Citrus Sinensis ID: 030029

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180----
MAATEENSQLFPIFILTIMALPLVPYTILKLCHAFSKKIKTIHCQCSDCARSGKYRKSIFKRISNFSTCSNLSLVLLWVIMIILIYYIKSTSREMQVFEPFSILGLEHGASDSDIKKAYRRLSIQYHPDKNPDPEANKYFVEYISKAYQALTDPISRENFEKYGHPDGRQAMDFKWALLSLSSC
ccccccccccHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHccHHHccccccccccccccccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHccccccccccccEEccccccc
ccccccccccHHHHHHHHHHHHHcccHEEEccccccHHHHcccccccccHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHccccHHEccccccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHccccccccccEEEEccccccc
maateensqlfpIFILTIMALPLVPYTILKLCHAFSKKIKtihcqcsdcarsgkyRKSIFKRISNFSTCSNLSLVLLWVIMIILIYYIKstsremqvfepfsilglehgasdsdIKKAYRRLSIqyhpdknpdpeaNKYFVEYISKAYQALtdpisrenfekyghpdgrqAMDFKWALLSLSSC
maateensqlfPIFILTIMALPLVPYTILKLCHAFSKKIKTIHCQCSDCARSGKYRKSIFKRISNFSTCSNLSLVLLWVIMIILIYYIKSTSREMQVFEPFSILGLEHGASDSDIKKAYRRLSIqyhpdknpdpeANKYFVEYISKAYQALTDPISRENFEKYGHPDGRQAMDFKWALLSLSSC
MAATEENSQLFPIFILTIMALPLVPYTILKLCHAFSKKIKTIHCQCSDCARSGKYRKSIFKRISNFSTCSNlslvllwvimiiliyyiKSTSREMQVFEPFSILGLEHGASDSDIKKAYRRLSIQYHPDKNPDPEANKYFVEYISKAYQALTDPISRENFEKYGHPDGRQAMDFKWALLSLSSC
*********LFPIFILTIMALPLVPYTILKLCHAFSKKIKTIHCQCSDCARSGKYRKSIFKRISNFSTCSNLSLVLLWVIMIILIYYIKSTSREMQVFEPFSILGLEHGA****IKKAYRRLSIQ***********NKYFVEYISKAYQALTDPISRENFEKY*******AMDFKWALL*****
*AATEENSQLFPIFILTIMALPLVPYTILKLCH*********************************STCSNLSLVLLWVIMIILIYYIKSTSREMQVFEPFSILGLEHGASDSDIKKAYRRLSIQYHPDKNPDPEANKYFVEYISKAYQALTDPISRENFEKYGHPDGRQAMDFKWALLSLSS*
MAATEENSQLFPIFILTIMALPLVPYTILKLCHAFSKKIKTIHCQCSDCARSGKYRKSIFKRISNFSTCSNLSLVLLWVIMIILIYYIKSTSREMQVFEPFSILGLEHGASDSDIKKAYRRLSIQYHPDKNPDPEANKYFVEYISKAYQALTDPISRENFEKYGHPDGRQAMDFKWALLSLSSC
*******SQLFPIFILTIMALPLVPYTILKLCHAFSKKIKTIHCQCSDCARSGKYRKSIFKRISNFSTCSNLSLVLLWVIMIILIYYIKSTSREMQVFEPFSILGLEHGASDSDIKKAYRRLSIQYHPDKNPDPEANKYFVEYISKAYQALTDPISRENFEKYGHPDGRQAMDFKWALLSLSSC
oooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAATEENSQLFPIFILTIMALPLVPYTILKLCHAFSKKIKTIHCQCSDCARSGKYRKSIFKRISNFSTCSNLSLVLLWVIMIILIYYIKSTSREMQVFEPFSILGLEHGASDSDIKKAYRRLSIQYHPDKNPDPEANKYFVEYISKAYQALTDPISRENFEKYGHPDGRQAMDFKWALLSLSSC
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query184 2.2.26 [Sep-21-2011]
P14906 663 Protein translocation pro yes no 0.918 0.254 0.302 8e-22
Q8VHE0 760 Translocation protein SEC yes no 0.907 0.219 0.342 2e-20
Q5R660 761 Translocation protein SEC yes no 0.717 0.173 0.384 4e-20
Q9UGP8 760 Translocation protein SEC yes no 0.717 0.173 0.384 5e-20
Q9HGN7 611 Translocation protein sec yes no 0.902 0.271 0.333 2e-17
Q5FVM7 771 DnaJ homolog subfamily C no no 0.516 0.123 0.397 2e-14
Q80TN4 772 DnaJ homolog subfamily C no no 0.494 0.117 0.393 5e-14
Q5RCM7 782 DnaJ homolog subfamily C no no 0.478 0.112 0.406 8e-14
Q9Y2G8 782 DnaJ homolog subfamily C no no 0.478 0.112 0.406 1e-13
Q74H58 373 Chaperone protein DnaJ OS yes no 0.347 0.171 0.515 2e-13
>sp|P14906|SEC63_YEAST Protein translocation protein SEC63 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC63 PE=1 SV=2 Back     alignment and function desciption
 Score =  103 bits (256), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 63/208 (30%), Positives = 111/208 (53%), Gaps = 39/208 (18%)

Query: 5   EENSQLFPIFILTIMALPLVPYTILKLCHAFSKKIKTIHCQCSDCARSGKYRKSIFKRIS 64
           +E S+ +P FILT + + + P T+L++   F       + +  +  +S ++ + +FK ++
Sbjct: 8   DEASETWPSFILTGLLMVVGPMTLLQIYQIFFGA----NAEDGNSGKSKEFNEEVFKNLN 63

Query: 65  NFSTCS-----------------------NLSLVLLWVIMIILIYYIKSTSR----EMQV 97
              T                         N+ +++ W+++ IL+  I S         ++
Sbjct: 64  EEYTSDEIKQFRRKFDKNSNKKSKIWSRRNIIIIVGWILVAILLQRINSNDAIKDAATKL 123

Query: 98  FEPFSILGLEHGASDSDIKKAYRRLSIQYHPDK-----NPDPEA--NKYFVEYISKAYQA 150
           F+P+ ILG+   ASD DIK AYR+LS+++HPDK      PD ++   + +V+ I+KAY++
Sbjct: 124 FDPYEILGISTSASDRDIKSAYRKLSVKFHPDKLAKGLTPDEKSVMEETYVQ-ITKAYES 182

Query: 151 LTDPISRENFEKYGHPDGRQAMDFKWAL 178
           LTD + R+N+ KYGHPDG Q+     AL
Sbjct: 183 LTDELVRQNYLKYGHPDGPQSTSHGIAL 210
Acts as component of the Sec62/63 complex which is involved in SRP-independent post-translational translocation across the endoplasmic reticulum (ER) and functions together with the Sec61 complex and KAR2 in a channel-forming translocon complex. A cycle of assembly and disassembly of Sec62/63 complex from SEC61 may govern the activity of the translocon. SEC63 may affect SEC1-polypeptide interactions by increasing the affinity of targeting pathways for SEC61 and/or by modifying SEC61 to allow more efficient polypeptide interaction. May also be involved in SRP-dependent cotranslational translocation. Is essential for cell growth and for germination.
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (taxid: 559292)
>sp|Q8VHE0|SEC63_MOUSE Translocation protein SEC63 homolog OS=Mus musculus GN=Sec63 PE=1 SV=4 Back     alignment and function description
>sp|Q5R660|SEC63_PONAB Translocation protein SEC63 homolog OS=Pongo abelii GN=SEC63 PE=2 SV=1 Back     alignment and function description
>sp|Q9UGP8|SEC63_HUMAN Translocation protein SEC63 homolog OS=Homo sapiens GN=SEC63 PE=1 SV=2 Back     alignment and function description
>sp|Q9HGN7|SEC63_SCHPO Translocation protein sec63 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sec63 PE=1 SV=1 Back     alignment and function description
>sp|Q5FVM7|DJC16_RAT DnaJ homolog subfamily C member 16 OS=Rattus norvegicus GN=Dnajc16 PE=2 SV=1 Back     alignment and function description
>sp|Q80TN4|DJC16_MOUSE DnaJ homolog subfamily C member 16 OS=Mus musculus GN=Dnajc16 PE=1 SV=2 Back     alignment and function description
>sp|Q5RCM7|DJC16_PONAB DnaJ homolog subfamily C member 16 OS=Pongo abelii GN=DNAJC16 PE=2 SV=1 Back     alignment and function description
>sp|Q9Y2G8|DJC16_HUMAN DnaJ homolog subfamily C member 16 OS=Homo sapiens GN=DNAJC16 PE=2 SV=3 Back     alignment and function description
>sp|Q74H58|DNAJ_GEOSL Chaperone protein DnaJ OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=dnaJ PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query184
225464625 688 PREDICTED: translocation protein SEC63 h 0.967 0.258 0.837 5e-87
302143768 618 unnamed protein product [Vitis vinifera] 0.967 0.288 0.837 7e-87
413918040 345 hypothetical protein ZEAMMB73_611252 [Ze 0.967 0.515 0.792 2e-82
449445973 685 PREDICTED: translocation protein SEC63 h 0.967 0.259 0.803 4e-82
224079782 685 predicted protein [Populus trichocarpa] 0.967 0.259 0.792 1e-81
449533991242 PREDICTED: translocation protein SEC63 h 0.967 0.735 0.803 2e-81
255545152 682 heat shock protein binding protein, puta 0.967 0.260 0.792 3e-81
125547707 681 hypothetical protein OsI_15323 [Oryza sa 0.967 0.261 0.780 5e-81
115457642 681 Os04g0307200 [Oryza sativa Japonica Grou 0.967 0.261 0.780 5e-81
297842873 681 heat shock protein binding protein [Arab 0.967 0.261 0.786 5e-81
>gi|225464625|ref|XP_002275958.1| PREDICTED: translocation protein SEC63 homolog [Vitis vinifera] Back     alignment and taxonomy information
 Score =  325 bits (833), Expect = 5e-87,   Method: Compositional matrix adjust.
 Identities = 149/178 (83%), Positives = 165/178 (92%)

Query: 1   MAATEENSQLFPIFILTIMALPLVPYTILKLCHAFSKKIKTIHCQCSDCARSGKYRKSIF 60
           MAA+EENS LFPIFILTIMALPLVPYTI+KLCHA S+K K+IHCQCS+C RSGKYR+SIF
Sbjct: 1   MAASEENSALFPIFILTIMALPLVPYTIMKLCHAASRKTKSIHCQCSECTRSGKYRRSIF 60

Query: 61  KRISNFSTCSNLSLVLLWVIMIILIYYIKSTSREMQVFEPFSILGLEHGASDSDIKKAYR 120
           KRISNFSTCSNL+LVLLWV+MIIL+YYIK  S+E+Q+FEPFSILGLE GASDS+IKKAYR
Sbjct: 61  KRISNFSTCSNLTLVLLWVVMIILVYYIKHISQEIQIFEPFSILGLESGASDSEIKKAYR 120

Query: 121 RLSIQYHPDKNPDPEANKYFVEYISKAYQALTDPISRENFEKYGHPDGRQAMDFKWAL 178
           RLSIQYHPDKNPDPEA+KYFVE+ISKAYQALTDPISREN+EKYGHPDGRQ      AL
Sbjct: 121 RLSIQYHPDKNPDPEAHKYFVEFISKAYQALTDPISRENYEKYGHPDGRQGFQMGIAL 178

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|302143768|emb|CBI22629.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|413918040|gb|AFW57972.1| hypothetical protein ZEAMMB73_611252 [Zea mays] Back     alignment and taxonomy information
>gi|449445973|ref|XP_004140746.1| PREDICTED: translocation protein SEC63 homolog [Cucumis sativus] Back     alignment and taxonomy information
>gi|224079782|ref|XP_002305942.1| predicted protein [Populus trichocarpa] gi|118481069|gb|ABK92488.1| unknown [Populus trichocarpa] gi|222848906|gb|EEE86453.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449533991|ref|XP_004173953.1| PREDICTED: translocation protein SEC63 homolog, partial [Cucumis sativus] Back     alignment and taxonomy information
>gi|255545152|ref|XP_002513637.1| heat shock protein binding protein, putative [Ricinus communis] gi|223547545|gb|EEF49040.1| heat shock protein binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|125547707|gb|EAY93529.1| hypothetical protein OsI_15323 [Oryza sativa Indica Group] Back     alignment and taxonomy information
>gi|115457642|ref|NP_001052421.1| Os04g0307200 [Oryza sativa Japonica Group] gi|32483270|emb|CAE02397.1| OSJNBa0024J22.1 [Oryza sativa Japonica Group] gi|38347199|emb|CAD40524.2| OSJNBa0023J03.11 [Oryza sativa Japonica Group] gi|113563992|dbj|BAF14335.1| Os04g0307200 [Oryza sativa Japonica Group] gi|116308927|emb|CAH66056.1| OSIGBa0125J07.5 [Oryza sativa Indica Group] gi|125589813|gb|EAZ30163.1| hypothetical protein OsJ_14220 [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|297842873|ref|XP_002889318.1| heat shock protein binding protein [Arabidopsis lyrata subsp. lyrata] gi|297335159|gb|EFH65577.1| heat shock protein binding protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query184
TAIR|locus:2016354 687 ATERDJ2A [Arabidopsis thaliana 0.967 0.259 0.707 6e-64
TAIR|locus:2127373 661 ATERDJ2B [Arabidopsis thaliana 0.967 0.269 0.685 7.9e-62
GENEDB_PFALCIPARUM|PF13_0102 651 PF13_0102 "DNAJ-like Sec63 hom 0.413 0.116 0.589 1.5e-19
UNIPROTKB|Q8IEC8 651 PF13_0102 "DnaJ/SEC63 protein, 0.413 0.116 0.589 1.5e-19
FB|FBgn0035771 753 sec63 "sec63" [Drosophila mela 0.913 0.223 0.360 1.7e-19
SGD|S000005780 663 SEC63 "Essential subunit of Se 0.445 0.123 0.466 1.9e-19
DICTYBASE|DDB_G0286131 814 sec63 "protein transport prote 0.951 0.214 0.335 3.1e-19
UNIPROTKB|E1C0C3 759 SEC63 "Uncharacterized protein 0.907 0.220 0.348 6.3e-17
UNIPROTKB|A6PVC9161 SEC63 "Translocation protein S 0.456 0.521 0.511 8.6e-17
CGD|CAL0005862 673 orf19.491 [Candida albicans (t 0.402 0.109 0.475 9.3e-17
TAIR|locus:2016354 ATERDJ2A [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 652 (234.6 bits), Expect = 6.0e-64, P = 6.0e-64
 Identities = 126/178 (70%), Positives = 142/178 (79%)

Query:     1 MAATEENSQLFPIFILTIMALPLVPYTILKLCHAFSKKIKTIHCQCSDCARSGKYRKSIF 60
             MAA+EENS LFPIFILTIMA+PLVPYT++KL  A SKK +TIHCQC +C RSGKY++S+F
Sbjct:     1 MAASEENSALFPIFILTIMAIPLVPYTMVKLSGALSKKQRTIHCQCLECDRSGKYKRSLF 60

Query:    61 KRISNFSTCSNXXXXXXXXXXXXXXXXXKSTSREMQVFEPFSILGLEHGASDSDIKKAYR 120
             K+ISNFST SN                 K+ SRE QVF+PFSILGLE G +DS+IKKAYR
Sbjct:    61 KKISNFSTWSNLTLVLLWVVMIFLIYYTKNMSREAQVFDPFSILGLEPGVTDSEIKKAYR 120

Query:   121 RLSIQYHPDKNPDPEANKYFVEYISKAYQALTDPISRENFEKYGHPDGRQAMDFKWAL 178
             RLSIQYHPDKNPDPEANKYFVE+ISKAYQALTD +SRENFEKYGHPDGRQ      AL
Sbjct:   121 RLSIQYHPDKNPDPEANKYFVEFISKAYQALTDSVSRENFEKYGHPDGRQGFQMGIAL 178
GO:0006457 "protein folding" evidence=IEA;ISS
GO:0009507 "chloroplast" evidence=ISM
GO:0031072 "heat shock protein binding" evidence=IEA
GO:0051082 "unfolded protein binding" evidence=IEA
GO:0005739 "mitochondrion" evidence=IDA
GO:0005783 "endoplasmic reticulum" evidence=IDA
GO:0005886 "plasma membrane" evidence=IDA
GO:0030176 "integral to endoplasmic reticulum membrane" evidence=IDA
GO:0005829 "cytosol" evidence=RCA
GO:0005794 "Golgi apparatus" evidence=IDA
GO:0030968 "endoplasmic reticulum unfolded protein response" evidence=RCA
TAIR|locus:2127373 ATERDJ2B [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
GENEDB_PFALCIPARUM|PF13_0102 PF13_0102 "DNAJ-like Sec63 homologue" [Plasmodium falciparum (taxid:5833)] Back     alignment and assigned GO terms
UNIPROTKB|Q8IEC8 PF13_0102 "DnaJ/SEC63 protein, putative" [Plasmodium falciparum 3D7 (taxid:36329)] Back     alignment and assigned GO terms
FB|FBgn0035771 sec63 "sec63" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
SGD|S000005780 SEC63 "Essential subunit of Sec63 complex" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0286131 sec63 "protein transport protein SEC63" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|E1C0C3 SEC63 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|A6PVC9 SEC63 "Translocation protein SEC63 homolog" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
CGD|CAL0005862 orf19.491 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00037758001
SubName- Full=Chromosome undetermined scaffold_91, whole genome shotgun sequence; (688 aa)
(Vitis vinifera)
Predicted Functional Partners:
GSVIVG00037864001
SubName- Full=Putative uncharacterized protein (Chromosome chr14 scaffold_9, whole genome shotg [...] (69 aa)
     •  0.800
GSVIVG00027847001
SubName- Full=Chromosome chr19 scaffold_4, whole genome shotgun sequence; (476 aa)
     •  0.800
GSVIVG00024600001
SubName- Full=Chromosome chr6 scaffold_3, whole genome shotgun sequence; (371 aa)
     •  0.800
GSVIVG00024508001
SubName- Full=Chromosome chr6 scaffold_3, whole genome shotgun sequence; (107 aa)
     •  0.800
GSVIVG00018216001
SubName- Full=Putative uncharacterized protein (Chromosome chr13 scaffold_17, whole genome shot [...] (108 aa)
     •  0.800
GSVIVG00016972001
SubName- Full=Chromosome chr11 scaffold_14, whole genome shotgun sequence; (489 aa)
     •  0.800
GSVIVG00001356001
SubName- Full=Chromosome chr8 scaffold_115, whole genome shotgun sequence; (566 aa)
      • 0.446

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query184
COG5407 610 COG5407, SEC63, Preprotein translocase subunit Sec 4e-30
pfam0022663 pfam00226, DnaJ, DnaJ domain 5e-23
TIGR02349 354 TIGR02349, DnaJ_bact, chaperone protein DnaJ 6e-23
COG0484 371 COG0484, DnaJ, DnaJ-class molecular chaperone with 4e-22
PRK14297 380 PRK14297, PRK14297, chaperone protein DnaJ; Provis 3e-21
cd0625755 cd06257, DnaJ, DnaJ domain or J-domain 2e-20
PRK10767 371 PRK10767, PRK10767, chaperone protein DnaJ; Provis 6e-20
smart0027160 smart00271, DnaJ, DnaJ molecular chaperone homolog 8e-20
PRK14291 382 PRK14291, PRK14291, chaperone protein DnaJ; Provis 9e-20
PRK14278 378 PRK14278, PRK14278, chaperone protein DnaJ; Provis 1e-19
PRK14298 377 PRK14298, PRK14298, chaperone protein DnaJ; Provis 1e-19
PRK14284 391 PRK14284, PRK14284, chaperone protein DnaJ; Provis 3e-19
PRK14277 386 PRK14277, PRK14277, chaperone protein DnaJ; Provis 4e-19
TIGR03835 871 TIGR03835, termin_org_DnaJ, terminal organelle ass 3e-18
PRK14280 376 PRK14280, PRK14280, chaperone protein DnaJ; Provis 4e-18
PRK14294 366 PRK14294, PRK14294, chaperone protein DnaJ; Provis 5e-17
PRK14301 373 PRK14301, PRK14301, chaperone protein DnaJ; Provis 9e-17
PRK14289 386 PRK14289, PRK14289, chaperone protein DnaJ; Provis 1e-16
PRK14283 378 PRK14283, PRK14283, chaperone protein DnaJ; Provis 1e-16
PRK14281 397 PRK14281, PRK14281, chaperone protein DnaJ; Provis 3e-16
PRK14276 380 PRK14276, PRK14276, chaperone protein DnaJ; Provis 4e-16
PRK14299 291 PRK14299, PRK14299, chaperone protein DnaJ; Provis 7e-16
PRK14293 374 PRK14293, PRK14293, chaperone protein DnaJ; Provis 1e-15
PRK14290 365 PRK14290, PRK14290, chaperone protein DnaJ; Provis 3e-15
PTZ00037 421 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Prov 5e-15
PRK14287 371 PRK14287, PRK14287, chaperone protein DnaJ; Provis 7e-15
PRK14292 371 PRK14292, PRK14292, chaperone protein DnaJ; Provis 1e-14
PRK14286 372 PRK14286, PRK14286, chaperone protein DnaJ; Provis 2e-14
PRK14285 365 PRK14285, PRK14285, chaperone protein DnaJ; Provis 1e-13
PRK14295 389 PRK14295, PRK14295, chaperone protein DnaJ; Provis 6e-13
PRK14282 369 PRK14282, PRK14282, chaperone protein DnaJ; Provis 5e-12
PRK14279 392 PRK14279, PRK14279, chaperone protein DnaJ; Provis 2e-11
COG2214 237 COG2214, CbpA, DnaJ-class molecular chaperone [Pos 3e-11
PRK14300 372 PRK14300, PRK14300, chaperone protein DnaJ; Provis 3e-11
PRK14296 372 PRK14296, PRK14296, chaperone protein DnaJ; Provis 1e-10
PRK14288 369 PRK14288, PRK14288, chaperone protein DnaJ; Provis 8e-09
PRK10266 306 PRK10266, PRK10266, curved DNA-binding protein Cbp 5e-08
PRK09430267 PRK09430, djlA, Dna-J like membrane chaperone prot 2e-07
PHA02624 647 PHA02624, PHA02624, large T antigen; Provisional 2e-04
PTZ00341 1136 PTZ00341, PTZ00341, Ring-infected erythrocyte surf 6e-04
PHA03102153 PHA03102, PHA03102, Small T antigen; Reviewed 0.002
COG5269 379 COG5269, ZUO1, Ribosome-associated chaperone zuoti 0.004
>gnl|CDD|227694 COG5407, SEC63, Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] Back     alignment and domain information 
 Score =  115 bits (288), Expect = 4e-30
 Identities = 59/176 (33%), Positives = 92/176 (52%), Gaps = 18/176 (10%)

Query: 5   EENSQLFPIFILTIMALPLVPYTI-LKLCHAFSKKIKTIHCQCSDCARSGK--YRKSIFK 61
           +E+    P F+L+ +   ++P T  L    + SK+++ + C C  C    K   RKSIFK
Sbjct: 8   DESGLASPYFVLSGLVPVVLPMTYDLIEGPSASKELRRVRCACQGCRPKDKNVSRKSIFK 67

Query: 62  RISNFSTCSNLSLVLLWVIMIILIYYIKSTSRE-MQVFEPFSILGLEHGASDSDIKKAYR 120
                     +  ++ W+++  LI  I++   E  + F+P+ ILG++   S+ DIKK YR
Sbjct: 68  L-------RKIFTIVGWLVISYLISNIRTLKIEYRRGFDPYEILGIDQDTSERDIKKRYR 120

Query: 121 RLSIQYHPDKNPDP------EANKYFVEYISKAYQALTDPISRENFEKYGHPDGRQ 170
            LS+++HPDK P        E  + +   I+KAY  LTD   REN+  YG PD  Q
Sbjct: 121 MLSMKFHPDKAPPMVNELRSEYEEKYKT-ITKAYGLLTDKKRRENYLNYGTPDSPQ 175

Length = 610
>gnl|CDD|215804 pfam00226, DnaJ, DnaJ domain Back     alignment and domain information
>gnl|CDD|233829 TIGR02349, DnaJ_bact, chaperone protein DnaJ Back     alignment and domain information
>gnl|CDD|223560 COG0484, DnaJ, DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|184611 PRK14297, PRK14297, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|99751 cd06257, DnaJ, DnaJ domain or J-domain Back     alignment and domain information
>gnl|CDD|236757 PRK10767, PRK10767, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|197617 smart00271, DnaJ, DnaJ molecular chaperone homology domain Back     alignment and domain information
>gnl|CDD|237661 PRK14291, PRK14291, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237654 PRK14278, PRK14278, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184612 PRK14298, PRK14298, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237658 PRK14284, PRK14284, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184599 PRK14277, PRK14277, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|234368 TIGR03835, termin_org_DnaJ, terminal organelle assembly protein TopJ Back     alignment and domain information
>gnl|CDD|237656 PRK14280, PRK14280, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237664 PRK14294, PRK14294, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237668 PRK14301, PRK14301, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237660 PRK14289, PRK14289, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184604 PRK14283, PRK14283, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237657 PRK14281, PRK14281, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237653 PRK14276, PRK14276, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237667 PRK14299, PRK14299, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237663 PRK14293, PRK14293, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172778 PRK14290, PRK14290, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|240236 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>gnl|CDD|237659 PRK14287, PRK14287, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237662 PRK14292, PRK14292, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172774 PRK14286, PRK14286, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172773 PRK14285, PRK14285, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237665 PRK14295, PRK14295, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184603 PRK14282, PRK14282, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237655 PRK14279, PRK14279, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|225124 COG2214, CbpA, DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|172788 PRK14300, PRK14300, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237666 PRK14296, PRK14296, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172776 PRK14288, PRK14288, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|182347 PRK10266, PRK10266, curved DNA-binding protein CbpA; Provisional Back     alignment and domain information
>gnl|CDD|236512 PRK09430, djlA, Dna-J like membrane chaperone protein; Provisional Back     alignment and domain information
>gnl|CDD|222912 PHA02624, PHA02624, large T antigen; Provisional Back     alignment and domain information
>gnl|CDD|173534 PTZ00341, PTZ00341, Ring-infected erythrocyte surface antigen; Provisional Back     alignment and domain information
>gnl|CDD|222986 PHA03102, PHA03102, Small T antigen; Reviewed Back     alignment and domain information
>gnl|CDD|227594 COG5269, ZUO1, Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 184
KOG0721230 consensus Molecular chaperone (DnaJ superfamily) [ 100.0
COG5407 610 SEC63 Preprotein translocase subunit Sec63 [Intrac 100.0
COG0484 371 DnaJ DnaJ-class molecular chaperone with C-termina 99.92
KOG0713 336 consensus Molecular chaperone (DnaJ superfamily) [ 99.88
PRK14296 372 chaperone protein DnaJ; Provisional 99.84
PRK14288 369 chaperone protein DnaJ; Provisional 99.83
KOG0712 337 consensus Molecular chaperone (DnaJ superfamily) [ 99.81
PRK14287 371 chaperone protein DnaJ; Provisional 99.81
PRK14286 372 chaperone protein DnaJ; Provisional 99.81
PRK14299 291 chaperone protein DnaJ; Provisional 99.8
PRK14276 380 chaperone protein DnaJ; Provisional 99.8
PRK14279 392 chaperone protein DnaJ; Provisional 99.8
PRK14283 378 chaperone protein DnaJ; Provisional 99.79
PRK14280 376 chaperone protein DnaJ; Provisional 99.79
PRK14298 377 chaperone protein DnaJ; Provisional 99.79
PTZ00037 421 DnaJ_C chaperone protein; Provisional 99.79
PRK14282 369 chaperone protein DnaJ; Provisional 99.79
PRK14294 366 chaperone protein DnaJ; Provisional 99.78
PRK14291 382 chaperone protein DnaJ; Provisional 99.78
PRK14278 378 chaperone protein DnaJ; Provisional 99.78
PRK14285 365 chaperone protein DnaJ; Provisional 99.77
PRK14277 386 chaperone protein DnaJ; Provisional 99.77
KOG0716 279 consensus Molecular chaperone (DnaJ superfamily) [ 99.77
PRK14297 380 chaperone protein DnaJ; Provisional 99.77
PRK14301 373 chaperone protein DnaJ; Provisional 99.77
PF0022664 DnaJ: DnaJ domain; InterPro: IPR001623 The prokary 99.76
PRK10767 371 chaperone protein DnaJ; Provisional 99.76
PRK14284 391 chaperone protein DnaJ; Provisional 99.76
PRK14281 397 chaperone protein DnaJ; Provisional 99.75
PRK14300 372 chaperone protein DnaJ; Provisional 99.74
PRK14295 389 chaperone protein DnaJ; Provisional 99.74
TIGR02349 354 DnaJ_bact chaperone protein DnaJ. This model repre 99.74
PRK14292 371 chaperone protein DnaJ; Provisional 99.74
KOG0715 288 consensus Molecular chaperone (DnaJ superfamily) [ 99.74
PRK10266 306 curved DNA-binding protein CbpA; Provisional 99.74
PRK14289 386 chaperone protein DnaJ; Provisional 99.73
PRK14293 374 chaperone protein DnaJ; Provisional 99.73
PRK14290 365 chaperone protein DnaJ; Provisional 99.73
KOG0691 296 consensus Molecular chaperone (DnaJ superfamily) [ 99.73
PTZ00341 1136 Ring-infected erythrocyte surface antigen; Provisi 99.72
KOG0718 546 consensus Molecular chaperone (DnaJ superfamily) [ 99.7
KOG0717 508 consensus Molecular chaperone (DnaJ superfamily) [ 99.66
cd0625755 DnaJ DnaJ domain or J-domain. DnaJ/Hsp40 (heat sho 99.66
smart0027160 DnaJ DnaJ molecular chaperone homology domain. 99.65
KOG0719 264 consensus Molecular chaperone (DnaJ superfamily) [ 99.65
PHA03102153 Small T antigen; Reviewed 99.64
TIGR03835 871 termin_org_DnaJ terminal organelle assembly protei 99.63
COG2214 237 CbpA DnaJ-class molecular chaperone [Posttranslati 99.58
KOG0722 329 consensus Molecular chaperone (DnaJ superfamily) [ 99.53
PRK01356166 hscB co-chaperone HscB; Provisional 99.48
PRK05014171 hscB co-chaperone HscB; Provisional 99.47
PRK00294173 hscB co-chaperone HscB; Provisional 99.45
PRK03578176 hscB co-chaperone HscB; Provisional 99.44
PTZ00100116 DnaJ chaperone protein; Provisional 99.4
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.39
KOG0714 306 consensus Molecular chaperone (DnaJ superfamily) [ 99.39
KOG0720 490 consensus Molecular chaperone (DnaJ superfamily) [ 99.36
PRK09430267 djlA Dna-J like membrane chaperone protein; Provis 99.28
PHA02624 647 large T antigen; Provisional 99.26
PRK01773173 hscB co-chaperone HscB; Provisional 99.2
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 99.14
KOG1150 250 consensus Predicted molecular chaperone (DnaJ supe 99.09
TIGR00714157 hscB Fe-S protein assembly co-chaperone HscB. This 99.02
COG5269 379 ZUO1 Ribosome-associated chaperone zuotin [Transla 98.85
KOG0568 342 consensus Molecular chaperone (DnaJ superfamily) [ 98.6
KOG0723112 consensus Molecular chaperone (DnaJ superfamily) [ 98.58
KOG1789 2235 consensus Endocytosis protein RME-8, contains DnaJ 98.4
KOG3192168 consensus Mitochondrial J-type chaperone [Posttran 97.51
COG1076174 DjlA DnaJ-domain-containing proteins 1 [Posttransl 96.55
COG1076174 DjlA DnaJ-domain-containing proteins 1 [Posttransl 96.25
PF03656127 Pam16: Pam16; InterPro: IPR005341 The Pam16 protei 96.19
KOG0431453 consensus Auxilin-like protein and related protein 94.92
PF11833 194 DUF3353: Protein of unknown function (DUF3353); In 88.58
PF1344662 RPT: A repeated domain in UCH-protein 85.57
KOG0724 335 consensus Zuotin and related molecular chaperones 82.06
PF12725 318 DUF3810: Protein of unknown function (DUF3810); In 81.82
>KOG0721 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=100.00  E-value=1.1e-56  Score=362.31  Aligned_cols=180  Identities=44%  Similarity=0.734  Sum_probs=164.9

Q ss_pred             CCccccCCCchHHHHHHHHhhhHHHHHHHHhccccccccccccccCchhHhhhhhhhhhhhhcccccchhhHHHHHHHHH
Q 030029            1 MAATEENSQLFPIFILTIMALPLVPYTILKLCHAFSKKIKTIHCQCSDCARSGKYRKSIFKRISNFSTCSNLSLVLLWVI   80 (184)
Q Consensus         1 ~~~~de~g~~f~~F~~t~~~~~lip~T~~~l~~~~~~~~~~~~c~c~~c~~~~~~~~~~~~~~~~~~~~~~~~l~~~w~l   80 (184)
                      +.+|||+|++|+||++||++++|+|+||+.|++.........+|+|..|++.+++.++..++  .+.+.+++++++||++
T Consensus         4 ~~eYDE~g~tf~yflls~~~~i~~P~Ty~~i~~~~~~~~~~~~c~c~~c~~~r~~~~~~~~k--~~~~~~~i~lv~~W~v   81 (230)
T KOG0721|consen    4 DYEYDESGNTFPYFLLSFLAIILLPMTYLLIPRNPEPPKRKEECQCHGCDKKRRKKAKVSPK--SISTKRKVFLVVGWAV   81 (230)
T ss_pred             ccccccccCccHHHHHHHHHHHHHHHHHHHhccccchhhhhhHHhhhhhhhhhhhhcccCcc--cchhHHHHHHHHHHHH
Confidence            46899999999999999999999999999999765556677899999999877665554444  5667889999999999


Q ss_pred             HHHHHHHHHhhccccccCCcccccCCCCCCCHHHHHHHHHHHHHHhCCCCCCChhHHHHHHHHHHHHHHHcCChHHHHHH
Q 030029           81 MIILIYYIKSTSREMQVFEPFSILGLEHGASDSDIKKAYRRLSIQYHPDKNPDPEANKYFVEYISKAYQALTDPISRENF  160 (184)
Q Consensus        81 ~~~l~~~~~~~~~~~~~~d~Y~iLgv~~~as~~eIkkayr~l~~~~HPDk~~~~~~~~~~~~~I~~AY~~L~d~~~R~~Y  160 (184)
                      +++|+|.+..+..+.+.+||||||||++++|.+|||+|||+|++++||||++.++..+++++.|++||+.|+|+..|+||
T Consensus        82 ~~fL~y~i~~~~~~~~~fDPyEILGl~pgas~~eIKkaYR~LSik~HPDK~~~~~~~e~~~~~I~KAY~aLTD~~sreN~  161 (230)
T KOG0721|consen   82 IAFLIYKIMNSRRERQKFDPYEILGLDPGASEKEIKKAYRRLSIKYHPDKQPPEEGDEEFFEAIAKAYQALTDKKSRENW  161 (230)
T ss_pred             HHHHHHHHhhhhHHhhcCCcHHhhCCCCCCCHHHHHHHHHHhhhhhCCCcCCCcchhHHHHHHHHHHHHHhcchhhHHHH
Confidence            99999999999999999999999999999999999999999999999999998777777778899999999999999999


Q ss_pred             HhcCCCCCCCccccccccCCCC
Q 030029          161 EKYGHPDGRQAMDFKWALLSLS  182 (184)
Q Consensus       161 d~~g~~~g~~~~~~~ialp~~~  182 (184)
                      ++||||||||++++|||||+|-
T Consensus       162 ekYG~PDGpq~~s~GIALPk~I  183 (230)
T KOG0721|consen  162 EKYGNPDGPQATSFGIALPKWI  183 (230)
T ss_pred             HHhCCCCCccchhhHhhhHHHH
Confidence            9999999999999999999994

>COG5407 SEC63 Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] Back     alignment and domain information
>COG0484 DnaJ DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0713 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14296 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14288 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0712 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14287 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14286 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14299 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14276 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14279 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14283 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14280 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14298 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PTZ00037 DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>PRK14282 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14294 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14291 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14278 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14285 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14277 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0716 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14297 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14301 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PF00226 DnaJ: DnaJ domain; InterPro: IPR001623 The prokaryotic heat shock protein DnaJ interacts with the chaperone hsp70-like DnaK protein [] Back     alignment and domain information
>PRK10767 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14284 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14281 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14300 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14295 chaperone protein DnaJ; Provisional Back     alignment and domain information
>TIGR02349 DnaJ_bact chaperone protein DnaJ Back     alignment and domain information
>PRK14292 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0715 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10266 curved DNA-binding protein CbpA; Provisional Back     alignment and domain information
>PRK14289 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14293 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14290 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0691 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00341 Ring-infected erythrocyte surface antigen; Provisional Back     alignment and domain information
>KOG0718 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0717 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd06257 DnaJ DnaJ domain or J-domain Back     alignment and domain information
>smart00271 DnaJ DnaJ molecular chaperone homology domain Back     alignment and domain information
>KOG0719 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA03102 Small T antigen; Reviewed Back     alignment and domain information
>TIGR03835 termin_org_DnaJ terminal organelle assembly protein TopJ Back     alignment and domain information
>COG2214 CbpA DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0722 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK01356 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PRK05014 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PRK00294 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PRK03578 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PTZ00100 DnaJ chaperone protein; Provisional Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG0714 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0720 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK09430 djlA Dna-J like membrane chaperone protein; Provisional Back     alignment and domain information
>PHA02624 large T antigen; Provisional Back     alignment and domain information
>PRK01773 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1150 consensus Predicted molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00714 hscB Fe-S protein assembly co-chaperone HscB Back     alignment and domain information
>COG5269 ZUO1 Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0568 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0723 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1789 consensus Endocytosis protein RME-8, contains DnaJ domain [Intracellular trafficking, secretion, and vesicular transport; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3192 consensus Mitochondrial J-type chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF03656 Pam16: Pam16; InterPro: IPR005341 The Pam16 protein is the fifth essential subunit of the pre-sequence translocase-associated protein import motor (PAM) [] Back     alignment and domain information
>KOG0431 consensus Auxilin-like protein and related proteins containing DnaJ domain [General function prediction only] Back     alignment and domain information
>PF11833 DUF3353: Protein of unknown function (DUF3353); InterPro: IPR021788 This family of proteins are functionally uncharacterised Back     alignment and domain information
>PF13446 RPT: A repeated domain in UCH-protein Back     alignment and domain information
>KOG0724 consensus Zuotin and related molecular chaperones (DnaJ superfamily), contains DNA-binding domains [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12725 DUF3810: Protein of unknown function (DUF3810); InterPro: IPR024294 This family of bacterial proteins is functionally uncharacterised Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query184
1hdj_A77 Human Hsp40 (Hdj-1), Nmr Length = 77 7e-14
2cug_A88 Solution Structure Of The J Domain Of The Pseudo Dn 2e-13
2ctw_A109 Solution Structure Of J-Domain From Mouse Dnaj Subf 5e-12
2ctp_A78 Solution Structure Of J-Domain From Human Dnaj Subf 7e-12
1bqz_A77 J-Domain (Residues 1-77) Of The Escherichia Coli N- 2e-10
2lgw_A99 Solution Structure Of The J Domain Of Hsj1a Length 2e-10
2dmx_A92 Solution Structure Of The J Domain Of Dnaj Homolog 2e-10
1xbl_A107 Nmr Structure Of The J-Domain (Residues 2-76) In Th 3e-10
1bq0_A103 J-Domain (Residues 1-77) Of The Escherichia Coli N- 3e-10
2ctr_A88 Solution Structure Of J-Domain From Human Dnaj Subf 1e-09
2lo1_A71 Nmr Structure Of The Protein Bc008182, A Dnaj-Like 1e-09
2och_A73 J-domain Of Dnj-12 From Caenorhabditis Elegans Leng 6e-09
3apo_A 780 Crystal Structure Of Full-Length Erdj5 Length = 780 1e-08
3apq_A 210 Crystal Structure Of J-Trx1 Fragment Of Erdj5 Lengt 2e-08
2dn9_A79 Solution Structure Of J-Domain From The Dnaj Homolo 2e-08
2ej7_A82 Solution Structure Of The Dnaj Domain Of The Human 3e-08
2o37_A92 J-Domain Of Sis1 Protein, Hsp40 Co-Chaperone From S 2e-07
2kqx_A73 Nmr Structure Of The J-Domain (Residues 2-72) In Th 3e-05
2y4u_A450 Crystal Structure Of Human P58(Ipk) In Space Group 3e-04
3lz8_A 329 Structure Of A Putative Chaperone Dnaj From Klebsie 4e-04
2y4t_A450 Crystal Structure Of The Human Co-Chaperone P58(Ipk 4e-04
>pdb|1HDJ|A Chain A, Human Hsp40 (Hdj-1), Nmr Length = 77 Back     alignment and structure 
Iteration: 1

 Score = 73.6 bits (179), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 47/65 (72%), Gaps = 1/65 (1%)
Query: 101 FSILGLEHGASDSDIKKAYRRLSIQYHPDKNPDPEANKYFVEYISKAYQALTDPISRENF 160
           +  LGL  GASD +IK+AYRR +++YHPDKN +P A + F E I++AY  L+DP  RE F
Sbjct: 6   YQTLGLARGASDEEIKRAYRRQALRYHPDKNKEPGAEEKFKE-IAEAYDVLSDPRKREIF 64
Query: 161 EKYGH 165
           ++YG 
Sbjct: 65  DRYGE 69
>pdb|2CUG|A Chain A, Solution Structure Of The J Domain Of The Pseudo Dnaj Protein, Mouse Hypothetical Mkiaa0962 Length = 88 Back     alignment and structure
>pdb|2CTW|A Chain A, Solution Structure Of J-Domain From Mouse Dnaj Subfamily C Menber 5 Length = 109 Back     alignment and structure
>pdb|2CTP|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 12 Length = 78 Back     alignment and structure
>pdb|1BQZ|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-78) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 77 Back     alignment and structure
>pdb|2LGW|A Chain A, Solution Structure Of The J Domain Of Hsj1a Length = 99 Back     alignment and structure
>pdb|2DMX|A Chain A, Solution Structure Of The J Domain Of Dnaj Homolog Subfamily B Member 8 Length = 92 Back     alignment and structure
>pdb|1XBL|A Chain A, Nmr Structure Of The J-Domain (Residues 2-76) In The Escherichia Coli N-Terminal Fragment (Residues 2-108) Of The Molecular Chaperone Dnaj, 20 Structures Length = 107 Back     alignment and structure
>pdb|1BQ0|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-104) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 103 Back     alignment and structure
>pdb|2CTR|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 9 Length = 88 Back     alignment and structure
>pdb|2LO1|A Chain A, Nmr Structure Of The Protein Bc008182, A Dnaj-Like Domain From Homo Sapiens Length = 71 Back     alignment and structure
>pdb|2OCH|A Chain A, J-domain Of Dnj-12 From Caenorhabditis Elegans Length = 73 Back     alignment and structure
>pdb|3APO|A Chain A, Crystal Structure Of Full-Length Erdj5 Length = 780 Back     alignment and structure
>pdb|3APQ|A Chain A, Crystal Structure Of J-Trx1 Fragment Of Erdj5 Length = 210 Back     alignment and structure
>pdb|2DN9|A Chain A, Solution Structure Of J-Domain From The Dnaj Homolog, Human Tid1 Protein Length = 79 Back     alignment and structure
>pdb|2EJ7|A Chain A, Solution Structure Of The Dnaj Domain Of The Human Protein Hcg3, A Hypothetical Protein Tmp_locus_21 Length = 82 Back     alignment and structure
>pdb|2O37|A Chain A, J-Domain Of Sis1 Protein, Hsp40 Co-Chaperone From Saccharomyces Cerevisiae Length = 92 Back     alignment and structure
>pdb|2KQX|A Chain A, Nmr Structure Of The J-Domain (Residues 2-72) In The Escherichia Coli Cbpa Length = 73 Back     alignment and structure
>pdb|2Y4U|A Chain A, Crystal Structure Of Human P58(Ipk) In Space Group P312 Length = 450 Back     alignment and structure
>pdb|3LZ8|A Chain A, Structure Of A Putative Chaperone Dnaj From Klebsiella Pneumoniae Subsp. Pneumoniae Mgh 78578 At 2.9 A Resolution. Length = 329 Back     alignment and structure
>pdb|2Y4T|A Chain A, Crystal Structure Of The Human Co-Chaperone P58(Ipk) Length = 450 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query184
1hdj_A77 Human HSP40, HDJ-1; molecular chaperone; NMR {Homo 2e-26
2ctr_A88 DNAJ homolog subfamily B member 9; J-domain, chape 2e-25
2ctp_A78 DNAJ homolog subfamily B member 12; J-domain, chap 2e-25
2ctw_A109 DNAJ homolog subfamily C member 5; J-domain, chape 3e-25
2cug_A88 Mkiaa0962 protein; DNAJ-like domain, structural ge 3e-25
3apq_A 210 DNAJ homolog subfamily C member 10; thioredoxin fo 3e-24
2dmx_A92 DNAJ homolog subfamily B member 8; DNAJ J domain, 5e-24
1bq0_A103 DNAJ, HSP40; chaperone, heat shock, protein foldin 6e-24
2yua_A99 Williams-beuren syndrome chromosome region 18 prot 6e-24
2ej7_A82 HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati 2e-23
2dn9_A79 DNAJ homolog subfamily A member 3; J-domain, TID1, 2e-23
2ctq_A112 DNAJ homolog subfamily C member 12; J-domain, chap 2e-23
2lgw_A99 DNAJ homolog subfamily B member 2; J domain, HSJ1A 3e-23
3lz8_A 329 Putative chaperone DNAJ; structure genomics, struc 6e-23
2ys8_A90 RAB-related GTP-binding protein RABJ; DNAJ domain, 8e-23
2och_A73 Hypothetical protein DNJ-12; HSP40, J-domain, chap 4e-22
2o37_A92 Protein SIS1; HSP40, J-domain, cochaperone, APC900 6e-22
1wjz_A94 1700030A21RIK protein; J-domain, DNAJ like protein 8e-21
2l6l_A155 DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, 4e-20
2qsa_A109 DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s 9e-19
1gh6_A114 Large T antigen; tumor suppressor, oncoprotein, an 2e-18
1iur_A88 KIAA0730 protein; DNAJ like domain, riken structur 1e-17
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 3e-17
2pf4_E174 Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, 6e-17
1faf_A79 Large T antigen; J domain, HPD motif, anti-paralle 5e-12
3hho_A174 CO-chaperone protein HSCB homolog; structural geno 7e-12
1fpo_A171 HSC20, chaperone protein HSCB; molecular chaperone 1e-11
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 2e-11
3uo3_A181 J-type CO-chaperone JAC1, mitochondrial; structura 2e-10
2guz_A71 Mitochondrial import inner membrane translocase su 3e-10
1n4c_A182 Auxilin; four helix bundle, protein binding; NMR { 6e-10
3bvo_A207 CO-chaperone protein HSCB, mitochondrial precurso; 5e-08
3ag7_A106 Putative uncharacterized protein F9E10.5; J-domain 2e-07
2qwo_B92 Putative tyrosine-protein phosphatase auxilin; cha 8e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-06
>1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 77 Back     alignment and structure
 Score = 94.9 bits (237), Expect = 2e-26
 Identities = 34/63 (53%), Positives = 46/63 (73%), Gaps = 1/63 (1%)

Query: 103 ILGLEHGASDSDIKKAYRRLSIQYHPDKNPDPEANKYFVEYISKAYQALTDPISRENFEK 162
            LGL  GASD +IK+AYRR +++YHPDKN +P A + F E I++AY  L+DP  RE F++
Sbjct: 8   TLGLARGASDEEIKRAYRRQALRYHPDKNKEPGAEEKFKE-IAEAYDVLSDPRKREIFDR 66

Query: 163 YGH 165
           YG 
Sbjct: 67  YGE 69
>2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Length = 109 Back     alignment and structure
>2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Length = 88 Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Length = 210 Back     alignment and structure
>2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Length = 103 Back     alignment and structure
>2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 82 Back     alignment and structure
>2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 112 Back     alignment and structure
>2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Length = 329 Back     alignment and structure
>2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Length = 73 Back     alignment and structure
>2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Length = 92 Back     alignment and structure
>1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Length = 94 Back     alignment and structure
>2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Length = 109 Back     alignment and structure
>1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Length = 114 Back     alignment and structure
>1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 88 Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Length = 780 Back     alignment and structure
>2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Length = 174 Back     alignment and structure
>1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Length = 79 Back     alignment and structure
>1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Length = 171 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A Length = 181 Back     alignment and structure
>2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Length = 71 Back     alignment and structure
>1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Length = 182 Back     alignment and structure
>3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} Length = 207 Back     alignment and structure
>3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} Length = 106 Back     alignment and structure
>2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Length = 92 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query184
1hdj_A77 Human HSP40, HDJ-1; molecular chaperone; NMR {Homo 99.87
2ctp_A78 DNAJ homolog subfamily B member 12; J-domain, chap 99.87
2dn9_A79 DNAJ homolog subfamily A member 3; J-domain, TID1, 99.86
2cug_A88 Mkiaa0962 protein; DNAJ-like domain, structural ge 99.86
2ej7_A82 HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati 99.85
2ctr_A88 DNAJ homolog subfamily B member 9; J-domain, chape 99.85
2och_A73 Hypothetical protein DNJ-12; HSP40, J-domain, chap 99.84
1wjz_A94 1700030A21RIK protein; J-domain, DNAJ like protein 99.83
2dmx_A92 DNAJ homolog subfamily B member 8; DNAJ J domain, 99.82
2ctq_A112 DNAJ homolog subfamily C member 12; J-domain, chap 99.82
1bq0_A103 DNAJ, HSP40; chaperone, heat shock, protein foldin 99.82
2lgw_A99 DNAJ homolog subfamily B member 2; J domain, HSJ1A 99.82
2yua_A99 Williams-beuren syndrome chromosome region 18 prot 99.81
2ctw_A109 DNAJ homolog subfamily C member 5; J-domain, chape 99.81
2o37_A92 Protein SIS1; HSP40, J-domain, cochaperone, APC900 99.81
2qsa_A109 DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s 99.8
3apq_A 210 DNAJ homolog subfamily C member 10; thioredoxin fo 99.78
2l6l_A155 DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, 99.75
2ys8_A90 RAB-related GTP-binding protein RABJ; DNAJ domain, 99.75
1gh6_A114 Large T antigen; tumor suppressor, oncoprotein, an 99.75
3lz8_A 329 Putative chaperone DNAJ; structure genomics, struc 99.74
1faf_A79 Large T antigen; J domain, HPD motif, anti-paralle 99.72
2pf4_E174 Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, 99.71
3hho_A174 CO-chaperone protein HSCB homolog; structural geno 99.7
1fpo_A171 HSC20, chaperone protein HSCB; molecular chaperone 99.69
1iur_A88 KIAA0730 protein; DNAJ like domain, riken structur 99.65
3bvo_A207 CO-chaperone protein HSCB, mitochondrial precurso; 99.64
2guz_A71 Mitochondrial import inner membrane translocase su 99.63
1n4c_A182 Auxilin; four helix bundle, protein binding; NMR { 99.61
2qwo_B92 Putative tyrosine-protein phosphatase auxilin; cha 99.6
3uo3_A181 J-type CO-chaperone JAC1, mitochondrial; structura 99.6
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 99.59
3ag7_A106 Putative uncharacterized protein F9E10.5; J-domain 99.56
2guz_B65 Mitochondrial import inner membrane translocase su 99.06
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.02
>1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Back     alignment and structure
Probab=99.87  E-value=2.4e-22  Score=138.63  Aligned_cols=69  Identities=49%  Similarity=0.902  Sum_probs=64.6

Q ss_pred             CCcccccCCCCCCCHHHHHHHHHHHHHHhCCCCCCChhHHHHHHHHHHHHHHHcCChHHHHHHHhcCCCC
Q 030029           98 FEPFSILGLEHGASDSDIKKAYRRLSIQYHPDKNPDPEANKYFVEYISKAYQALTDPISRENFEKYGHPD  167 (184)
Q Consensus        98 ~d~Y~iLgv~~~as~~eIkkayr~l~~~~HPDk~~~~~~~~~~~~~I~~AY~~L~d~~~R~~Yd~~g~~~  167 (184)
                      .|+|+||||++++|.++||++||++++++|||+++++++.+.|.+ |++||++|+||.+|..||++|..+
T Consensus         3 ~~~y~iLgv~~~as~~~Ik~ayr~l~~~~HPD~~~~~~~~~~f~~-i~~Ay~~L~d~~~R~~Yd~~~~~~   71 (77)
T 1hdj_A            3 KDYYQTLGLARGASDEEIKRAYRRQALRYHPDKNKEPGAEEKFKE-IAEAYDVLSDPRKREIFDRYGEEG   71 (77)
T ss_dssp             CCSHHHHTCCTTCCHHHHHHHHHHHHHTTCTTTCCCTTHHHHHHH-HHHHHHHTTCHHHHHHHHHTCGGG
T ss_pred             CCHHHHcCCCCCCCHHHHHHHHHHHHHHHCcCCCCCccHHHHHHH-HHHHHHHHCCHHHHHHHHHHcccc
Confidence            689999999999999999999999999999999988878888875 999999999999999999999754
>2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Back     alignment and structure
>1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Back     alignment and structure
>2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Back     alignment and structure
>2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Back     alignment and structure
>2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Back     alignment and structure
>2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Back     alignment and structure
>3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Back     alignment and structure
>1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Back     alignment and structure
>2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Back     alignment and structure
>1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Back     alignment and structure
>1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Back     alignment and structure
>3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} Back     alignment and structure
>2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Back     alignment and structure
>2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Back     alignment and structure
>3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Back     alignment and structure
>3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>2guz_B Mitochondrial import inner membrane translocase subunit TIM16; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 184
d1xbla_75 a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain 9e-16
d1hdja_77 a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9 3e-13
d1nz6a_98 a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [T 4e-13
d1wjza_94 a.2.3.1 (A:) CSL-type zinc finger-containing prote 4e-12
d1fafa_79 a.2.3.1 (A:) Large T antigen, the N-terminal J dom 3e-10
d1fpoa176 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) doma 1e-09
d1iura_88 a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human 3e-09
d1gh6a_114 a.2.3.1 (A:) Large T antigen, the N-terminal J dom 5e-08
>d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 75 Back     information, alignment and structure

class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Chaperone J-domain
family: Chaperone J-domain
domain: DnaJ chaperone, N-terminal (J) domain
species: Escherichia coli [TaxId: 562]

 Score = 66.6 bits (162), Expect = 9e-16
 Identities = 26/70 (37%), Positives = 44/70 (62%)

Query: 101 FSILGLEHGASDSDIKKAYRRLSIQYHPDKNPDPEANKYFVEYISKAYQALTDPISRENF 160
           + ILG+   A + +I+KAY+RL+++YHPD+N   +  +   + I +AY+ LTD   R  +
Sbjct: 6   YEILGVSKTAEEREIRKAYKRLAMKYHPDRNQGDKEAEAKFKEIKEAYEVLTDSQKRAAY 65

Query: 161 EKYGHPDGRQ 170
           ++YGH    Q
Sbjct: 66  DQYGHAAFEQ 75
>d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Length = 77 Back     information, alignment and structure
>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Length = 98 Back     information, alignment and structure
>d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Length = 79 Back     information, alignment and structure
>d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 76 Back     information, alignment and structure
>d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Length = 114 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query184
d1xbla_75 DnaJ chaperone, N-terminal (J) domain {Escherichia 99.91
d1hdja_77 HSP40 {Human (Homo sapiens) [TaxId: 9606]} 99.89
d1wjza_94 CSL-type zinc finger-containing protein 3 (J-domai 99.8
d1gh6a_114 Large T antigen, the N-terminal J domain {Simian v 99.79
d1fafa_79 Large T antigen, the N-terminal J domain {Murine p 99.71
d1fpoa176 HSC20 (HSCB), N-terminal (J) domain {Escherichia c 99.68
d1iura_88 Hypothetical protein KIAA0730 {Human (Homo sapiens 99.6
d1nz6a_98 Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} 99.59
d2b7ea156 Pre-mRNA-processing protein PRP40 {Baker's yeast ( 80.57
>d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Chaperone J-domain
family: Chaperone J-domain
domain: DnaJ chaperone, N-terminal (J) domain
species: Escherichia coli [TaxId: 562]

Probab=99.91  E-value=1.3e-24  Score=148.40  Aligned_cols=73  Identities=40%  Similarity=0.726  Sum_probs=64.8

Q ss_pred             cCCcccccCCCCCCCHHHHHHHHHHHHHHhCCCCCCCh-hHHHHHHHHHHHHHHHcCChHHHHHHHhcCCCCCCC
Q 030029           97 VFEPFSILGLEHGASDSDIKKAYRRLSIQYHPDKNPDP-EANKYFVEYISKAYQALTDPISRENFEKYGHPDGRQ  170 (184)
Q Consensus        97 ~~d~Y~iLgv~~~as~~eIkkayr~l~~~~HPDk~~~~-~~~~~~~~~I~~AY~~L~d~~~R~~Yd~~g~~~g~~  170 (184)
                      ..|+|+||||+++||.+|||+|||++++++|||+++++ +..+.|. .|++||++|+||.+|..||+||+.+..|
T Consensus         2 k~dyY~vLgv~~~As~~eIk~aYr~l~~~~HPDk~~~~~~~~~~f~-~i~~Ay~vL~d~~~R~~YD~~g~~~~eq   75 (75)
T d1xbla_           2 KQDYYEILGVSKTAEEREIRKAYKRLAMKYHPDRNQGDKEAEAKFK-EIKEAYEVLTDSQKRAAYDQYGHAAFEQ   75 (75)
T ss_dssp             CCCTTTTTCCSSSCCHHHHHHHHHHHHHHTCCTTCTTTCHHHHHHH-HHHHHHHHTTSSHHHHHHHHHTTSSCCC
T ss_pred             CCCHHHHcCCCCCcCHHHHHHHHHHHHhhhhhhccCCChHHHHHHH-HHHHHHHhcCCHHHHHHHHHhCccccCC
Confidence            47999999999999999999999999999999999864 4445565 5999999999999999999999876543
>d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Back     information, alignment and structure
>d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Back     information, alignment and structure
>d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2b7ea1 a.159.2.1 (A:4-59) Pre-mRNA-processing protein PRP40 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure