  Score=214.05  Aligned_cols=77  Identities=42%  Similarity=0.678  Sum_probs=72.8

Q ss_pred             CCCCCeEEEEeccCCCHHHHHHHHHHHHHhCCCeeEEEEcCCCCchHHHHHHHHHhhCCCeEEEEecCccCcCcCCC
Q 029926          109 STDTPIVGIIMESDSDLPVMNDAARTLSDFGVPYEIKILSPHQNRKGALSYALSAKERGIKIIIVGDGVEAHLSGTL  185 (185)
Q Consensus       109 ~~~~~kVaIIMGS~SDl~vmekA~~vLeefGIpyEvrVaSAHRtPe~l~ey~k~ae~~GikVIIAvAG~AAhLPGVV  185 (185)
                      ..|+|.|+|||||+|||++|++|.++|++|||+||++|+||||+|+++.+|+++++++|++||||+||++|||||||
T Consensus        19 ~~mkp~V~IimGS~SD~~v~~~a~~~L~~~gI~~e~~V~SAHRtp~~l~~~~~~a~~~g~~ViIa~AG~aahLpGvv   95 (181)
T 4b4k_A           19 SHMKSLVGVIMGSTSDWETMKYACDILDELNIPYEKKVVSAHRTPDYMFEYAETARERGLKVIIAGAGGAAHLPGMV   95 (181)
T ss_dssp             ---CCSEEEEESSGGGHHHHHHHHHHHHHTTCCEEEEECCTTTSHHHHHHHHHHTTTTTCCEEEEEECSSCCHHHHH
T ss_pred             CCCCccEEEEECCHhHHHHHHHHHHHHHHcCCCeeEEEEccccChHHHHHHHHHHHhcCceEEEEeccccccchhhH
Confidence            56789999999999999999999999999999999999999999999999999999999999999999999999985
>4grd_A N5-CAIR mutase, phosphoribosylaminoimidazole carboxylase catalyti; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures; 1.85A {Burkholderia cenocepacia} Back     alignment and structure
>1xmp_A PURE, phosphoribosylaminoimidazole carboxylase; purine biosynthesis, spine, lyase; 1.80A {Bacillus anthracis} SCOP: c.23.8.1 Back     alignment and structure
>3rg8_A Phosphoribosylaminoimidazole carboxylase, PURE PR; purine biosynthesis, lyase; 1.74A {Treponema denticola} SCOP: c.23.8.0 PDB: 3rgg_A* Back     alignment and structure
>3oow_A Phosphoribosylaminoimidazole carboxylase,catalyic; structural genomics, center for structural genomics of infec diseases, csgid; HET: MSE; 1.75A {Francisella tularensis subsp} SCOP: c.23.8.1 PDB: 3opq_A* Back     alignment and structure
>3kuu_A Phosphoribosylaminoimidazole carboxylase catalyti PURE; 3-layer (ABA) sandwich, rossmann fold, csgid, lyase, structu genomics; 1.41A {Yersinia pestis} SCOP: c.23.8.1 PDB: 1d7a_A* 1qcz_A 2ate_A* 2nsl_A* 2nsh_A* 2nsj_A* Back     alignment and structure
>3trh_A Phosphoribosylaminoimidazole carboxylase carboxyltransferase subunit; purines, pyrimidines, nucleosides, nucleotides, lyase; 2.20A {Coxiella burnetii} Back     alignment and structure
>3ors_A N5-carboxyaminoimidazole ribonucleotide mutase; isomerase, isomerase,biosynthetic protein; 1.45A {Staphylococcus aureus subsp} Back     alignment and structure
>3lp6_A Phosphoribosylaminoimidazole carboxylase catalyti; alpha and beta protein, structural genomics, PSI-2, protein initiative; 1.70A {Mycobacterium tuberculosis} SCOP: c.23.8.0 Back     alignment and structure
>1u11_A PURE (N5-carboxyaminoimidazole ribonucleotide MUT; acidophIle, protein stability, lyase; HET: CIT; 1.55A {Acetobacter aceti} SCOP: c.23.8.1 PDB: 2fwj_A* 2fw1_A* 2fwb_A 2fwa_A 2fw9_A 2fw7_A 2fw6_A 2fwp_A* 2fwi_A* 2fw8_A Back     alignment and structure
>1o4v_A Phosphoribosylaminoimidazole mutase PURE; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; 1.77A {Thermotoga maritima} SCOP: c.23.8.1 Back     alignment and structure
>2ywx_A Phosphoribosylaminoimidazole carboxylase catalyti; rossmann fold, structural genomics, NPPSFA; 2.31A {Methanocaldococcus jannaschii} Back     alignment and structure
>2h31_A Multifunctional protein ADE2; alpha-beta-alpha, ligase, lyase; 2.80A {Homo sapiens} Back     alignment and structure
>3uhj_A Probable glycerol dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.34A {Sinorhizobium meliloti} Back     alignment and structure
>1jq5_A Glycerol dehydrogenase; oxidoreductase, NAD, glycerol metabolism; HET: NAD; 1.70A {Geobacillus stearothermophilus} SCOP: e.22.1.2 PDB: 1jpu_A* 1jqa_A* Back     alignment and structure
>3bfj_A 1,3-propanediol oxidoreductase; opportunistic pathogens, decamer, structural genomics,struct proteomics in europe, spine; 2.70A {Klebsiella pneumoniae} Back     alignment and structure
>1o2d_A Alcohol dehydrogenase, iron-containing; TM0920, structural genomics, JCSG, PSI, protein structure initiative; HET: MSE NAP TRS; 1.30A {Thermotoga maritima} SCOP: e.22.1.2 PDB: 1vhd_A* Back     alignment and structure
>3ce9_A Glycerol dehydrogenase; NP_348253.1, 3-dehydroquinate syntha structural genomics, joint center for structural genomics; HET: MSE; 2.37A {Clostridium acetobutylicum atcc 824} Back     alignment and structure
>3okf_A 3-dehydroquinate synthase; structural genomics, center for structural genomics of infec diseases, csgid, NAD, lyase; HET: NAD; 2.50A {Vibrio cholerae o1 biovar eltor} Back     alignment and structure
>3ox4_A Alcohol dehydrogenase 2; iron, NAD, oxidoreductase; HET: NAD; 2.00A {Zymomonas mobilis} PDB: 3owo_A* Back     alignment and structure
>1rrm_A Lactaldehyde reductase; structural genomics, dehydrogenase, PSI, protein structure initiative; HET: APR; 1.60A {Escherichia coli} SCOP: e.22.1.2 PDB: 2bi4_A* 2bl4_A* Back     alignment and structure
>1vlj_A NADH-dependent butanol dehydrogenase; TM0820, structural G JCSG, protein structure initiative, PSI, joint center for S genomics; HET: NAP; 1.78A {Thermotoga maritima} SCOP: e.22.1.2 Back     alignment and structure
>1ta9_A Glycerol dehydrogenase; oxidoredu; 1.90A {Schizosaccharomyces pombe} Back     alignment and structure
>1sg6_A Pentafunctional AROM polypeptide; shikimate pathway, aromatic amino acid biosynthesis, DHQS, O form J, domain movement, cyclase, lyase; HET: NAD; 1.70A {Emericella nidulans} SCOP: e.22.1.1 PDB: 1nr5_A* 1nrx_A* 1nua_A 1nva_A* 1nvb_A* 1nvd_A* 1nve_A* 1nvf_A* 1dqs_A* Back     alignment and structure
>3h5o_A Transcriptional regulator GNTR; transcription regulator, GNTR,chromobacterium violaceum, PSI, SGX, DNA-binding; 2.30A {Chromobacterium violaceum} Back     alignment and structure
>3dbi_A Sugar-binding transcriptional regulator, LACI FAM; structural genomics, sugar-binding transcriptional regulator structure initiative, PSI-2; HET: MSE; 2.45A {Escherichia coli K12} Back     alignment and structure
>3jvd_A Transcriptional regulators; structural genomics, PSI-2, sugar binding protein, transcrip regulation, protein structure initiative; 2.30A {Corynebacterium glutamicum} Back     alignment and structure
>3e3m_A Transcriptional regulator, LACI family; structural genomics, DNA-binding, plasmid, transcription regulation, PSI-2; 1.60A {Silicibacter pomeroyi} Back     alignment and structure
>1oj7_A Hypothetical oxidoreductase YQHD; structural genomics; HET: NZQ; 2.0A {Escherichia coli} SCOP: e.22.1.2 Back     alignment and structure
>3l49_A ABC sugar (ribose) transporter, periplasmic substrate-binding subunit; sugar binding/transporter, structural genomics, PSI; HET: UNL; 2.30A {Rhodobacter sphaeroides} Back     alignment and structure
>2gru_A 2-deoxy-scyllo-inosose synthase; aminoglycoside, 2-deoxystreptamine, dehydroquinate synthase, lyase; HET: NAD EXO CAK; 2.15A {Bacillus circulans} PDB: 2d2x_A* Back     alignment and structure
>3lft_A Uncharacterized protein; ABC, ATPase, cassette, L-Trp, PSI, MCSG, structural genomics center for structural genomics; HET: MSE TRP; 1.35A {Streptococcus pneumoniae} Back     alignment and structure
>3ctp_A Periplasmic binding protein/LACI transcriptional; structural genomics, protein structure initiative; HET: XLF; 1.41A {Alkaliphilus metalliredigens} Back     alignment and structure
>3hl0_A Maleylacetate reductase; structur genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; HET: MSE NAD EPE; 1.60A {Agrobacterium tumefaciens str} Back     alignment and structure
>2o20_A Catabolite control protein A; CCPA, transcriptional regulator, helix-turn-helix, transcrip; 1.90A {Lactococcus lactis} Back     alignment and structure
>3s99_A Basic membrane lipoprotein; ssgcid, structural genomics, SEA structural genomics center for infectious disease, adenine; HET: ADE; 2.05A {Brucella melitensis biovar abortus} Back     alignment and structure
>3egc_A Putative ribose operon repressor; structural genomics, unknown function, DNA-binding, transcri transcription regulation, PSI-2; 2.35A {Burkholderia thailandensis} Back     alignment and structure
>2fn9_A Ribose ABC transporter, periplasmic ribose-bindin; RBP, ribose binding protein, periplasmic binding protein, thermophilic proteins; 1.40A {Thermotoga maritima} PDB: 2fn8_A* Back     alignment and structure
>2iks_A DNA-binding transcriptional dual regulator; escherichia coli structural genomics, PSI-2, protein structure initiative; 1.85A {Escherichia coli} Back     alignment and structure
>3hs3_A Ribose operon repressor; PSI-II, NYSGXRC, periplasmic binding protein, structural genomics, protein structure initiative; 1.60A {Lactobacillus acidophilus} Back     alignment and structure
>3bil_A Probable LACI-family transcriptional regulator; structural genomics, unknown function, PSI-2, protein structure initiative; 2.50A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3jzd_A Iron-containing alcohol dehydrogenase; YP_298327.1, putative alcohol dehedrogenase, structural GENO joint center for structural genomics; HET: MSE NAD PG4 P6G PGE; 2.10A {Ralstonia eutropha} Back     alignment and structure
>3qbe_A 3-dehydroquinate synthase; shikimate pathway, mycobacte tuberculosis, nicotinamide adenine dinucleotide (NAD)-depen enzyme; 2.07A {Mycobacterium tuberculosis} PDB: 3qbd_A Back     alignment and structure
>3kke_A LACI family transcriptional regulator; structural genomics, DNA-binding, transcription regulation, PSI-2; 2.20A {Mycobacterium smegmatis str} Back     alignment and structure
>3miz_A Putative transcriptional regulator protein, LACI family; LACL family, protein structure initiative II (PSI II), NYSGXRC, structural genomics; 1.91A {Rhizobium etli} Back     alignment and structure
>3kjx_A Transcriptional regulator, LACI family; LACL family, protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.33A {Silicibacter pomeroyi} Back     alignment and structure
>1xah_A Sadhqs, 3-dehydroquinate synthase; shikimate pathway, aromatic amino acid biosynthesis, open form, form B, domain movement, cyclase; HET: NAD; 2.20A {Staphylococcus aureus} PDB: 1xag_A* 1xai_A* 1xaj_A* 1xal_A* Back     alignment and structure
>3l6u_A ABC-type sugar transport system periplasmic compo; structural genomics, nysgrc, target 11006S, PSI-2, protein S initiative; 1.90A {Exiguobacterium sibiricum} Back     alignment and structure
>3o1i_D Periplasmic protein TORT; ligand free, two component sensor, periplasmic binding prote signaling protein; HET: PE4; 2.80A {Vibrio parahaemolyticus} PDB: 3o1h_B* 3o1j_C Back     alignment and structure
>3msz_A Glutaredoxin 1; alpha-beta sandwich, center for structural genomics of infec diseases, csgid, oxidoreductase; HET: GSH; 2.05A {Francisella tularensis subsp} PDB: 3lgc_A* Back     alignment and structure
>3brq_A HTH-type transcriptional regulator ASCG; transcriptional repressor structure escherichia coli, struct genomics, PSI-2; HET: FRU; 2.00A {Escherichia coli} Back     alignment and structure
>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Back     alignment and structure
>1byk_A Protein (trehalose operon repressor); LACI family, phosphate binding, protein structure, trehalose repressor, gene regulation; HET: T6P; 2.50A {Escherichia coli} SCOP: c.93.1.1 Back     alignment and structure
>1jye_A Lactose operon repressor; gene regulation, protein stability, protein DNA-binding, transcription; 1.70A {Escherichia coli} SCOP: c.93.1.1 PDB: 1lbi_A 1lbg_A* 1lbh_A 1jyf_A 3edc_A 1efa_A* 1jwl_A* 2pe5_A* 1tlf_A* 2p9h_A* 2paf_A* 1cjg_A* 1l1m_A 1osl_A 2kei_A* 2kej_A* 2kek_A* 2bjc_A 1lqc_A 1lcc_A* ... Back     alignment and structure
>3m9w_A D-xylose-binding periplasmic protein; xylose binding protein, conformational changes, SUGA protein; 2.15A {Escherichia coli} PDB: 3m9x_A* 3ma0_A* Back     alignment and structure
>2hqb_A Transcriptional activator of COMK gene; berkeley structure genomics center target 1957B, structural genomics, PSI; 2.70A {Bacillus halodurans} Back     alignment and structure
>3dlo_A Universal stress protein; unknown function, structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics; HET: MSE; 1.97A {Archaeoglobus fulgidus} PDB: 3qtb_A* Back     alignment and structure
>1dbq_A Purine repressor; transcription regulation, DNA-binding regulatory protein; 2.20A {Escherichia coli} SCOP: c.93.1.1 PDB: 1jhz_A Back     alignment and structure
>3jy6_A Transcriptional regulator, LACI family; NYSGXRC, PSI-II, protein S initiative, structural genomics; 1.97A {Lactobacillus brevis} Back     alignment and structure
>3zyw_A Glutaredoxin-3; metal binding protein; 1.84A {Homo sapiens} Back     alignment and structure
>3c3k_A Alanine racemase; structural genomics, protein structure initiative, NEW YORK research center for structural genomics, nysgxrc; 1.99A {Actinobacillus succinogenes} Back     alignment and structure
>3o74_A Fructose transport system repressor FRUR; dual transcriptional regulator, DNA, transcription; 2.00A {Pseudomonas putida} PDB: 3o75_A* Back     alignment and structure
>1ujn_A Dehydroquinate synthase; riken structu genomics/proteomics initiative, RSGI, structural genomics,; 1.80A {Thermus thermophilus} SCOP: e.22.1.1 Back     alignment and structure
>3ipz_A Monothiol glutaredoxin-S14, chloroplastic; electron transport, PL redox-active center, transit peptide, transport, oxidoreduc; 2.40A {Arabidopsis thaliana} PDB: 2lku_A Back     alignment and structure
>1tjy_A Sugar transport protein; protein-ligand complex, signaling protein; HET: PAV; 1.30A {Salmonella typhimurium} SCOP: c.93.1.1 PDB: 1tm2_A 3t95_A* 3ejw_A* Back     alignment and structure
>3huu_A Transcription regulator like protein; PSI-II, NYSGXRC, LAC I, STR genomics, protein structure initiative; 1.95A {Staphylococcus haemolyticus} Back     alignment and structure
>3h75_A Periplasmic sugar-binding domain protein; protein structure initiative II (PSI II), sugar binding PROT alpha/beta fold; 1.60A {Pseudomonas fluorescens pf-5} Back     alignment and structure
>2vzf_A NADH-dependent FMN reductase; oxidoreductase; 2.50A {Edta-degrading bacterium BNC1} PDB: 2vzh_A* 2vzj_A* Back     alignment and structure
>2b99_A Riboflavin synthase; lumazine riboflavin, transferase; HET: RDL; 2.22A {Methanocaldococcus jannaschii} PDB: 2b98_A* Back     alignment and structure
>1aba_A Glutaredoxin; electron transport; HET: MES; 1.45A {Enterobacteria phage T4} SCOP: c.47.1.1 PDB: 1aaz_A 1de1_A 1de2_A Back     alignment and structure
>2dri_A D-ribose-binding protein; sugar transport; HET: RIP; 1.60A {Escherichia coli} SCOP: c.93.1.1 PDB: 1urp_A* 1ba2_A 1dbp_A* 1drj_A* 1drk_A* 2gx6_A* Back     alignment and structure
>1nvm_A HOA, 4-hydroxy-2-oxovalerate aldolase; sequestered tunnel, substrate channeling; HET: NAD; 1.70A {Pseudomonas SP} SCOP: a.5.7.1 c.1.10.5 Back     alignment and structure
>2fvy_A D-galactose-binding periplasmic protein; periplasmic binding protien, hinge, chemotaxis, transport,; HET: BGC; 0.92A {Escherichia coli} SCOP: c.93.1.1 PDB: 1glg_A* 2fw0_A* 2gbp_A* 2qw1_A* 2hph_A* 2ipn_A* 2ipm_A* 2ipl_A* 1gca_A* 1gcg_A 3ga5_A* 3gbp_A* Back     alignment and structure
>1x60_A Sporulation-specific N-acetylmuramoyl-L-alanine amidase; CWLC, CWLCR, peptidoglycan, cell WALL lytic amidase, tandem repeats, hydrolase; NMR {Bacillus subtilis} Back     alignment and structure
>3ksm_A ABC-type sugar transport system, periplasmic COMP; periplasmic component, PSI- 11023L, structural genomics, protein structure initiative; HET: BDR; 1.90A {Hahella chejuensis} Back     alignment and structure
>3gyb_A Transcriptional regulators (LACI-family transcriptional regulatory protein); protein structure initiative II(PSI II), nysgxrc; 1.60A {Corynebacterium glutamicum} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 185
d1qcza_163 c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoi 1e-18
d1o4va_169 c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoi 2e-18
d1xmpa_155 c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoi 4e-18
d1u11a_159 c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoi 1e-16
>d1qcza_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Escherichia coli [TaxId: 562]} Length = 163 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Flavodoxin-like
superfamily: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE)
family: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE)
domain: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE)
species: Escherichia coli [TaxId: 562]

 Score = 76.5 bits (188), Expect = 1e-18
 Identities = 27/73 (36%), Positives = 39/73 (53%)

Query: 113 PIVGIIMESDSDLPVMNDAARTLSDFGVPYEIKILSPHQNRKGALSYALSAKERGIKIII 172
             V I+M S SD   M  AA       VP+ ++++S H+      S+A SA+E G ++II
Sbjct: 2   ARVAIVMGSKSDWATMQFAAEIFEILNVPHHVEVVSAHRTPDKLFSFAESAEENGYQVII 61

Query: 173 VGDGVEAHLSGTL 185
            G G  AHL G +
Sbjct: 62  AGAGGAAHLPGMI 74
>d1o4va_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Thermotoga maritima [TaxId: 2336]} Length = 169 Back     information, alignment and structure
>d1xmpa_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Bacillus anthracis [TaxId: 1392]} Length = 155 Back     information, alignment and structure
>d1u11a_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Acetobacter aceti [TaxId: 435]} Length = 159 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query185
d1qcza_163 N5-CAIR mutase (phosphoribosylaminoimidazole carbo 99.95
d1u11a_159 N5-CAIR mutase (phosphoribosylaminoimidazole carbo 99.95
d1xmpa_155 N5-CAIR mutase (phosphoribosylaminoimidazole carbo 99.94
d1o4va_169 N5-CAIR mutase (phosphoribosylaminoimidazole carbo 99.93
d1jq5a_ 366 Glycerol dehydrogenase {Bacillus stearothermophilu 95.28
d1o2da_ 359 Alcohol dehydrogenase TM0920 {Thermotoga maritima 94.47
d2dria_ 271 D-ribose-binding protein {Escherichia coli, strain 93.88
d1vlja_ 398 NADH-dependent butanol dehydrogenase A (TM0820) {T 93.21
d2bona1 295 Lipid kinase YegS {Escherichia coli [TaxId: 562]} 92.73
d1rrma_ 385 Lactaldehyde reductase FucO {Escherichia coli [Tax 92.49
d1byka_ 255 Trehalose repressor, C-terminal domain {Escherichi 91.46
d1aisa192 TATA-box binding protein (TBP), C-terminal domain 90.42
d2qv7a1 312 Diacylglycerol kinase DgkB {Staphylococcus aureus 90.23
d1tjya_ 316 AI-2 receptor LsrB {Salmonella typhi [TaxId: 90370 90.07
d1guda_ 288 D-allose-binding protein {Escherichia coli [TaxId: 89.29
d1mp9a192 TATA-box binding protein (TBP), C-terminal domain 88.89
d1utaa_77 Cell division protein FtsN {Escherichia coli [TaxI 87.02
d1qnaa199 TATA-box binding protein (TBP), C-terminal domain 86.91
d2bd0a1 240 Bacterial sepiapterin reductase {Chlorobium tepidu 86.79
d1dbqa_ 282 Purine repressor (PurR), C-terminal domain {Escher 86.03
d2rhca1 257 beta-keto acyl carrier protein reductase {Streptom 85.93
d2nzug1 275 Glucose-resistance amylase regulator CcpA, C-termi 84.83
d1g94a2 354 Bacterial alpha-amylase {Pseudoalteromonas halopla 84.7
d2pjua1186 Propionate catabolism operon regulatory protein Pr 84.23
d1fmca_ 255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 84.22
d1oaaa_ 259 Sepiapterin reductase {Mouse (Mus musculus) [TaxId 83.51
d1zema1 260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 83.43
d1xq1a_ 259 Tropinone reductase {Thale cress (Arabidopsis thal 82.45
d1gega_ 255 meso-2,3-butanediol dehydrogenase {Klebsiella pneu 82.07
d1oj7a_ 390 Hypothetical oxidoreductase yqhD {Escherichia coli 81.89
d1jx6a_ 338 Quorum-sensing signal (autoinducer-2) binding prot 81.72
d2c07a1 251 beta-keto acyl carrier protein reductase {Malaria 81.64
d1gpua3146 Transketolase (TK), C-domain {Baker's yeast (Sacch 81.39
d1g0oa_ 272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 80.92
d1iowa196 D-Ala-D-Ala ligase, N-domain {Escherichia coli, ge 80.63
d1yb1a_ 244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 80.31
>d1qcza_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Flavodoxin-like
superfamily: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE)
family: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE)
domain: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE)
species: Escherichia coli [TaxId: 562]

Probab=99.95  E-value=8.5e-29  Score=199.31  Aligned_cols=73  Identities=37%  Similarity=0.558  Sum_probs=71.3

Q ss_pred             CeEEEEeccCCCHHHHHHHHHHHHHhCCCeeEEEEcCCCCchHHHHHHHHHhhCCCeEEEEecCccCcCcCCC
Q 029926          113 PIVGIIMESDSDLPVMNDAARTLSDFGVPYEIKILSPHQNRKGALSYALSAKERGIKIIIVGDGVEAHLSGTL  185 (185)
Q Consensus       113 ~kVaIIMGS~SDl~vmekA~~vLeefGIpyEvrVaSAHRtPe~l~ey~k~ae~~GikVIIAvAG~AAhLPGVV  185 (185)
                      ++|+|||||+||+++|+++.++|++|||+||++|+||||+|+++.+|+++++++|++||||+||+||||||+|
T Consensus         2 aKV~IImGS~SD~~~~~~a~~~L~~~gI~~e~~v~SAHRtp~~l~~~~~~~~~~~~~ViIa~AG~aa~Lpgvv   74 (163)
T d1qcza_           2 ARVAIVMGSKSDWATMQFAAEIFEILNVPHHVEVVSAHRTPDKLFSFAESAEENGYQVIIAGAGGAAHLPGMI   74 (163)
T ss_dssp             CCEEEEESSGGGHHHHHHHHHHHHHHTCCEEEEECCTTTCHHHHHHHHHHTTTTTCSEEEEEECSSCCHHHHH
T ss_pred             CeEEEEECcHhhHHHHHHHHHHHHHcCCCeEEEEeccccCHHHHHHHHHHHHHcCCeEEEEeccCCCcccchh
Confidence            5799999999999999999999999999999999999999999999999999999999999999999999985
>d1u11a_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Acetobacter aceti [TaxId: 435]} Back     information, alignment and structure
>d1xmpa_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Bacillus anthracis [TaxId: 1392]} Back     information, alignment and structure
>d1o4va_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1jq5a_ e.22.1.2 (A:) Glycerol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1o2da_ e.22.1.2 (A:) Alcohol dehydrogenase TM0920 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2dria_ c.93.1.1 (A:) D-ribose-binding protein {Escherichia coli, strain k-12 [TaxId: 562]} Back     information, alignment and structure
>d1vlja_ e.22.1.2 (A:) NADH-dependent butanol dehydrogenase A (TM0820) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2bona1 e.52.1.2 (A:5-299) Lipid kinase YegS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rrma_ e.22.1.2 (A:) Lactaldehyde reductase FucO {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1byka_ c.93.1.1 (A:) Trehalose repressor, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1aisa1 d.129.1.1 (A:1-92) TATA-box binding protein (TBP), C-terminal domain {Archaeon Pyrococcus woesei [TaxId: 2262]} Back     information, alignment and structure
>d2qv7a1 e.52.1.2 (A:1-312) Diacylglycerol kinase DgkB {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1tjya_ c.93.1.1 (A:) AI-2 receptor LsrB {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
>d1guda_ c.93.1.1 (A:) D-allose-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mp9a1 d.129.1.1 (A:5-96) TATA-box binding protein (TBP), C-terminal domain {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1utaa_ d.58.52.1 (A:) Cell division protein FtsN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qnaa1 d.129.1.1 (A:17-115) TATA-box binding protein (TBP), C-terminal domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1dbqa_ c.93.1.1 (A:) Purine repressor (PurR), C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d2nzug1 c.93.1.1 (G:58-332) Glucose-resistance amylase regulator CcpA, C-terminal domain {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1g94a2 c.1.8.1 (A:1-354) Bacterial alpha-amylase {Pseudoalteromonas haloplanktis (Alteromonas haloplanktis) [TaxId: 228]} Back     information, alignment and structure
>d2pjua1 c.92.3.1 (A:11-196) Propionate catabolism operon regulatory protein PrpR {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1oj7a_ e.22.1.2 (A:) Hypothetical oxidoreductase yqhD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jx6a_ c.93.1.1 (A:) Quorum-sensing signal (autoinducer-2) binding protein LuxP {Vibrio harveyi [TaxId: 669]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1gpua3 c.48.1.1 (A:535-680) Transketolase (TK), C-domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1iowa1 c.30.1.2 (A:1-96) D-Ala-D-Ala ligase, N-domain {Escherichia coli, gene ddlB [TaxId: 562]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure