Citrus Sinensis ID: 030076
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 183 | ||||||
| 225444405 | 293 | PREDICTED: UDP-3-O-[3-hydroxymyristoyl] | 0.792 | 0.494 | 0.786 | 7e-65 | |
| 302144058 | 289 | unnamed protein product [Vitis vinifera] | 0.792 | 0.501 | 0.786 | 8e-65 | |
| 224078928 | 234 | predicted protein [Populus trichocarpa] | 0.792 | 0.619 | 0.793 | 2e-63 | |
| 255555019 | 247 | UDP-3-O-[3-hydroxymyristoyl] glucosamine | 0.786 | 0.582 | 0.777 | 1e-61 | |
| 356495807 | 312 | PREDICTED: UDP-3-O-[3-hydroxymyristoyl] | 0.863 | 0.506 | 0.712 | 3e-61 | |
| 124359869 | 285 | Trimeric LpxA-like [Medicago truncatula] | 0.797 | 0.512 | 0.746 | 1e-57 | |
| 297799948 | 303 | bacterial transferase hexapeptide repeat | 0.792 | 0.478 | 0.731 | 6e-57 | |
| 42567003 | 304 | trimeric LpxA-like protein [Arabidopsis | 0.846 | 0.509 | 0.683 | 5e-56 | |
| 449433924 | 285 | PREDICTED: UDP-3-O-acylglucosamine N-acy | 0.781 | 0.501 | 0.713 | 1e-55 | |
| 357154632 | 288 | PREDICTED: UDP-3-O-[3-hydroxymyristoyl] | 0.928 | 0.590 | 0.588 | 1e-54 |
| >gi|225444405|ref|XP_002265427.1| PREDICTED: UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 251 bits (642), Expect = 7e-65, Method: Compositional matrix adjust.
Identities = 114/145 (78%), Positives = 135/145 (93%)
Query: 37 QQFQKWHNGGGIFHQSACIDSTVLIEVGAIVHSKAVLGANVCIGSGTVVGPAVTIGQSTN 96
Q+FQKWHNGGG+FH++ACI+ST LIE+GA+VHS+ V+ ANV IGSGT+VGPAV IG+ST
Sbjct: 60 QEFQKWHNGGGMFHKTACIESTTLIEIGAVVHSECVVAANVHIGSGTIVGPAVKIGESTK 119
Query: 97 IGFNVALSNCIIGDSCIIHNGVCIGQDGFGFFVDEHGNMLKKPQLLNARIGNHVEIGANS 156
I +NV+++NC IGD+C IHNGVCIGQDGFGFFVDEHGNM+KK Q+L+ARIGNHVEIGAN+
Sbjct: 120 IEYNVSVTNCTIGDACFIHNGVCIGQDGFGFFVDEHGNMMKKAQMLSARIGNHVEIGANT 179
Query: 157 CIDRGSWRDTVIGDHSKIDNLVQVG 181
CIDRGSWRDTVIGDHSKIDNLVQ+G
Sbjct: 180 CIDRGSWRDTVIGDHSKIDNLVQIG 204
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: N/A Phylum: Streptophyta Superkingdom: |
| >gi|302144058|emb|CBI23163.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224078928|ref|XP_002305684.1| predicted protein [Populus trichocarpa] gi|222848648|gb|EEE86195.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|255555019|ref|XP_002518547.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase, putative [Ricinus communis] gi|223542392|gb|EEF43934.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|356495807|ref|XP_003516764.1| PREDICTED: UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|124359869|gb|ABN06168.1| Trimeric LpxA-like [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|297799948|ref|XP_002867858.1| bacterial transferase hexapeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297313694|gb|EFH44117.1| bacterial transferase hexapeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|42567003|ref|NP_193854.2| trimeric LpxA-like protein [Arabidopsis thaliana] gi|332659029|gb|AEE84429.1| trimeric LpxA-like protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|449433924|ref|XP_004134746.1| PREDICTED: UDP-3-O-acylglucosamine N-acyltransferase-like [Cucumis sativus] gi|449530480|ref|XP_004172223.1| PREDICTED: UDP-3-O-acylglucosamine N-acyltransferase-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|357154632|ref|XP_003576848.1| PREDICTED: UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase-like [Brachypodium distachyon] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 183 | ||||||
| TAIR|locus:2127423 | 304 | LpxD2 "lipid X D2" [Arabidopsi | 0.836 | 0.503 | 0.692 | 1.6e-56 | |
| TIGR_CMR|SO_1639 | 341 | SO_1639 "UDP-3-O-(3-hydroxymyr | 0.699 | 0.375 | 0.469 | 4.8e-23 | |
| TIGR_CMR|CBU_0613 | 342 | CBU_0613 "UDP-3-O-[3-hydroxymy | 0.732 | 0.391 | 0.415 | 1.1e-21 | |
| UNIPROTKB|Q9KPW2 | 351 | lpxD "UDP-3-O-acylglucosamine | 0.721 | 0.376 | 0.410 | 1.5e-21 | |
| TIGR_CMR|VC_2250 | 351 | VC_2250 "UDP-3-O-3-hydroxymyri | 0.721 | 0.376 | 0.410 | 1.5e-21 | |
| UNIPROTKB|P21645 | 341 | lpxD [Escherichia coli K-12 (t | 0.721 | 0.387 | 0.395 | 9.2e-20 | |
| TIGR_CMR|GSU_2266 | 347 | GSU_2266 "UDP-3-O-3-hydroxymyr | 0.683 | 0.360 | 0.409 | 5.7e-19 | |
| TIGR_CMR|CPS_1563 | 349 | CPS_1563 "UDP-3-O-[3-hydroxymy | 0.726 | 0.381 | 0.401 | 1e-16 | |
| TIGR_CMR|CJE_0679 | 321 | CJE_0679 "UDP-3-O-(R-3-hydroxy | 0.595 | 0.339 | 0.372 | 5.4e-12 | |
| TIGR_CMR|SPO_1930 | 363 | SPO_1930 "UDP-3-O-3-hydroxymyr | 0.661 | 0.333 | 0.320 | 2.5e-08 |
| TAIR|locus:2127423 LpxD2 "lipid X D2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 582 (209.9 bits), Expect = 1.6e-56, P = 1.6e-56
Identities = 106/153 (69%), Positives = 126/153 (82%)
Query: 29 TKSDIESRQQFQKWHNGGGIFHQSACIDSTVLIEVGAIVHSKAVLGANVCIGSGTVVGPA 88
T I ++ F +W NGGG H SA I S+ L+E GA+VH KAVLGA V +GSGTV+GP+
Sbjct: 63 TGGGIIVKEGFLRWENGGGTCHSSAQIYSSALVEFGAVVHEKAVLGAEVHVGSGTVIGPS 122
Query: 89 VTIGQSTNIGFNVALSNCIIGDSCIIHNGVCIGQDGFGFFVDEHGNMLKKPQLLNARIGN 148
V IG ST IG+NV++SNC IGDSC+IHNGVCIGQDGFGF+VDEHGNM+KKPQ LN +IGN
Sbjct: 123 VDIGPSTRIGYNVSISNCSIGDSCVIHNGVCIGQDGFGFYVDEHGNMVKKPQTLNVKIGN 182
Query: 149 HVEIGANSCIDRGSWRDTVIGDHSKIDNLVQVG 181
VEIGAN+CIDRGSWR+TVI D +KIDNLVQ+G
Sbjct: 183 RVEIGANTCIDRGSWRETVIEDDTKIDNLVQIG 215
|
|
| TIGR_CMR|SO_1639 SO_1639 "UDP-3-O-(3-hydroxymyristoyl) glucosamine n-acyltransferase" [Shewanella oneidensis MR-1 (taxid:211586)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CBU_0613 CBU_0613 "UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase" [Coxiella burnetii RSA 493 (taxid:227377)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9KPW2 lpxD "UDP-3-O-acylglucosamine N-acyltransferase" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|VC_2250 VC_2250 "UDP-3-O-3-hydroxymyristoyl glucosamine N-acyltransferase" [Vibrio cholerae O1 biovar El Tor (taxid:686)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P21645 lpxD [Escherichia coli K-12 (taxid:83333)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|GSU_2266 GSU_2266 "UDP-3-O-3-hydroxymyristoyl glucosamine N-acyltransferase" [Geobacter sulfurreducens PCA (taxid:243231)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CPS_1563 CPS_1563 "UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase" [Colwellia psychrerythraea 34H (taxid:167879)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CJE_0679 CJE_0679 "UDP-3-O-(R-3-hydroxymyristoyl)-glucosamine N-acyltransferase" [Campylobacter jejuni RM1221 (taxid:195099)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|SPO_1930 SPO_1930 "UDP-3-O-3-hydroxymyristoyl glucosamine N-acyltransferase" [Ruegeria pomeroyi DSS-3 (taxid:246200)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 183 | |||
| PRK00892 | 343 | PRK00892, lpxD, UDP-3-O-[3-hydroxymyristoyl] gluco | 9e-51 | |
| cd03352 | 205 | cd03352, LbH_LpxD, UDP-3-O-acyl-glucosamine N-acyl | 5e-46 | |
| TIGR01853 | 324 | TIGR01853, lipid_A_lpxD, UDP-3-O-[3-hydroxymyristo | 2e-40 | |
| COG1044 | 338 | COG1044, LpxD, UDP-3-O-[3-hydroxymyristoyl] | 6e-38 | |
| PRK05289 | 262 | PRK05289, PRK05289, UDP-N-acetylglucosamine acyltr | 9e-12 | |
| cd03351 | 254 | cd03351, LbH_UDP-GlcNAc_AT, UDP-N-acetylglucosamin | 1e-10 | |
| COG1208 | 358 | COG1208, GCD1, Nucleoside-diphosphate-sugar pyroph | 6e-09 | |
| COG1043 | 260 | COG1043, LpxA, Acyl-[acyl carrier protein] | 2e-08 | |
| PRK12461 | 255 | PRK12461, PRK12461, UDP-N-acetylglucosamine acyltr | 3e-08 | |
| cd03360 | 197 | cd03360, LbH_AT_putative, Putative Acyltransferase | 1e-07 | |
| TIGR03570 | 193 | TIGR03570, NeuD_NnaD, sugar O-acyltransferase, sia | 2e-07 | |
| cd03360 | 197 | cd03360, LbH_AT_putative, Putative Acyltransferase | 3e-07 | |
| cd03354 | 101 | cd03354, LbH_SAT, Serine acetyltransferase (SAT): | 5e-07 | |
| COG1045 | 194 | COG1045, CysE, Serine acetyltransferase [Amino aci | 7e-07 | |
| TIGR01852 | 254 | TIGR01852, lipid_A_lpxA, acyl-[acyl-carrier-protei | 1e-06 | |
| TIGR02091 | 361 | TIGR02091, glgC, glucose-1-phosphate adenylyltrans | 1e-06 | |
| COG2171 | 271 | COG2171, DapD, Tetrahydrodipicolinate N-succinyltr | 2e-06 | |
| cd00710 | 167 | cd00710, LbH_gamma_CA, Gamma carbonic anhydrases ( | 2e-06 | |
| COG0448 | 393 | COG0448, GlgC, ADP-glucose pyrophosphorylase [Carb | 2e-06 | |
| PRK14355 | 459 | PRK14355, glmU, bifunctional N-acetylglucosamine-1 | 3e-06 | |
| PRK14354 | 458 | PRK14354, glmU, bifunctional N-acetylglucosamine-1 | 3e-06 | |
| cd05636 | 163 | cd05636, LbH_G1P_TT_C_like, Putative glucose-1-pho | 5e-06 | |
| cd04651 | 104 | cd04651, LbH_G1P_AT_C, Glucose-1-phosphate adenyly | 5e-06 | |
| COG0663 | 176 | COG0663, PaaY, Carbonic anhydrases/acetyltransfera | 7e-06 | |
| PRK05289 | 262 | PRK05289, PRK05289, UDP-N-acetylglucosamine acyltr | 1e-05 | |
| PRK14354 | 458 | PRK14354, glmU, bifunctional N-acetylglucosamine-1 | 1e-05 | |
| cd03353 | 193 | cd03353, LbH_GlmU_C, N-acetyl-glucosamine-1-phosph | 1e-05 | |
| TIGR03992 | 393 | TIGR03992, Arch_glmU, UDP-N-acetylglucosamine diph | 2e-05 | |
| cd00208 | 78 | cd00208, LbetaH, Left-handed parallel beta-Helix ( | 3e-05 | |
| PRK05293 | 380 | PRK05293, glgC, glucose-1-phosphate adenylyltransf | 3e-05 | |
| TIGR01173 | 451 | TIGR01173, glmU, UDP-N-acetylglucosamine diphospho | 4e-05 | |
| cd04645 | 153 | cd04645, LbH_gamma_CA_like, Gamma carbonic anhydra | 7e-05 | |
| PRK14360 | 450 | PRK14360, glmU, bifunctional N-acetylglucosamine-1 | 1e-04 | |
| COG1207 | 460 | COG1207, GlmU, N-acetylglucosamine-1-phosphate uri | 1e-04 | |
| cd03352 | 205 | cd03352, LbH_LpxD, UDP-3-O-acyl-glucosamine N-acyl | 2e-04 | |
| TIGR03992 | 393 | TIGR03992, Arch_glmU, UDP-N-acetylglucosamine diph | 2e-04 | |
| cd00208 | 78 | cd00208, LbetaH, Left-handed parallel beta-Helix ( | 2e-04 | |
| PRK14352 | 482 | PRK14352, glmU, bifunctional N-acetylglucosamine-1 | 2e-04 | |
| cd03359 | 161 | cd03359, LbH_Dynactin_5, Dynactin 5 (or subunit p2 | 2e-04 | |
| cd00710 | 167 | cd00710, LbH_gamma_CA, Gamma carbonic anhydrases ( | 5e-04 | |
| cd04745 | 155 | cd04745, LbH_paaY_like, paaY-like: This group is c | 7e-04 | |
| COG1044 | 338 | COG1044, LpxD, UDP-3-O-[3-hydroxymyristoyl] | 0.001 | |
| COG1207 | 460 | COG1207, GlmU, N-acetylglucosamine-1-phosphate uri | 0.001 | |
| cd03356 | 79 | cd03356, LbH_G1P_AT_C_like, Left-handed parallel b | 0.001 | |
| cd03356 | 79 | cd03356, LbH_G1P_AT_C_like, Left-handed parallel b | 0.001 | |
| cd04647 | 109 | cd04647, LbH_MAT_like, Maltose O-acyltransferase ( | 0.001 | |
| cd03358 | 119 | cd03358, LbH_WxcM_N_like, WcxM-like, Left-handed p | 0.001 | |
| TIGR03532 | 231 | TIGR03532, DapD_Ac, 2,3,4,5-tetrahydropyridine-2,6 | 0.001 | |
| COG0448 | 393 | COG0448, GlgC, ADP-glucose pyrophosphorylase [Carb | 0.002 | |
| cd03356 | 79 | cd03356, LbH_G1P_AT_C_like, Left-handed parallel b | 0.002 | |
| TIGR01852 | 254 | TIGR01852, lipid_A_lpxA, acyl-[acyl-carrier-protei | 0.003 | |
| PRK13627 | 196 | PRK13627, PRK13627, carnitine operon protein CaiE; | 0.003 | |
| cd03350 | 139 | cd03350, LbH_THP_succinylT, 2,3,4,5-tetrahydropyri | 0.004 |
| >gnl|CDD|234858 PRK00892, lpxD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; Provisional | Back alignment and domain information |
|---|
Score = 166 bits (422), Expect = 9e-51
Identities = 61/133 (45%), Positives = 79/133 (59%), Gaps = 2/133 (1%)
Query: 50 HQSACIDSTVLIEVGAIVHSKAVLGANVCIGSGTVVGPAVTIGQSTNIGFNVAL-SNCII 108
SA I V I A++ + V+G V IG+G V+G V IG + NV + I
Sbjct: 110 DPSAKIGEGVSIGPNAVIGAGVVIGDGVVIGAGAVIGDGVKIGADCRLHANVTIYHAVRI 169
Query: 109 GDSCIIHNGVCIGQDGFGFFVDEHGNMLKKPQLLNARIGNHVEIGANSCIDRGSWRDTVI 168
G+ IIH+G IG DGFGF ++ G +K PQL IG+ VEIGAN+ IDRG+ DTVI
Sbjct: 170 GNRVIIHSGAVIGSDGFGF-ANDRGGWVKIPQLGRVIIGDDVEIGANTTIDRGALDDTVI 228
Query: 169 GDHSKIDNLVQVG 181
G+ KIDNLVQ+
Sbjct: 229 GEGVKIDNLVQIA 241
|
Length = 343 |
| >gnl|CDD|100043 cd03352, LbH_LpxD, UDP-3-O-acyl-glucosamine N-acyltransferase (LpxD): The enzyme catalyzes the transfer of 3-hydroxymyristic acid or 3-hydroxy-arachidic acid, depending on the organism, from the acyl carrier protein (ACP) to UDP-3-O-acyl-glucosamine to produce UDP-2,3-diacyl-GlcNAc | Back alignment and domain information |
|---|
| >gnl|CDD|233599 TIGR01853, lipid_A_lpxD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|223974 COG1044, LpxD, UDP-3-O-[3-hydroxymyristoyl] | Back alignment and domain information |
|---|
| >gnl|CDD|235390 PRK05289, PRK05289, UDP-N-acetylglucosamine acyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|100042 cd03351, LbH_UDP-GlcNAc_AT, UDP-N-acetylglucosamine O-acyltransferase (UDP-GlcNAc acyltransferase): Proteins in this family catalyze the transfer of (R)-3-hydroxymyristic acid from its acyl carrier protein thioester to UDP-GlcNAc | Back alignment and domain information |
|---|
| >gnl|CDD|224129 COG1208, GCD1, Nucleoside-diphosphate-sugar pyrophosphorylase involved in lipopolysaccharide biosynthesis/translation initiation factor 2B, gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) [Cell envelope biogenesis, outer membrane / Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|223973 COG1043, LpxA, Acyl-[acyl carrier protein] | Back alignment and domain information |
|---|
| >gnl|CDD|183539 PRK12461, PRK12461, UDP-N-acetylglucosamine acyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|100050 cd03360, LbH_AT_putative, Putative Acyltransferase (AT), Left-handed parallel beta-Helix (LbH) domain; This group is composed of mostly uncharacterized proteins containing an N-terminal helical subdomain followed by a LbH domain | Back alignment and domain information |
|---|
| >gnl|CDD|234265 TIGR03570, NeuD_NnaD, sugar O-acyltransferase, sialic acid O-acetyltransferase NeuD family | Back alignment and domain information |
|---|
| >gnl|CDD|100050 cd03360, LbH_AT_putative, Putative Acyltransferase (AT), Left-handed parallel beta-Helix (LbH) domain; This group is composed of mostly uncharacterized proteins containing an N-terminal helical subdomain followed by a LbH domain | Back alignment and domain information |
|---|
| >gnl|CDD|100045 cd03354, LbH_SAT, Serine acetyltransferase (SAT): SAT catalyzes the CoA-dependent acetylation of the side chain hydroxyl group of L-serine to form O-acetylserine, as the first step of a two-step biosynthetic pathway in bacteria and plants leading to the formation of L-cysteine | Back alignment and domain information |
|---|
| >gnl|CDD|223975 COG1045, CysE, Serine acetyltransferase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|188173 TIGR01852, lipid_A_lpxA, acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|233720 TIGR02091, glgC, glucose-1-phosphate adenylyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|225082 COG2171, DapD, Tetrahydrodipicolinate N-succinyltransferase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|100039 cd00710, LbH_gamma_CA, Gamma carbonic anhydrases (CA): Carbonic anhydrases are zinc-containing enzymes that catalyze the reversible hydration of carbon dioxide in a two-step mechanism, involving the nucleophilic attack of a zinc-bound hydroxide ion on carbon dioxide, followed by the regeneration of the active site by ionization of the zinc-bound water molecule and removal of a proton from the active site | Back alignment and domain information |
|---|
| >gnl|CDD|223525 COG0448, GlgC, ADP-glucose pyrophosphorylase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|237685 PRK14355, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184643 PRK14354, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|100060 cd05636, LbH_G1P_TT_C_like, Putative glucose-1-phosphate thymidylyltransferase, C-terminal Left-handed parallel beta-Helix (LbH) domain: Proteins in this family show simlarity to glucose-1-phosphate adenylyltransferases in that they contain N-terminal catalytic domains that resemble a dinucleotide-binding Rossmann fold and C-terminal LbH fold domains | Back alignment and domain information |
|---|
| >gnl|CDD|100056 cd04651, LbH_G1P_AT_C, Glucose-1-phosphate adenylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Glucose-1-phosphate adenylyltransferase is also known as ADP-glucose synthase or ADP-glucose pyrophosphorylase | Back alignment and domain information |
|---|
| >gnl|CDD|223735 COG0663, PaaY, Carbonic anhydrases/acetyltransferases, isoleucine patch superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|235390 PRK05289, PRK05289, UDP-N-acetylglucosamine acyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184643 PRK14354, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|100044 cd03353, LbH_GlmU_C, N-acetyl-glucosamine-1-phosphate uridyltransferase (GlmU), C-terminal left-handed beta-helix (LbH) acetyltransferase domain: GlmU is also known as UDP-N-acetylglucosamine pyrophosphorylase | Back alignment and domain information |
|---|
| >gnl|CDD|234433 TIGR03992, Arch_glmU, UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|100038 cd00208, LbetaH, Left-handed parallel beta-Helix (LbetaH or LbH) domain: The alignment contains 5 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X) | Back alignment and domain information |
|---|
| >gnl|CDD|179997 PRK05293, glgC, glucose-1-phosphate adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233299 TIGR01173, glmU, UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|100051 cd04645, LbH_gamma_CA_like, Gamma carbonic anhydrase-like: This family is composed of gamma carbonic anhydrase (CA), Ferripyochelin Binding Protein (FBP), E | Back alignment and domain information |
|---|
| >gnl|CDD|184646 PRK14360, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224128 COG1207, GlmU, N-acetylglucosamine-1-phosphate uridyltransferase (contains nucleotidyltransferase and I-patch acetyltransferase domains) [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|100043 cd03352, LbH_LpxD, UDP-3-O-acyl-glucosamine N-acyltransferase (LpxD): The enzyme catalyzes the transfer of 3-hydroxymyristic acid or 3-hydroxy-arachidic acid, depending on the organism, from the acyl carrier protein (ACP) to UDP-3-O-acyl-glucosamine to produce UDP-2,3-diacyl-GlcNAc | Back alignment and domain information |
|---|
| >gnl|CDD|234433 TIGR03992, Arch_glmU, UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|100038 cd00208, LbetaH, Left-handed parallel beta-Helix (LbetaH or LbH) domain: The alignment contains 5 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X) | Back alignment and domain information |
|---|
| >gnl|CDD|184641 PRK14352, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|100049 cd03359, LbH_Dynactin_5, Dynactin 5 (or subunit p25); Dynactin is a major component of the activator complex that stimulates dynein-mediated vesicle transport | Back alignment and domain information |
|---|
| >gnl|CDD|100039 cd00710, LbH_gamma_CA, Gamma carbonic anhydrases (CA): Carbonic anhydrases are zinc-containing enzymes that catalyze the reversible hydration of carbon dioxide in a two-step mechanism, involving the nucleophilic attack of a zinc-bound hydroxide ion on carbon dioxide, followed by the regeneration of the active site by ionization of the zinc-bound water molecule and removal of a proton from the active site | Back alignment and domain information |
|---|
| >gnl|CDD|100058 cd04745, LbH_paaY_like, paaY-like: This group is composed by uncharacterized proteins with similarity to the protein product of the E | Back alignment and domain information |
|---|
| >gnl|CDD|223974 COG1044, LpxD, UDP-3-O-[3-hydroxymyristoyl] | Back alignment and domain information |
|---|
| >gnl|CDD|224128 COG1207, GlmU, N-acetylglucosamine-1-phosphate uridyltransferase (contains nucleotidyltransferase and I-patch acetyltransferase domains) [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|100046 cd03356, LbH_G1P_AT_C_like, Left-handed parallel beta-Helix (LbH) domain of a group of proteins with similarity to glucose-1-phosphate adenylyltransferase: Included in this family are glucose-1-phosphate adenylyltransferase, mannose-1-phosphate guanylyltransferase, and the eukaryotic translation initiation factor eIF-2B subunits, epsilon and gamma | Back alignment and domain information |
|---|
| >gnl|CDD|100046 cd03356, LbH_G1P_AT_C_like, Left-handed parallel beta-Helix (LbH) domain of a group of proteins with similarity to glucose-1-phosphate adenylyltransferase: Included in this family are glucose-1-phosphate adenylyltransferase, mannose-1-phosphate guanylyltransferase, and the eukaryotic translation initiation factor eIF-2B subunits, epsilon and gamma | Back alignment and domain information |
|---|
| >gnl|CDD|100053 cd04647, LbH_MAT_like, Maltose O-acyltransferase (MAT)-like: This family is composed of maltose O-acetyltransferase, galactoside O-acetyltransferase (GAT), xenobiotic acyltransferase (XAT) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|100048 cd03358, LbH_WxcM_N_like, WcxM-like, Left-handed parallel beta-Helix (LbH) N-terminal domain: This group is composed of Xanthomonas campestris WcxM and proteins with similarity to the WcxM N-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|132571 TIGR03532, DapD_Ac, 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|223525 COG0448, GlgC, ADP-glucose pyrophosphorylase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|100046 cd03356, LbH_G1P_AT_C_like, Left-handed parallel beta-Helix (LbH) domain of a group of proteins with similarity to glucose-1-phosphate adenylyltransferase: Included in this family are glucose-1-phosphate adenylyltransferase, mannose-1-phosphate guanylyltransferase, and the eukaryotic translation initiation factor eIF-2B subunits, epsilon and gamma | Back alignment and domain information |
|---|
| >gnl|CDD|188173 TIGR01852, lipid_A_lpxA, acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|184189 PRK13627, PRK13627, carnitine operon protein CaiE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|100041 cd03350, LbH_THP_succinylT, 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP) N-succinyltransferase (also called THP succinyltransferase): THDP N-succinyltransferase catalyzes the conversion of tetrahydrodipicolinate and succinyl-CoA to N-succinyltetrahydrodipicolinate and CoA | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 183 | |||
| COG1044 | 338 | LpxD UDP-3-O-[3-hydroxymyristoyl] | 99.91 | |
| TIGR01853 | 324 | lipid_A_lpxD UDP-3-O-[3-hydroxymyristoyl] glucosam | 99.89 | |
| PRK00892 | 343 | lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-ac | 99.86 | |
| cd05636 | 163 | LbH_G1P_TT_C_like Putative glucose-1-phosphate thy | 99.82 | |
| TIGR03532 | 231 | DapD_Ac 2,3,4,5-tetrahydropyridine-2,6-dicarboxyla | 99.81 | |
| COG1044 | 338 | LpxD UDP-3-O-[3-hydroxymyristoyl] | 99.79 | |
| cd03351 | 254 | LbH_UDP-GlcNAc_AT UDP-N-acetylglucosamine O-acyltr | 99.78 | |
| PRK05289 | 262 | UDP-N-acetylglucosamine acyltransferase; Provision | 99.78 | |
| TIGR01852 | 254 | lipid_A_lpxA acyl-[acyl-carrier-protein]--UDP-N-ac | 99.77 | |
| cd03351 | 254 | LbH_UDP-GlcNAc_AT UDP-N-acetylglucosamine O-acyltr | 99.77 | |
| cd03350 | 139 | LbH_THP_succinylT 2,3,4,5-tetrahydropyridine-2,6-d | 99.76 | |
| COG0663 | 176 | PaaY Carbonic anhydrases/acetyltransferases, isole | 99.75 | |
| cd03353 | 193 | LbH_GlmU_C N-acetyl-glucosamine-1-phosphate uridyl | 99.75 | |
| cd04646 | 164 | LbH_Dynactin_6 Dynactin 6 (or subunit p27): Dynact | 99.74 | |
| TIGR01852 | 254 | lipid_A_lpxA acyl-[acyl-carrier-protein]--UDP-N-ac | 99.74 | |
| PRK14353 | 446 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.74 | |
| TIGR01853 | 324 | lipid_A_lpxD UDP-3-O-[3-hydroxymyristoyl] glucosam | 99.73 | |
| PRK13627 | 196 | carnitine operon protein CaiE; Provisional | 99.73 | |
| PLN02296 | 269 | carbonate dehydratase | 99.73 | |
| cd04745 | 155 | LbH_paaY_like paaY-like: This group is composed by | 99.73 | |
| PRK14355 | 459 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.73 | |
| cd03352 | 205 | LbH_LpxD UDP-3-O-acyl-glucosamine N-acyltransferas | 99.73 | |
| PRK00892 | 343 | lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-ac | 99.72 | |
| COG0663 | 176 | PaaY Carbonic anhydrases/acetyltransferases, isole | 99.72 | |
| PLN02296 | 269 | carbonate dehydratase | 99.72 | |
| cd04646 | 164 | LbH_Dynactin_6 Dynactin 6 (or subunit p27): Dynact | 99.72 | |
| PRK12461 | 255 | UDP-N-acetylglucosamine acyltransferase; Provision | 99.72 | |
| cd03352 | 205 | LbH_LpxD UDP-3-O-acyl-glucosamine N-acyltransferas | 99.72 | |
| COG1207 | 460 | GlmU N-acetylglucosamine-1-phosphate uridyltransfe | 99.71 | |
| TIGR02287 | 192 | PaaY phenylacetic acid degradation protein PaaY. M | 99.71 | |
| KOG1461 | 673 | consensus Translation initiation factor 2B, epsilo | 99.71 | |
| TIGR00965 | 269 | dapD 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate | 99.71 | |
| PRK12461 | 255 | UDP-N-acetylglucosamine acyltransferase; Provision | 99.7 | |
| cd04650 | 154 | LbH_FBP Ferripyochelin Binding Protein (FBP): FBP | 99.7 | |
| PRK14359 | 430 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.7 | |
| cd00710 | 167 | LbH_gamma_CA Gamma carbonic anhydrases (CA): Carbo | 99.69 | |
| TIGR02287 | 192 | PaaY phenylacetic acid degradation protein PaaY. M | 99.69 | |
| PLN02472 | 246 | uncharacterized protein | 99.69 | |
| cd04745 | 155 | LbH_paaY_like paaY-like: This group is composed by | 99.69 | |
| cd03350 | 139 | LbH_THP_succinylT 2,3,4,5-tetrahydropyridine-2,6-d | 99.68 | |
| PLN02472 | 246 | uncharacterized protein | 99.68 | |
| TIGR01173 | 451 | glmU UDP-N-acetylglucosamine diphosphorylase/gluco | 99.68 | |
| PRK13627 | 196 | carnitine operon protein CaiE; Provisional | 99.68 | |
| cd04650 | 154 | LbH_FBP Ferripyochelin Binding Protein (FBP): FBP | 99.68 | |
| PRK05293 | 380 | glgC glucose-1-phosphate adenylyltransferase; Prov | 99.67 | |
| PRK11830 | 272 | dapD 2,3,4,5-tetrahydropyridine-2,6-carboxylate N- | 99.67 | |
| cd00710 | 167 | LbH_gamma_CA Gamma carbonic anhydrases (CA): Carbo | 99.67 | |
| cd04645 | 153 | LbH_gamma_CA_like Gamma carbonic anhydrase-like: T | 99.67 | |
| TIGR03308 | 204 | phn_thr-fam phosphonate metabolim protein, transfe | 99.67 | |
| COG1043 | 260 | LpxA Acyl-[acyl carrier protein] | 99.66 | |
| PRK05289 | 262 | UDP-N-acetylglucosamine acyltransferase; Provision | 99.66 | |
| PRK09451 | 456 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.65 | |
| PRK14358 | 481 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.65 | |
| cd04645 | 153 | LbH_gamma_CA_like Gamma carbonic anhydrase-like: T | 99.65 | |
| TIGR00965 | 269 | dapD 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate | 99.65 | |
| COG1043 | 260 | LpxA Acyl-[acyl carrier protein] | 99.65 | |
| PRK14352 | 482 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.65 | |
| TIGR03570 | 201 | NeuD_NnaD sugar O-acyltransferase, sialic acid O-a | 99.64 | |
| cd03358 | 119 | LbH_WxcM_N_like WcxM-like, Left-handed parallel be | 99.63 | |
| TIGR03532 | 231 | DapD_Ac 2,3,4,5-tetrahydropyridine-2,6-dicarboxyla | 99.63 | |
| PRK14353 | 446 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.63 | |
| cd03360 | 197 | LbH_AT_putative Putative Acyltransferase (AT), Lef | 99.63 | |
| PRK14356 | 456 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.62 | |
| COG0448 | 393 | GlgC ADP-glucose pyrophosphorylase [Carbohydrate t | 99.62 | |
| PRK14360 | 450 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.61 | |
| cd05636 | 163 | LbH_G1P_TT_C_like Putative glucose-1-phosphate thy | 99.61 | |
| TIGR03570 | 201 | NeuD_NnaD sugar O-acyltransferase, sialic acid O-a | 99.61 | |
| cd04649 | 147 | LbH_THP_succinylT_putative Putative 2,3,4,5-tetrah | 99.6 | |
| cd03359 | 161 | LbH_Dynactin_5 Dynactin 5 (or subunit p25); Dynact | 99.6 | |
| cd03360 | 197 | LbH_AT_putative Putative Acyltransferase (AT), Lef | 99.6 | |
| PRK14357 | 448 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.59 | |
| PRK11830 | 272 | dapD 2,3,4,5-tetrahydropyridine-2,6-carboxylate N- | 99.59 | |
| cd04649 | 147 | LbH_THP_succinylT_putative Putative 2,3,4,5-tetrah | 99.58 | |
| cd03358 | 119 | LbH_WxcM_N_like WcxM-like, Left-handed parallel be | 99.58 | |
| PRK14358 | 481 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.58 | |
| COG1207 | 460 | GlmU N-acetylglucosamine-1-phosphate uridyltransfe | 99.57 | |
| TIGR01208 | 353 | rmlA_long glucose-1-phosphate thymidylylransferase | 99.57 | |
| COG1208 | 358 | GCD1 Nucleoside-diphosphate-sugar pyrophosphorylas | 99.57 | |
| PRK14354 | 458 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.56 | |
| PRK10502 | 182 | putative acyl transferase; Provisional | 99.55 | |
| PRK09677 | 192 | putative lipopolysaccharide biosynthesis O-acetyl | 99.54 | |
| PRK14352 | 482 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.54 | |
| cd03353 | 193 | LbH_GlmU_C N-acetyl-glucosamine-1-phosphate uridyl | 99.54 | |
| PRK10502 | 182 | putative acyl transferase; Provisional | 99.53 | |
| PLN02241 | 436 | glucose-1-phosphate adenylyltransferase | 99.53 | |
| PRK14356 | 456 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.53 | |
| PRK14360 | 450 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.53 | |
| PLN02694 | 294 | serine O-acetyltransferase | 99.52 | |
| cd05824 | 80 | LbH_M1P_guanylylT_C Mannose-1-phosphate guanylyltr | 99.52 | |
| COG2171 | 271 | DapD Tetrahydrodipicolinate N-succinyltransferase | 99.52 | |
| PRK00844 | 407 | glgC glucose-1-phosphate adenylyltransferase; Prov | 99.51 | |
| COG1045 | 194 | CysE Serine acetyltransferase [Amino acid transpor | 99.51 | |
| cd03356 | 79 | LbH_G1P_AT_C_like Left-handed parallel beta-Helix | 99.51 | |
| cd03359 | 161 | LbH_Dynactin_5 Dynactin 5 (or subunit p25); Dynact | 99.51 | |
| PRK14355 | 459 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.5 | |
| cd05787 | 79 | LbH_eIF2B_epsilon eIF-2B epsilon subunit, central | 99.5 | |
| cd04652 | 81 | LbH_eIF2B_gamma_C eIF-2B gamma subunit, C-terminal | 99.49 | |
| PRK11132 | 273 | cysE serine acetyltransferase; Provisional | 99.49 | |
| PRK02862 | 429 | glgC glucose-1-phosphate adenylyltransferase; Prov | 99.49 | |
| PRK14354 | 458 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.49 | |
| PRK09527 | 203 | lacA galactoside O-acetyltransferase; Reviewed | 99.48 | |
| cd04652 | 81 | LbH_eIF2B_gamma_C eIF-2B gamma subunit, C-terminal | 99.48 | |
| TIGR01172 | 162 | cysE serine O-acetyltransferase. Cysteine biosynth | 99.48 | |
| TIGR03536 | 341 | DapD_gpp 2,3,4,5-tetrahydropyridine-2,6-dicarboxyl | 99.47 | |
| cd05824 | 80 | LbH_M1P_guanylylT_C Mannose-1-phosphate guanylyltr | 99.47 | |
| TIGR02092 | 369 | glgD glucose-1-phosphate adenylyltransferase, GlgD | 99.46 | |
| cd03356 | 79 | LbH_G1P_AT_C_like Left-handed parallel beta-Helix | 99.46 | |
| TIGR01173 | 451 | glmU UDP-N-acetylglucosamine diphosphorylase/gluco | 99.46 | |
| PRK09527 | 203 | lacA galactoside O-acetyltransferase; Reviewed | 99.46 | |
| PRK09677 | 192 | putative lipopolysaccharide biosynthesis O-acetyl | 99.46 | |
| TIGR03536 | 341 | DapD_gpp 2,3,4,5-tetrahydropyridine-2,6-dicarboxyl | 99.46 | |
| cd03357 | 169 | LbH_MAT_GAT Maltose O-acetyltransferase (MAT) and | 99.46 | |
| PRK10191 | 146 | putative acyl transferase; Provisional | 99.46 | |
| TIGR03535 | 319 | DapD_actino 2,3,4,5-tetrahydropyridine-2,6-dicarbo | 99.45 | |
| PRK14357 | 448 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.45 | |
| cd05635 | 101 | LbH_unknown Uncharacterized proteins, Left-handed | 99.45 | |
| PRK10092 | 183 | maltose O-acetyltransferase; Provisional | 99.44 | |
| cd05787 | 79 | LbH_eIF2B_epsilon eIF-2B epsilon subunit, central | 99.43 | |
| KOG1461 | 673 | consensus Translation initiation factor 2B, epsilo | 99.42 | |
| TIGR03308 | 204 | phn_thr-fam phosphonate metabolim protein, transfe | 99.42 | |
| PLN02357 | 360 | serine acetyltransferase | 99.42 | |
| COG2171 | 271 | DapD Tetrahydrodipicolinate N-succinyltransferase | 99.42 | |
| PLN02739 | 355 | serine acetyltransferase | 99.41 | |
| PRK00725 | 425 | glgC glucose-1-phosphate adenylyltransferase; Prov | 99.41 | |
| KOG1460 | 407 | consensus GDP-mannose pyrophosphorylase [Carbohydr | 99.4 | |
| cd04651 | 104 | LbH_G1P_AT_C Glucose-1-phosphate adenylyltransfera | 99.4 | |
| cd03357 | 169 | LbH_MAT_GAT Maltose O-acetyltransferase (MAT) and | 99.39 | |
| cd03354 | 101 | LbH_SAT Serine acetyltransferase (SAT): SAT cataly | 99.38 | |
| TIGR03535 | 319 | DapD_actino 2,3,4,5-tetrahydropyridine-2,6-dicarbo | 99.37 | |
| TIGR02091 | 361 | glgC glucose-1-phosphate adenylyltransferase. This | 99.37 | |
| KOG1322 | 371 | consensus GDP-mannose pyrophosphorylase/mannose-1- | 99.37 | |
| PRK14359 | 430 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.36 | |
| cd05825 | 107 | LbH_wcaF_like wcaF-like: This group is composed of | 99.34 | |
| cd05825 | 107 | LbH_wcaF_like wcaF-like: This group is composed of | 99.34 | |
| PRK09451 | 456 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.34 | |
| COG1208 | 358 | GCD1 Nucleoside-diphosphate-sugar pyrophosphorylas | 99.31 | |
| PLN02694 | 294 | serine O-acetyltransferase | 99.3 | |
| cd00208 | 78 | LbetaH Left-handed parallel beta-Helix (LbetaH or | 99.3 | |
| cd00208 | 78 | LbetaH Left-handed parallel beta-Helix (LbetaH or | 99.29 | |
| PLN02241 | 436 | glucose-1-phosphate adenylyltransferase | 99.29 | |
| cd04651 | 104 | LbH_G1P_AT_C Glucose-1-phosphate adenylyltransfera | 99.28 | |
| cd04647 | 109 | LbH_MAT_like Maltose O-acyltransferase (MAT)-like: | 99.28 | |
| cd05635 | 101 | LbH_unknown Uncharacterized proteins, Left-handed | 99.28 | |
| PRK10191 | 146 | putative acyl transferase; Provisional | 99.27 | |
| PRK10092 | 183 | maltose O-acetyltransferase; Provisional | 99.26 | |
| cd04647 | 109 | LbH_MAT_like Maltose O-acyltransferase (MAT)-like: | 99.26 | |
| COG0110 | 190 | WbbJ Acetyltransferase (isoleucine patch superfami | 99.25 | |
| TIGR01172 | 162 | cysE serine O-acetyltransferase. Cysteine biosynth | 99.24 | |
| PRK05293 | 380 | glgC glucose-1-phosphate adenylyltransferase; Prov | 99.24 | |
| PRK11132 | 273 | cysE serine acetyltransferase; Provisional | 99.23 | |
| cd03354 | 101 | LbH_SAT Serine acetyltransferase (SAT): SAT cataly | 99.23 | |
| PLN02357 | 360 | serine acetyltransferase | 99.22 | |
| COG0448 | 393 | GlgC ADP-glucose pyrophosphorylase [Carbohydrate t | 99.19 | |
| TIGR01208 | 353 | rmlA_long glucose-1-phosphate thymidylylransferase | 99.17 | |
| COG1045 | 194 | CysE Serine acetyltransferase [Amino acid transpor | 99.17 | |
| PLN02739 | 355 | serine acetyltransferase | 99.17 | |
| KOG3121 | 184 | consensus Dynactin, subunit p25 [Cytoskeleton] | 99.16 | |
| KOG1462 | 433 | consensus Translation initiation factor 2B, gamma | 99.16 | |
| cd03349 | 145 | LbH_XAT Xenobiotic acyltransferase (XAT): The XAT | 99.1 | |
| PRK02862 | 429 | glgC glucose-1-phosphate adenylyltransferase; Prov | 99.09 | |
| KOG1462 | 433 | consensus Translation initiation factor 2B, gamma | 99.07 | |
| KOG4750 | 269 | consensus Serine O-acetyltransferase [Amino acid t | 99.05 | |
| PRK00844 | 407 | glgC glucose-1-phosphate adenylyltransferase; Prov | 99.05 | |
| cd03349 | 145 | LbH_XAT Xenobiotic acyltransferase (XAT): The XAT | 98.96 | |
| TIGR02091 | 361 | glgC glucose-1-phosphate adenylyltransferase. This | 98.95 | |
| COG0110 | 190 | WbbJ Acetyltransferase (isoleucine patch superfami | 98.93 | |
| KOG1460 | 407 | consensus GDP-mannose pyrophosphorylase [Carbohydr | 98.92 | |
| TIGR02092 | 369 | glgD glucose-1-phosphate adenylyltransferase, GlgD | 98.87 | |
| PRK00725 | 425 | glgC glucose-1-phosphate adenylyltransferase; Prov | 98.86 | |
| KOG4750 | 269 | consensus Serine O-acetyltransferase [Amino acid t | 98.85 | |
| KOG1322 | 371 | consensus GDP-mannose pyrophosphorylase/mannose-1- | 98.84 | |
| TIGR02353 | 695 | NRPS_term_dom non-ribosomal peptide synthetase ter | 98.78 | |
| KOG3121 | 184 | consensus Dynactin, subunit p25 [Cytoskeleton] | 98.77 | |
| TIGR02353 | 695 | NRPS_term_dom non-ribosomal peptide synthetase ter | 98.72 | |
| KOG4042 | 190 | consensus Dynactin subunit p27/WS-3, involved in t | 98.59 | |
| KOG4042 | 190 | consensus Dynactin subunit p27/WS-3, involved in t | 98.45 | |
| PF14602 | 34 | Hexapep_2: Hexapeptide repeat of succinyl-transfer | 98.34 | |
| PF00132 | 36 | Hexapep: Bacterial transferase hexapeptide (six re | 98.24 | |
| COG4801 | 277 | Predicted acyltransferase [General function predic | 98.2 | |
| PF00132 | 36 | Hexapep: Bacterial transferase hexapeptide (six re | 98.09 | |
| PF14602 | 34 | Hexapep_2: Hexapeptide repeat of succinyl-transfer | 98.0 | |
| COG4801 | 277 | Predicted acyltransferase [General function predic | 97.55 | |
| PF07959 | 414 | Fucokinase: L-fucokinase; InterPro: IPR012887 In t | 92.03 | |
| PF07959 | 414 | Fucokinase: L-fucokinase; InterPro: IPR012887 In t | 91.51 | |
| PF04519 | 101 | Bactofilin: Polymer-forming cytoskeletal; InterPro | 87.64 |
| >COG1044 LpxD UDP-3-O-[3-hydroxymyristoyl] | Back alignment and domain information |
|---|
Probab=99.91 E-value=1.9e-23 Score=163.10 Aligned_cols=140 Identities=44% Similarity=0.691 Sum_probs=119.7
Q ss_pred ccCCCcEEccceEECCCcEECCCcEEccCcEECCCcEECCCCEECCCCEECCCcEECCCcEEec-eEECCCCEECCCcEE
Q 030076 42 WHNGGGIFHQSACIDSTVLIEVGAIVHSKAVLGANVCIGSGTVVGPAVTIGQSTNIGFNVALSN-CIIGDSCIIHNGVCI 120 (183)
Q Consensus 42 ~~~~~~~i~~~~~i~~~~~i~~~~~i~~~~~ig~~~~I~~~~~I~~~~~Ig~~~~Ig~~~~i~~-~~I~~~~~Ig~~~~i 120 (183)
.+.+...+.+.+.+++++.++++++|++++.||+++.|+++++|++++.||+++.|+.++.|.. +.||++|.|++++.|
T Consensus 101 ~I~~~A~i~~~A~i~~~~~ig~~~vI~~~v~IG~~~~I~~~~vIg~~~~IG~~~~i~~~v~I~~~~~IG~~v~I~~GavI 180 (338)
T COG1044 101 GIHPTAVIDPTATIGKNVSIGPNVVIGAGVVIGENVVIGAGAVIGENVKIGDGTVIHPNVTIYHNVVIGNNVIIHSGAVI 180 (338)
T ss_pred ccCccccccCcCccCCCCccCCCeEECCCCEECCCcEECCCCEECCCcEECCCcEEcCCCEEecCcEECCceEECCCCEE
Confidence 3445556677777777777778888888888888888888888888888888888888888854 999999999999999
Q ss_pred CCCCCceeeccCCccccCCceeceEECCCCEECCCcEEcCCCCCCeEECCCCEECCCCeEee
Q 030076 121 GQDGFGFFVDEHGNMLKKPQLLNARIGNHVEIGANSCIDRGSWRDTVIGDHSKIDNLVQVGF 182 (183)
Q Consensus 121 ~~~~~~~~~~~~~~~~~~~~~~~~~Ig~~~~Ig~~~~v~~g~~~~~~Ig~~~~I~~~~~v~~ 182 (183)
+.+.|+|.....+ ..+..+.+.++|+++|.||++++|+++..++|+|++++.|++.++|+|
T Consensus 181 G~dgFg~a~~~~g-~~Ki~q~g~V~Igd~VeIGanT~Idrga~~dTvIg~~~kIdN~vqIaH 241 (338)
T COG1044 181 GADGFGYAGTAIG-WVKIPQIGRVIIGDDVEIGANTTIDRGALDDTVIGEGVKIDNLVQIGH 241 (338)
T ss_pred ccCccccccccCC-ceEcceeceEEECCceEEcccceeccccccCceecCCcEEcceeEEcc
Confidence 9999999876666 567778889999999999999999999999999999999999988876
|
|
| >TIGR01853 lipid_A_lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase | Back alignment and domain information |
|---|
| >PRK00892 lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd05636 LbH_G1P_TT_C_like Putative glucose-1-phosphate thymidylyltransferase, C-terminal Left-handed parallel beta-Helix (LbH) domain: Proteins in this family show simlarity to glucose-1-phosphate adenylyltransferases in that they contain N-terminal catalytic domains that resemble a dinucleotide-binding Rossmann fold and C-terminal LbH fold domains | Back alignment and domain information |
|---|
| >TIGR03532 DapD_Ac 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase | Back alignment and domain information |
|---|
| >COG1044 LpxD UDP-3-O-[3-hydroxymyristoyl] | Back alignment and domain information |
|---|
| >cd03351 LbH_UDP-GlcNAc_AT UDP-N-acetylglucosamine O-acyltransferase (UDP-GlcNAc acyltransferase): Proteins in this family catalyze the transfer of (R)-3-hydroxymyristic acid from its acyl carrier protein thioester to UDP-GlcNAc | Back alignment and domain information |
|---|
| >PRK05289 UDP-N-acetylglucosamine acyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR01852 lipid_A_lpxA acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase | Back alignment and domain information |
|---|
| >cd03351 LbH_UDP-GlcNAc_AT UDP-N-acetylglucosamine O-acyltransferase (UDP-GlcNAc acyltransferase): Proteins in this family catalyze the transfer of (R)-3-hydroxymyristic acid from its acyl carrier protein thioester to UDP-GlcNAc | Back alignment and domain information |
|---|
| >cd03350 LbH_THP_succinylT 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP) N-succinyltransferase (also called THP succinyltransferase): THDP N-succinyltransferase catalyzes the conversion of tetrahydrodipicolinate and succinyl-CoA to N-succinyltetrahydrodipicolinate and CoA | Back alignment and domain information |
|---|
| >COG0663 PaaY Carbonic anhydrases/acetyltransferases, isoleucine patch superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >cd03353 LbH_GlmU_C N-acetyl-glucosamine-1-phosphate uridyltransferase (GlmU), C-terminal left-handed beta-helix (LbH) acetyltransferase domain: GlmU is also known as UDP-N-acetylglucosamine pyrophosphorylase | Back alignment and domain information |
|---|
| >cd04646 LbH_Dynactin_6 Dynactin 6 (or subunit p27): Dynactin is a major component of the activator complex that stimulates dynein-mediated vesicle transport | Back alignment and domain information |
|---|
| >TIGR01852 lipid_A_lpxA acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase | Back alignment and domain information |
|---|
| >PRK14353 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR01853 lipid_A_lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase | Back alignment and domain information |
|---|
| >PRK13627 carnitine operon protein CaiE; Provisional | Back alignment and domain information |
|---|
| >PLN02296 carbonate dehydratase | Back alignment and domain information |
|---|
| >cd04745 LbH_paaY_like paaY-like: This group is composed by uncharacterized proteins with similarity to the protein product of the E | Back alignment and domain information |
|---|
| >PRK14355 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd03352 LbH_LpxD UDP-3-O-acyl-glucosamine N-acyltransferase (LpxD): The enzyme catalyzes the transfer of 3-hydroxymyristic acid or 3-hydroxy-arachidic acid, depending on the organism, from the acyl carrier protein (ACP) to UDP-3-O-acyl-glucosamine to produce UDP-2,3-diacyl-GlcNAc | Back alignment and domain information |
|---|
| >PRK00892 lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG0663 PaaY Carbonic anhydrases/acetyltransferases, isoleucine patch superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02296 carbonate dehydratase | Back alignment and domain information |
|---|
| >cd04646 LbH_Dynactin_6 Dynactin 6 (or subunit p27): Dynactin is a major component of the activator complex that stimulates dynein-mediated vesicle transport | Back alignment and domain information |
|---|
| >PRK12461 UDP-N-acetylglucosamine acyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd03352 LbH_LpxD UDP-3-O-acyl-glucosamine N-acyltransferase (LpxD): The enzyme catalyzes the transfer of 3-hydroxymyristic acid or 3-hydroxy-arachidic acid, depending on the organism, from the acyl carrier protein (ACP) to UDP-3-O-acyl-glucosamine to produce UDP-2,3-diacyl-GlcNAc | Back alignment and domain information |
|---|
| >COG1207 GlmU N-acetylglucosamine-1-phosphate uridyltransferase (contains nucleotidyltransferase and I-patch acetyltransferase domains) [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >TIGR02287 PaaY phenylacetic acid degradation protein PaaY | Back alignment and domain information |
|---|
| >KOG1461 consensus Translation initiation factor 2B, epsilon subunit (eIF-2Bepsilon/GCD6) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR00965 dapD 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase | Back alignment and domain information |
|---|
| >PRK12461 UDP-N-acetylglucosamine acyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd04650 LbH_FBP Ferripyochelin Binding Protein (FBP): FBP is an outer membrane protein which plays a role in iron acquisition | Back alignment and domain information |
|---|
| >PRK14359 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd00710 LbH_gamma_CA Gamma carbonic anhydrases (CA): Carbonic anhydrases are zinc-containing enzymes that catalyze the reversible hydration of carbon dioxide in a two-step mechanism, involving the nucleophilic attack of a zinc-bound hydroxide ion on carbon dioxide, followed by the regeneration of the active site by ionization of the zinc-bound water molecule and removal of a proton from the active site | Back alignment and domain information |
|---|
| >TIGR02287 PaaY phenylacetic acid degradation protein PaaY | Back alignment and domain information |
|---|
| >PLN02472 uncharacterized protein | Back alignment and domain information |
|---|
| >cd04745 LbH_paaY_like paaY-like: This group is composed by uncharacterized proteins with similarity to the protein product of the E | Back alignment and domain information |
|---|
| >cd03350 LbH_THP_succinylT 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP) N-succinyltransferase (also called THP succinyltransferase): THDP N-succinyltransferase catalyzes the conversion of tetrahydrodipicolinate and succinyl-CoA to N-succinyltetrahydrodipicolinate and CoA | Back alignment and domain information |
|---|
| >PLN02472 uncharacterized protein | Back alignment and domain information |
|---|
| >TIGR01173 glmU UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase | Back alignment and domain information |
|---|
| >PRK13627 carnitine operon protein CaiE; Provisional | Back alignment and domain information |
|---|
| >cd04650 LbH_FBP Ferripyochelin Binding Protein (FBP): FBP is an outer membrane protein which plays a role in iron acquisition | Back alignment and domain information |
|---|
| >PRK05293 glgC glucose-1-phosphate adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK11830 dapD 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd00710 LbH_gamma_CA Gamma carbonic anhydrases (CA): Carbonic anhydrases are zinc-containing enzymes that catalyze the reversible hydration of carbon dioxide in a two-step mechanism, involving the nucleophilic attack of a zinc-bound hydroxide ion on carbon dioxide, followed by the regeneration of the active site by ionization of the zinc-bound water molecule and removal of a proton from the active site | Back alignment and domain information |
|---|
| >cd04645 LbH_gamma_CA_like Gamma carbonic anhydrase-like: This family is composed of gamma carbonic anhydrase (CA), Ferripyochelin Binding Protein (FBP), E | Back alignment and domain information |
|---|
| >TIGR03308 phn_thr-fam phosphonate metabolim protein, transferase hexapeptide repeat family | Back alignment and domain information |
|---|
| >COG1043 LpxA Acyl-[acyl carrier protein] | Back alignment and domain information |
|---|
| >PRK05289 UDP-N-acetylglucosamine acyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK09451 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK14358 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd04645 LbH_gamma_CA_like Gamma carbonic anhydrase-like: This family is composed of gamma carbonic anhydrase (CA), Ferripyochelin Binding Protein (FBP), E | Back alignment and domain information |
|---|
| >TIGR00965 dapD 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase | Back alignment and domain information |
|---|
| >COG1043 LpxA Acyl-[acyl carrier protein] | Back alignment and domain information |
|---|
| >PRK14352 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR03570 NeuD_NnaD sugar O-acyltransferase, sialic acid O-acetyltransferase NeuD family | Back alignment and domain information |
|---|
| >cd03358 LbH_WxcM_N_like WcxM-like, Left-handed parallel beta-Helix (LbH) N-terminal domain: This group is composed of Xanthomonas campestris WcxM and proteins with similarity to the WcxM N-terminal domain | Back alignment and domain information |
|---|
| >TIGR03532 DapD_Ac 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase | Back alignment and domain information |
|---|
| >PRK14353 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd03360 LbH_AT_putative Putative Acyltransferase (AT), Left-handed parallel beta-Helix (LbH) domain; This group is composed of mostly uncharacterized proteins containing an N-terminal helical subdomain followed by a LbH domain | Back alignment and domain information |
|---|
| >PRK14356 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG0448 GlgC ADP-glucose pyrophosphorylase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14360 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd05636 LbH_G1P_TT_C_like Putative glucose-1-phosphate thymidylyltransferase, C-terminal Left-handed parallel beta-Helix (LbH) domain: Proteins in this family show simlarity to glucose-1-phosphate adenylyltransferases in that they contain N-terminal catalytic domains that resemble a dinucleotide-binding Rossmann fold and C-terminal LbH fold domains | Back alignment and domain information |
|---|
| >TIGR03570 NeuD_NnaD sugar O-acyltransferase, sialic acid O-acetyltransferase NeuD family | Back alignment and domain information |
|---|
| >cd04649 LbH_THP_succinylT_putative Putative 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP) N-succinyltransferase (THP succinyltransferase), C-terminal left-handed parallel alpha-helix (LbH) domain: This group is composed of mostly uncharacterized proteins containing an N-terminal domain of unknown function and a C-terminal LbH domain with similarity to THP succinyltransferase LbH | Back alignment and domain information |
|---|
| >cd03359 LbH_Dynactin_5 Dynactin 5 (or subunit p25); Dynactin is a major component of the activator complex that stimulates dynein-mediated vesicle transport | Back alignment and domain information |
|---|
| >cd03360 LbH_AT_putative Putative Acyltransferase (AT), Left-handed parallel beta-Helix (LbH) domain; This group is composed of mostly uncharacterized proteins containing an N-terminal helical subdomain followed by a LbH domain | Back alignment and domain information |
|---|
| >PRK14357 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK11830 dapD 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd04649 LbH_THP_succinylT_putative Putative 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP) N-succinyltransferase (THP succinyltransferase), C-terminal left-handed parallel alpha-helix (LbH) domain: This group is composed of mostly uncharacterized proteins containing an N-terminal domain of unknown function and a C-terminal LbH domain with similarity to THP succinyltransferase LbH | Back alignment and domain information |
|---|
| >cd03358 LbH_WxcM_N_like WcxM-like, Left-handed parallel beta-Helix (LbH) N-terminal domain: This group is composed of Xanthomonas campestris WcxM and proteins with similarity to the WcxM N-terminal domain | Back alignment and domain information |
|---|
| >PRK14358 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG1207 GlmU N-acetylglucosamine-1-phosphate uridyltransferase (contains nucleotidyltransferase and I-patch acetyltransferase domains) [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >TIGR01208 rmlA_long glucose-1-phosphate thymidylylransferase, long form | Back alignment and domain information |
|---|
| >COG1208 GCD1 Nucleoside-diphosphate-sugar pyrophosphorylase involved in lipopolysaccharide biosynthesis/translation initiation factor 2B, gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) [Cell envelope biogenesis, outer membrane / Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK14354 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK10502 putative acyl transferase; Provisional | Back alignment and domain information |
|---|
| >PRK09677 putative lipopolysaccharide biosynthesis O-acetyl transferase WbbJ; Provisional | Back alignment and domain information |
|---|
| >PRK14352 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd03353 LbH_GlmU_C N-acetyl-glucosamine-1-phosphate uridyltransferase (GlmU), C-terminal left-handed beta-helix (LbH) acetyltransferase domain: GlmU is also known as UDP-N-acetylglucosamine pyrophosphorylase | Back alignment and domain information |
|---|
| >PRK10502 putative acyl transferase; Provisional | Back alignment and domain information |
|---|
| >PLN02241 glucose-1-phosphate adenylyltransferase | Back alignment and domain information |
|---|
| >PRK14356 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK14360 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02694 serine O-acetyltransferase | Back alignment and domain information |
|---|
| >cd05824 LbH_M1P_guanylylT_C Mannose-1-phosphate guanylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Mannose-1-phosphate guanylyltransferase is also known as GDP-mannose pyrophosphorylase | Back alignment and domain information |
|---|
| >COG2171 DapD Tetrahydrodipicolinate N-succinyltransferase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK00844 glgC glucose-1-phosphate adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG1045 CysE Serine acetyltransferase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd03356 LbH_G1P_AT_C_like Left-handed parallel beta-Helix (LbH) domain of a group of proteins with similarity to glucose-1-phosphate adenylyltransferase: Included in this family are glucose-1-phosphate adenylyltransferase, mannose-1-phosphate guanylyltransferase, and the eukaryotic translation initiation factor eIF-2B subunits, epsilon and gamma | Back alignment and domain information |
|---|
| >cd03359 LbH_Dynactin_5 Dynactin 5 (or subunit p25); Dynactin is a major component of the activator complex that stimulates dynein-mediated vesicle transport | Back alignment and domain information |
|---|
| >PRK14355 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd05787 LbH_eIF2B_epsilon eIF-2B epsilon subunit, central Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon) | Back alignment and domain information |
|---|
| >cd04652 LbH_eIF2B_gamma_C eIF-2B gamma subunit, C-terminal Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon) | Back alignment and domain information |
|---|
| >PRK11132 cysE serine acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK02862 glgC glucose-1-phosphate adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK14354 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK09527 lacA galactoside O-acetyltransferase; Reviewed | Back alignment and domain information |
|---|
| >cd04652 LbH_eIF2B_gamma_C eIF-2B gamma subunit, C-terminal Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon) | Back alignment and domain information |
|---|
| >TIGR01172 cysE serine O-acetyltransferase | Back alignment and domain information |
|---|
| >TIGR03536 DapD_gpp 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase | Back alignment and domain information |
|---|
| >cd05824 LbH_M1P_guanylylT_C Mannose-1-phosphate guanylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Mannose-1-phosphate guanylyltransferase is also known as GDP-mannose pyrophosphorylase | Back alignment and domain information |
|---|
| >TIGR02092 glgD glucose-1-phosphate adenylyltransferase, GlgD subunit | Back alignment and domain information |
|---|
| >cd03356 LbH_G1P_AT_C_like Left-handed parallel beta-Helix (LbH) domain of a group of proteins with similarity to glucose-1-phosphate adenylyltransferase: Included in this family are glucose-1-phosphate adenylyltransferase, mannose-1-phosphate guanylyltransferase, and the eukaryotic translation initiation factor eIF-2B subunits, epsilon and gamma | Back alignment and domain information |
|---|
| >TIGR01173 glmU UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase | Back alignment and domain information |
|---|
| >PRK09527 lacA galactoside O-acetyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK09677 putative lipopolysaccharide biosynthesis O-acetyl transferase WbbJ; Provisional | Back alignment and domain information |
|---|
| >TIGR03536 DapD_gpp 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase | Back alignment and domain information |
|---|
| >cd03357 LbH_MAT_GAT Maltose O-acetyltransferase (MAT) and Galactoside O-acetyltransferase (GAT): MAT and GAT catalyze the CoA-dependent acetylation of the 6-hydroxyl group of their respective sugar substrates | Back alignment and domain information |
|---|
| >PRK10191 putative acyl transferase; Provisional | Back alignment and domain information |
|---|
| >TIGR03535 DapD_actino 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase | Back alignment and domain information |
|---|
| >PRK14357 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd05635 LbH_unknown Uncharacterized proteins, Left-handed parallel beta-Helix (LbH) domain: Members in this group are uncharacterized bacterial proteins containing a LbH domain with multiple turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X) | Back alignment and domain information |
|---|
| >PRK10092 maltose O-acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd05787 LbH_eIF2B_epsilon eIF-2B epsilon subunit, central Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon) | Back alignment and domain information |
|---|
| >KOG1461 consensus Translation initiation factor 2B, epsilon subunit (eIF-2Bepsilon/GCD6) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR03308 phn_thr-fam phosphonate metabolim protein, transferase hexapeptide repeat family | Back alignment and domain information |
|---|
| >PLN02357 serine acetyltransferase | Back alignment and domain information |
|---|
| >COG2171 DapD Tetrahydrodipicolinate N-succinyltransferase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02739 serine acetyltransferase | Back alignment and domain information |
|---|
| >PRK00725 glgC glucose-1-phosphate adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG1460 consensus GDP-mannose pyrophosphorylase [Carbohydrate transport and metabolism; Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd04651 LbH_G1P_AT_C Glucose-1-phosphate adenylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Glucose-1-phosphate adenylyltransferase is also known as ADP-glucose synthase or ADP-glucose pyrophosphorylase | Back alignment and domain information |
|---|
| >cd03357 LbH_MAT_GAT Maltose O-acetyltransferase (MAT) and Galactoside O-acetyltransferase (GAT): MAT and GAT catalyze the CoA-dependent acetylation of the 6-hydroxyl group of their respective sugar substrates | Back alignment and domain information |
|---|
| >cd03354 LbH_SAT Serine acetyltransferase (SAT): SAT catalyzes the CoA-dependent acetylation of the side chain hydroxyl group of L-serine to form O-acetylserine, as the first step of a two-step biosynthetic pathway in bacteria and plants leading to the formation of L-cysteine | Back alignment and domain information |
|---|
| >TIGR03535 DapD_actino 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase | Back alignment and domain information |
|---|
| >TIGR02091 glgC glucose-1-phosphate adenylyltransferase | Back alignment and domain information |
|---|
| >KOG1322 consensus GDP-mannose pyrophosphorylase/mannose-1-phosphate guanylyltransferase [Cell wall/membrane/envelope biogenesis] | Back alignment and domain information |
|---|
| >PRK14359 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd05825 LbH_wcaF_like wcaF-like: This group is composed of the protein product of the E | Back alignment and domain information |
|---|
| >cd05825 LbH_wcaF_like wcaF-like: This group is composed of the protein product of the E | Back alignment and domain information |
|---|
| >PRK09451 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG1208 GCD1 Nucleoside-diphosphate-sugar pyrophosphorylase involved in lipopolysaccharide biosynthesis/translation initiation factor 2B, gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) [Cell envelope biogenesis, outer membrane / Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PLN02694 serine O-acetyltransferase | Back alignment and domain information |
|---|
| >cd00208 LbetaH Left-handed parallel beta-Helix (LbetaH or LbH) domain: The alignment contains 5 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X) | Back alignment and domain information |
|---|
| >cd00208 LbetaH Left-handed parallel beta-Helix (LbetaH or LbH) domain: The alignment contains 5 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X) | Back alignment and domain information |
|---|
| >PLN02241 glucose-1-phosphate adenylyltransferase | Back alignment and domain information |
|---|
| >cd04651 LbH_G1P_AT_C Glucose-1-phosphate adenylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Glucose-1-phosphate adenylyltransferase is also known as ADP-glucose synthase or ADP-glucose pyrophosphorylase | Back alignment and domain information |
|---|
| >cd04647 LbH_MAT_like Maltose O-acyltransferase (MAT)-like: This family is composed of maltose O-acetyltransferase, galactoside O-acetyltransferase (GAT), xenobiotic acyltransferase (XAT) and similar proteins | Back alignment and domain information |
|---|
| >cd05635 LbH_unknown Uncharacterized proteins, Left-handed parallel beta-Helix (LbH) domain: Members in this group are uncharacterized bacterial proteins containing a LbH domain with multiple turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X) | Back alignment and domain information |
|---|
| >PRK10191 putative acyl transferase; Provisional | Back alignment and domain information |
|---|
| >PRK10092 maltose O-acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd04647 LbH_MAT_like Maltose O-acyltransferase (MAT)-like: This family is composed of maltose O-acetyltransferase, galactoside O-acetyltransferase (GAT), xenobiotic acyltransferase (XAT) and similar proteins | Back alignment and domain information |
|---|
| >COG0110 WbbJ Acetyltransferase (isoleucine patch superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01172 cysE serine O-acetyltransferase | Back alignment and domain information |
|---|
| >PRK05293 glgC glucose-1-phosphate adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK11132 cysE serine acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd03354 LbH_SAT Serine acetyltransferase (SAT): SAT catalyzes the CoA-dependent acetylation of the side chain hydroxyl group of L-serine to form O-acetylserine, as the first step of a two-step biosynthetic pathway in bacteria and plants leading to the formation of L-cysteine | Back alignment and domain information |
|---|
| >PLN02357 serine acetyltransferase | Back alignment and domain information |
|---|
| >COG0448 GlgC ADP-glucose pyrophosphorylase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01208 rmlA_long glucose-1-phosphate thymidylylransferase, long form | Back alignment and domain information |
|---|
| >COG1045 CysE Serine acetyltransferase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02739 serine acetyltransferase | Back alignment and domain information |
|---|
| >KOG3121 consensus Dynactin, subunit p25 [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG1462 consensus Translation initiation factor 2B, gamma subunit (eIF-2Bgamma/GCD1) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >cd03349 LbH_XAT Xenobiotic acyltransferase (XAT): The XAT class of hexapeptide acyltransferases is composed of a large number of microbial enzymes that catalyze the CoA-dependent acetylation of a variety of hydroxyl-bearing acceptors such as chloramphenicol and streptogramin, among others | Back alignment and domain information |
|---|
| >PRK02862 glgC glucose-1-phosphate adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG1462 consensus Translation initiation factor 2B, gamma subunit (eIF-2Bgamma/GCD1) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG4750 consensus Serine O-acetyltransferase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK00844 glgC glucose-1-phosphate adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd03349 LbH_XAT Xenobiotic acyltransferase (XAT): The XAT class of hexapeptide acyltransferases is composed of a large number of microbial enzymes that catalyze the CoA-dependent acetylation of a variety of hydroxyl-bearing acceptors such as chloramphenicol and streptogramin, among others | Back alignment and domain information |
|---|
| >TIGR02091 glgC glucose-1-phosphate adenylyltransferase | Back alignment and domain information |
|---|
| >COG0110 WbbJ Acetyltransferase (isoleucine patch superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1460 consensus GDP-mannose pyrophosphorylase [Carbohydrate transport and metabolism; Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR02092 glgD glucose-1-phosphate adenylyltransferase, GlgD subunit | Back alignment and domain information |
|---|
| >PRK00725 glgC glucose-1-phosphate adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG4750 consensus Serine O-acetyltransferase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1322 consensus GDP-mannose pyrophosphorylase/mannose-1-phosphate guanylyltransferase [Cell wall/membrane/envelope biogenesis] | Back alignment and domain information |
|---|
| >TIGR02353 NRPS_term_dom non-ribosomal peptide synthetase terminal domain of unknown function | Back alignment and domain information |
|---|
| >KOG3121 consensus Dynactin, subunit p25 [Cytoskeleton] | Back alignment and domain information |
|---|
| >TIGR02353 NRPS_term_dom non-ribosomal peptide synthetase terminal domain of unknown function | Back alignment and domain information |
|---|
| >KOG4042 consensus Dynactin subunit p27/WS-3, involved in transport of organelles along microtubules [Intracellular trafficking, secretion, and vesicular transport; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG4042 consensus Dynactin subunit p27/WS-3, involved in transport of organelles along microtubules [Intracellular trafficking, secretion, and vesicular transport; Cytoskeleton] | Back alignment and domain information |
|---|
| >PF14602 Hexapep_2: Hexapeptide repeat of succinyl-transferase; PDB: 2P2O_B 2IC7_B 2RIJ_A 3FSY_B 3FSX_D 3CJ8_A 1QRE_A 1QRG_A 1THJ_B 1QRM_A | Back alignment and domain information |
|---|
| >PF00132 Hexapep: Bacterial transferase hexapeptide (six repeats); InterPro: IPR001451 A variety of bacterial transferases contain a repeat structure composed of tandem repeats of a [LIV]-G-X(4) hexapeptide, which, in the tertiary structure of LpxA (UDP N-acetylglucosamine acyltransferase) [], has been shown to form a left-handed parallel beta helix | Back alignment and domain information |
|---|
| >COG4801 Predicted acyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PF00132 Hexapep: Bacterial transferase hexapeptide (six repeats); InterPro: IPR001451 A variety of bacterial transferases contain a repeat structure composed of tandem repeats of a [LIV]-G-X(4) hexapeptide, which, in the tertiary structure of LpxA (UDP N-acetylglucosamine acyltransferase) [], has been shown to form a left-handed parallel beta helix | Back alignment and domain information |
|---|
| >PF14602 Hexapep_2: Hexapeptide repeat of succinyl-transferase; PDB: 2P2O_B 2IC7_B 2RIJ_A 3FSY_B 3FSX_D 3CJ8_A 1QRE_A 1QRG_A 1THJ_B 1QRM_A | Back alignment and domain information |
|---|
| >COG4801 Predicted acyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PF07959 Fucokinase: L-fucokinase; InterPro: IPR012887 In the salvage pathway of GDP-L-fucose, free cytosolic fucose is phosphorylated by L-fucokinase to form L-fucose-L-phosphate, which is then further converted to GDP-L-fucose in the reaction catalysed by GDP-L-fucose pyrophosphorylase [] | Back alignment and domain information |
|---|
| >PF07959 Fucokinase: L-fucokinase; InterPro: IPR012887 In the salvage pathway of GDP-L-fucose, free cytosolic fucose is phosphorylated by L-fucokinase to form L-fucose-L-phosphate, which is then further converted to GDP-L-fucose in the reaction catalysed by GDP-L-fucose pyrophosphorylase [] | Back alignment and domain information |
|---|
| >PF04519 Bactofilin: Polymer-forming cytoskeletal; InterPro: IPR007607 This family contains several uncharacterised hypothetical proteins | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 183 | ||||
| 3eh0_A | 341 | Crystal Structure Of Lpxd From Escherichia Coli Len | 1e-17 | ||
| 2iu8_A | 374 | Chlamydia Trachomatis Lpxd With 25mm Udpglcnac (Com | 2e-16 | ||
| 3pmo_A | 372 | The Structure Of Lpxd From Pseudomonas Aeruginosa A | 1e-14 | ||
| 4e75_A | 357 | Structure Of Lpxd From Acinetobacter Baumannii At 2 | 7e-12 | ||
| 3t57_A | 305 | Activity And Crystal Structure Of Arabidopsis Udp-N | 1e-05 |
| >pdb|3EH0|A Chain A, Crystal Structure Of Lpxd From Escherichia Coli Length = 341 | Back alignment and structure |
|
| >pdb|2IU8|A Chain A, Chlamydia Trachomatis Lpxd With 25mm Udpglcnac (Complex I) Length = 374 | Back alignment and structure |
| >pdb|3PMO|A Chain A, The Structure Of Lpxd From Pseudomonas Aeruginosa At 1.3 A Resolution Length = 372 | Back alignment and structure |
| >pdb|4E75|A Chain A, Structure Of Lpxd From Acinetobacter Baumannii At 2.85a Resolution (p21 Form) Length = 357 | Back alignment and structure |
| >pdb|3T57|A Chain A, Activity And Crystal Structure Of Arabidopsis Udp-N-Acetylglucosamine Acyltransferase Length = 305 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 183 | |||
| 2iu8_A | 374 | LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-a | 1e-49 | |
| 3pmo_A | 372 | UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr; | 2e-48 | |
| 3eh0_A | 341 | UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltr | 3e-48 | |
| 3fs8_A | 273 | QDTC; acetyltransferase, natural product, deoxysug | 8e-24 | |
| 3fs8_A | 273 | QDTC; acetyltransferase, natural product, deoxysug | 2e-10 | |
| 4eqy_A | 283 | Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam | 2e-12 | |
| 2qia_A | 262 | UDP-N-acetylglucosamine acyltransferase; LEFT-hand | 2e-12 | |
| 2qia_A | 262 | UDP-N-acetylglucosamine acyltransferase; LEFT-hand | 6e-04 | |
| 3hsq_A | 259 | Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosam | 1e-11 | |
| 3hsq_A | 259 | Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosam | 9e-05 | |
| 3r0s_A | 266 | Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam | 2e-11 | |
| 1j2z_A | 270 | Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam | 2e-11 | |
| 1j2z_A | 270 | Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam | 1e-04 | |
| 3t57_A | 305 | UDP-N-acetylglucosamine O-acyltransferase domain- | 6e-11 | |
| 2ggo_A | 401 | 401AA long hypothetical glucose-1-phosphate thymid | 4e-10 | |
| 2ggo_A | 401 | 401AA long hypothetical glucose-1-phosphate thymid | 1e-07 | |
| 2ggo_A | 401 | 401AA long hypothetical glucose-1-phosphate thymid | 3e-07 | |
| 3r8y_A | 240 | 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- ac | 7e-10 | |
| 4ea9_A | 220 | Perosamine N-acetyltransferase; beta helix, acetyl | 4e-09 | |
| 4ea9_A | 220 | Perosamine N-acetyltransferase; beta helix, acetyl | 6e-06 | |
| 3brk_X | 420 | Glucose-1-phosphate adenylyltransferase; ADP-gluco | 6e-09 | |
| 3mqg_A | 192 | Lipopolysaccharides biosynthesis acetyltransferas; | 1e-08 | |
| 3mqg_A | 192 | Lipopolysaccharides biosynthesis acetyltransferas; | 4e-08 | |
| 3vbi_A | 205 | ANTD, galactoside O-acetyltransferase; anthrose, a | 2e-08 | |
| 3bfp_A | 194 | Acetyltransferase; LEFT-handed beta helix, COA bin | 5e-08 | |
| 3bfp_A | 194 | Acetyltransferase; LEFT-handed beta helix, COA bin | 4e-05 | |
| 1hm9_A | 468 | GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltr | 9e-07 | |
| 3st8_A | 501 | Bifunctional protein GLMU; acetyltransferase, pyro | 1e-06 | |
| 2v0h_A | 456 | Bifunctional protein GLMU; cell WALL, magnesium, c | 2e-06 | |
| 4fce_A | 459 | Bifunctional protein GLMU; GLMU. csgid, niaid, str | 4e-06 | |
| 3c8v_A | 496 | Putative acetyltransferase; YP_390128.1, structura | 7e-06 | |
| 3c8v_A | 496 | Putative acetyltransferase; YP_390128.1, structura | 3e-05 | |
| 3f1x_A | 310 | Serine acetyltransferase; NESG X-RAY BVR62 A6KZB9 | 7e-05 | |
| 3kwd_A | 213 | Carbon dioxide concentrating mechanism protein; LE | 7e-05 | |
| 3q1x_A | 313 | Serine acetyltransferase; cysteine biosynthesis, L | 1e-04 | |
| 2pig_A | 334 | Putative transferase; SCR6, NESG, YDCK, structural | 5e-04 | |
| 1yp2_A | 451 | Glucose-1-phosphate adenylyltransferase small subu | 7e-04 |
| >2iu8_A LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; UDP-3- O-acyl-glucosamine N-acyltransferase, lipid A biosynthesis; HET: PLM UD1; 2.2A {Chlamydia trachomatis} PDB: 2iu9_A* 2iua_A* Length = 374 | Back alignment and structure |
|---|
Score = 163 bits (415), Expect = 1e-49
Identities = 52/133 (39%), Positives = 72/133 (54%), Gaps = 1/133 (0%)
Query: 50 HQSACIDSTVLIEVGAIVHSKAVLGANVCIGSGTVVGPAVTIGQSTNIGFNVAL-SNCII 108
H +A I+ V IE A+V A +G+ IGSG+V+G T+G+ + I V + I
Sbjct: 134 HPTAIIEDHVCIEPYAVVCQHAHVGSACHIGSGSVIGAYSTVGEHSYIHPRVVIRERVSI 193
Query: 109 GDSCIIHNGVCIGQDGFGFFVDEHGNMLKKPQLLNARIGNHVEIGANSCIDRGSWRDTVI 168
G II G IG GFG+ G L I + VEIGAN+ IDRG ++ +V+
Sbjct: 194 GKRVIIQPGAVIGSCGFGYVTSAFGQHKHLKHLGKVIIEDDVEIGANTTIDRGRFKHSVV 253
Query: 169 GDHSKIDNLVQVG 181
+ SKIDNLVQ+
Sbjct: 254 REGSKIDNLVQIA 266
|
| >3pmo_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr; lipid A biosynthesis pathway, transferase; 1.30A {Pseudomonas aeruginosa} Length = 372 | Back alignment and structure |
|---|
| >3eh0_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltransferase; LPXD, LEFT-handed parallel beta helix, acyl carrier protein, antibiotic resistance; 2.60A {Escherichia coli} Length = 341 | Back alignment and structure |
|---|
| >3fs8_A QDTC; acetyltransferase, natural product, deoxysugar; HET: ACO; 1.70A {Thermoanaerobacteriumthermosaccharolyticum} PDB: 3fsb_A* 3fsc_A* Length = 273 | Back alignment and structure |
|---|
| >3fs8_A QDTC; acetyltransferase, natural product, deoxysugar; HET: ACO; 1.70A {Thermoanaerobacteriumthermosaccharolyticum} PDB: 3fsb_A* 3fsc_A* Length = 273 | Back alignment and structure |
|---|
| >4eqy_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; ssgcid, beta helix, structural genomics, seattle structural center for infectious disease, transferase; 1.80A {Burkholderia thailandensis} Length = 283 | Back alignment and structure |
|---|
| >2qia_A UDP-N-acetylglucosamine acyltransferase; LEFT-handed parallel beta helix; HET: U20; 1.74A {Escherichia coli K12} SCOP: b.81.1.1 PDB: 1lxa_A 2jf3_A* 2aq9_A* 2qiv_X* 2jf2_A Length = 262 | Back alignment and structure |
|---|
| >2qia_A UDP-N-acetylglucosamine acyltransferase; LEFT-handed parallel beta helix; HET: U20; 1.74A {Escherichia coli K12} SCOP: b.81.1.1 PDB: 1lxa_A 2jf3_A* 2aq9_A* 2qiv_X* 2jf2_A Length = 262 | Back alignment and structure |
|---|
| >3hsq_A Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosamine O-acyltransferase; L.interrogans LPXA, LPXA, LPXA acyltransferase; 2.10A {Leptospira interrogans} PDB: 3i3a_A* 3i3x_A* Length = 259 | Back alignment and structure |
|---|
| >3hsq_A Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosamine O-acyltransferase; L.interrogans LPXA, LPXA, LPXA acyltransferase; 2.10A {Leptospira interrogans} PDB: 3i3a_A* 3i3x_A* Length = 259 | Back alignment and structure |
|---|
| >3r0s_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; structural genomics; 2.30A {Campylobacter jejuni subsp} Length = 266 | Back alignment and structure |
|---|
| >1j2z_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; UDP-N-acetylglucosamine acyltransferase, LPXA, LEFT-handed B structure; HET: SOG TLA; 2.10A {Helicobacter pylori} SCOP: b.81.1.1 Length = 270 | Back alignment and structure |
|---|
| >1j2z_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; UDP-N-acetylglucosamine acyltransferase, LPXA, LEFT-handed B structure; HET: SOG TLA; 2.10A {Helicobacter pylori} SCOP: b.81.1.1 Length = 270 | Back alignment and structure |
|---|
| >3t57_A UDP-N-acetylglucosamine O-acyltransferase domain- protein; LEFT-handed parallel beta helix, lipid A biosynthesis, lipid synthesis; 2.10A {Arabidopsis thaliana} Length = 305 | Back alignment and structure |
|---|
| >2ggo_A 401AA long hypothetical glucose-1-phosphate thymidylyltransferase; beta barrel; 1.80A {Sulfolobus tokodaii} PDB: 2ggq_A* Length = 401 | Back alignment and structure |
|---|
| >2ggo_A 401AA long hypothetical glucose-1-phosphate thymidylyltransferase; beta barrel; 1.80A {Sulfolobus tokodaii} PDB: 2ggq_A* Length = 401 | Back alignment and structure |
|---|
| >2ggo_A 401AA long hypothetical glucose-1-phosphate thymidylyltransferase; beta barrel; 1.80A {Sulfolobus tokodaii} PDB: 2ggq_A* Length = 401 | Back alignment and structure |
|---|
| >3r8y_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- acetyltransferase; structural genomics, csgid; 1.70A {Bacillus anthracis} PDB: 3cj8_A* Length = 240 | Back alignment and structure |
|---|
| >4ea9_A Perosamine N-acetyltransferase; beta helix, acetyl coenzyme A, GDP-perosa transferase; HET: JBT; 0.90A {Caulobacter vibrioides} PDB: 4ea8_A* 4ea7_A* 4eaa_A* 4eab_A* Length = 220 | Back alignment and structure |
|---|
| >4ea9_A Perosamine N-acetyltransferase; beta helix, acetyl coenzyme A, GDP-perosa transferase; HET: JBT; 0.90A {Caulobacter vibrioides} PDB: 4ea8_A* 4ea7_A* 4eaa_A* 4eab_A* Length = 220 | Back alignment and structure |
|---|
| >3brk_X Glucose-1-phosphate adenylyltransferase; ADP-glucose pyrophosphorylase, allostery, kinetics, structure-function relationships; 2.10A {Agrobacterium tumefaciens} Length = 420 | Back alignment and structure |
|---|
| >3mqg_A Lipopolysaccharides biosynthesis acetyltransferas; beta helix, acetyl transferase, transferase; HET: ACO U5P UDP PE4; 1.43A {Bordetella petrii} PDB: 3mqh_A* Length = 192 | Back alignment and structure |
|---|
| >3mqg_A Lipopolysaccharides biosynthesis acetyltransferas; beta helix, acetyl transferase, transferase; HET: ACO U5P UDP PE4; 1.43A {Bordetella petrii} PDB: 3mqh_A* Length = 192 | Back alignment and structure |
|---|
| >3vbi_A ANTD, galactoside O-acetyltransferase; anthrose, acylated sugar, LEFT-handed beta helix, sugar N-AC transferase; HET: COA 0FX; 1.80A {Bacillus cereus} PDB: 3vbj_A* 3vbm_A* 3vbk_A* 3vbp_A* 3vbl_A* 3vbn_A* Length = 205 | Back alignment and structure |
|---|
| >3bfp_A Acetyltransferase; LEFT-handed beta helix, COA binding protein, N-glycan biosynthesis, bacillosamine, structural genomics, MKBSGI; HET: FLC; 1.75A {Campylobacter jejuni} SCOP: b.81.1.8 PDB: 2vhe_A* 3bsw_A* 3bss_A* 3bsy_A* 2npo_A Length = 194 | Back alignment and structure |
|---|
| >3bfp_A Acetyltransferase; LEFT-handed beta helix, COA binding protein, N-glycan biosynthesis, bacillosamine, structural genomics, MKBSGI; HET: FLC; 1.75A {Campylobacter jejuni} SCOP: b.81.1.8 PDB: 2vhe_A* 3bsw_A* 3bss_A* 3bsy_A* 2npo_A Length = 194 | Back alignment and structure |
|---|
| >1hm9_A GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltransfe; acetyltransferase, bifunctional, drug design; HET: ACO UD1; 1.75A {Streptococcus pneumoniae} SCOP: b.81.1.4 c.68.1.5 PDB: 1hm8_A* 1hm0_A* 4ac3_A* 4aaw_A* 1g97_A* 1g95_A* Length = 468 | Back alignment and structure |
|---|
| >3st8_A Bifunctional protein GLMU; acetyltransferase, pyrophosphorylase, rossmann fold, LEFT-handed-beta-helix, cell shape; HET: COA GP1 UD1; 1.98A {Mycobacterium tuberculosis} PDB: 3spt_A* 3foq_A 3dk5_A 3d8v_A 3d98_A* 3dj4_A 2qkx_A* Length = 501 | Back alignment and structure |
|---|
| >2v0h_A Bifunctional protein GLMU; cell WALL, magnesium, cell shape, transferase, peptidoglycan synthesis, associative mechanism; 1.79A {Haemophilus influenzae} PDB: 2v0i_A* 2v0j_A* 2v0k_A* 2v0l_A* 2vd4_A* 2w0v_A* 2w0w_A* 3twd_A* Length = 456 | Back alignment and structure |
|---|
| >4fce_A Bifunctional protein GLMU; GLMU. csgid, niaid, structural genomics, national institute allergy and infectious diseases; HET: GP1; 1.96A {Yersinia pseudotuberculosis} PDB: 3fww_A 1hv9_A* 2oi5_A* 2oi6_A* 2oi7_A* 1fxj_A* 1fwy_A* Length = 459 | Back alignment and structure |
|---|
| >3c8v_A Putative acetyltransferase; YP_390128.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; 2.28A {Desulfovibrio desulfuricans subsp} Length = 496 | Back alignment and structure |
|---|
| >3c8v_A Putative acetyltransferase; YP_390128.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; 2.28A {Desulfovibrio desulfuricans subsp} Length = 496 | Back alignment and structure |
|---|
| >3f1x_A Serine acetyltransferase; NESG X-RAY BVR62 A6KZB9 A6KZB9_BACV8, structural genomics, P protein structure initiative; 2.00A {Bacteroides vulgatus atcc 8482} Length = 310 | Back alignment and structure |
|---|
| >3kwd_A Carbon dioxide concentrating mechanism protein; LEFT-handed beta helix, gamma carbonic anhydrase, disulfide dependent activity; 1.10A {Thermosynechococcus elongatus} PDB: 3kwe_A 3kwc_A Length = 213 | Back alignment and structure |
|---|
| >3q1x_A Serine acetyltransferase; cysteine biosynthesis, LEFT handed helix, OASS; 1.59A {Entamoeba histolytica} PDB: 3p47_A 3p1b_A Length = 313 | Back alignment and structure |
|---|
| >2pig_A Putative transferase; SCR6, NESG, YDCK, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.38A {Salmonella paratyphi} PDB: 2f9c_A Length = 334 | Back alignment and structure |
|---|
| >1yp2_A Glucose-1-phosphate adenylyltransferase small subunit; ADP-glucose synthase, ADP-glucose pyrophosphorylase, agpase B; HET: PMB; 2.11A {Solanum tuberosum} SCOP: b.81.1.4 c.68.1.6 PDB: 1yp3_A* 1yp4_A* Length = 451 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 183 | |||
| 4e79_A | 357 | UDP-3-O-acylglucosamine N-acyltransferase; lipopol | 99.89 | |
| 3pmo_A | 372 | UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr; | 99.88 | |
| 3eh0_A | 341 | UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltr | 99.87 | |
| 3mqg_A | 192 | Lipopolysaccharides biosynthesis acetyltransferas; | 99.86 | |
| 2iu8_A | 374 | LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-a | 99.85 | |
| 2ggo_A | 401 | 401AA long hypothetical glucose-1-phosphate thymid | 99.82 | |
| 3ixc_A | 191 | Hexapeptide transferase family protein; niaid, ssg | 99.82 | |
| 3vbi_A | 205 | ANTD, galactoside O-acetyltransferase; anthrose, a | 99.81 | |
| 3tv0_A | 194 | Dynactin subunit 6; LEFT-handed beta-helix, ARP11, | 99.81 | |
| 3r0s_A | 266 | Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam | 99.8 | |
| 4eqy_A | 283 | Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam | 99.8 | |
| 3r8y_A | 240 | 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- ac | 99.8 | |
| 1xhd_A | 173 | Putative acetyltransferase/acyltransferase; struct | 99.8 | |
| 4e6u_A | 265 | Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam | 99.8 | |
| 3r3r_A | 187 | Ferripyochelin binding protein; structural genomic | 99.79 | |
| 1j2z_A | 270 | Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam | 99.79 | |
| 3gos_A | 276 | 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- su | 99.79 | |
| 3t57_A | 305 | UDP-N-acetylglucosamine O-acyltransferase domain- | 99.78 | |
| 4e79_A | 357 | UDP-3-O-acylglucosamine N-acyltransferase; lipopol | 99.78 | |
| 3pmo_A | 372 | UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr; | 99.78 | |
| 3eg4_A | 304 | 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- su | 99.78 | |
| 2qia_A | 262 | UDP-N-acetylglucosamine acyltransferase; LEFT-hand | 99.78 | |
| 3r1w_A | 189 | Carbonic anhydrase; beta-helix, lyase; 1.73A {Unid | 99.77 | |
| 1v3w_A | 173 | Ferripyochelin binding protein; beta-helix, carbon | 99.77 | |
| 2iu8_A | 374 | LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-a | 99.77 | |
| 1v3w_A | 173 | Ferripyochelin binding protein; beta-helix, carbon | 99.77 | |
| 3eh0_A | 341 | UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltr | 99.77 | |
| 1qre_A | 247 | Carbonic anhydrase; beta-helix, lyase; 1.46A {Meth | 99.77 | |
| 1xhd_A | 173 | Putative acetyltransferase/acyltransferase; struct | 99.76 | |
| 3kwd_A | 213 | Carbon dioxide concentrating mechanism protein; LE | 99.76 | |
| 3hsq_A | 259 | Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosam | 99.76 | |
| 3fs8_A | 273 | QDTC; acetyltransferase, natural product, deoxysug | 99.76 | |
| 3tk8_A | 316 | 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- su | 99.76 | |
| 3tv0_A | 194 | Dynactin subunit 6; LEFT-handed beta-helix, ARP11, | 99.76 | |
| 3kwd_A | 213 | Carbon dioxide concentrating mechanism protein; LE | 99.76 | |
| 3hsq_A | 259 | Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosam | 99.75 | |
| 4fce_A | 459 | Bifunctional protein GLMU; GLMU. csgid, niaid, str | 99.75 | |
| 3r3r_A | 187 | Ferripyochelin binding protein; structural genomic | 99.75 | |
| 3r1w_A | 189 | Carbonic anhydrase; beta-helix, lyase; 1.73A {Unid | 99.75 | |
| 3fs8_A | 273 | QDTC; acetyltransferase, natural product, deoxysug | 99.75 | |
| 3ixc_A | 191 | Hexapeptide transferase family protein; niaid, ssg | 99.75 | |
| 2v0h_A | 456 | Bifunctional protein GLMU; cell WALL, magnesium, c | 99.74 | |
| 3t57_A | 305 | UDP-N-acetylglucosamine O-acyltransferase domain- | 99.74 | |
| 4ea9_A | 220 | Perosamine N-acetyltransferase; beta helix, acetyl | 99.74 | |
| 1hm9_A | 468 | GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltr | 99.74 | |
| 3bfp_A | 194 | Acetyltransferase; LEFT-handed beta helix, COA bin | 99.73 | |
| 3mqg_A | 192 | Lipopolysaccharides biosynthesis acetyltransferas; | 99.73 | |
| 4ea9_A | 220 | Perosamine N-acetyltransferase; beta helix, acetyl | 99.72 | |
| 3bfp_A | 194 | Acetyltransferase; LEFT-handed beta helix, COA bin | 99.72 | |
| 3jqy_B | 252 | NEUO, polysialic acid O-acetyltransferase; LEFT-ha | 99.72 | |
| 2qia_A | 262 | UDP-N-acetylglucosamine acyltransferase; LEFT-hand | 99.72 | |
| 4eqy_A | 283 | Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam | 99.71 | |
| 1qre_A | 247 | Carbonic anhydrase; beta-helix, lyase; 1.46A {Meth | 99.71 | |
| 3r5d_A | 347 | Tetrahydrodipicolinate N-succinyletransferase; 1.8 | 99.71 | |
| 2wlg_A | 215 | Polysialic acid O-acetyltransferase; enzyme, LEFT- | 99.71 | |
| 3r8y_A | 240 | 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- ac | 99.7 | |
| 3gos_A | 276 | 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- su | 99.7 | |
| 1yp2_A | 451 | Glucose-1-phosphate adenylyltransferase small subu | 99.7 | |
| 3vbi_A | 205 | ANTD, galactoside O-acetyltransferase; anthrose, a | 99.7 | |
| 4e6u_A | 265 | Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam | 99.69 | |
| 3fsy_A | 332 | Tetrahydrodipicolinate N-succinyltransferase; beta | 99.69 | |
| 1j2z_A | 270 | Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam | 99.69 | |
| 3c8v_A | 496 | Putative acetyltransferase; YP_390128.1, structura | 99.69 | |
| 3r0s_A | 266 | Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam | 99.69 | |
| 3eg4_A | 304 | 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- su | 99.68 | |
| 3q1x_A | 313 | Serine acetyltransferase; cysteine biosynthesis, L | 99.67 | |
| 3tk8_A | 316 | 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- su | 99.67 | |
| 2pig_A | 334 | Putative transferase; SCR6, NESG, YDCK, structural | 99.65 | |
| 3nz2_A | 195 | Hexapeptide-repeat containing-acetyltransferase; s | 99.65 | |
| 3srt_A | 188 | Maltose O-acetyltransferase; structural genomics, | 99.63 | |
| 3hjj_A | 190 | Maltose O-acetyltransferase; LEFT-handed beta-heli | 99.62 | |
| 2ggo_A | 401 | 401AA long hypothetical glucose-1-phosphate thymid | 99.62 | |
| 3fsy_A | 332 | Tetrahydrodipicolinate N-succinyltransferase; beta | 99.61 | |
| 3ftt_A | 199 | Putative acetyltransferase sacol2570; galactoside | 99.6 | |
| 3r5d_A | 347 | Tetrahydrodipicolinate N-succinyletransferase; 1.8 | 99.6 | |
| 3mc4_A | 287 | WW/RSP5/WWP domain:bacterial transferase hexapept | 99.6 | |
| 3st8_A | 501 | Bifunctional protein GLMU; acetyltransferase, pyro | 99.59 | |
| 3c8v_A | 496 | Putative acetyltransferase; YP_390128.1, structura | 99.59 | |
| 3nz2_A | 195 | Hexapeptide-repeat containing-acetyltransferase; s | 99.59 | |
| 3ftt_A | 199 | Putative acetyltransferase sacol2570; galactoside | 99.58 | |
| 3jqy_B | 252 | NEUO, polysialic acid O-acetyltransferase; LEFT-ha | 99.58 | |
| 3brk_X | 420 | Glucose-1-phosphate adenylyltransferase; ADP-gluco | 99.58 | |
| 3hjj_A | 190 | Maltose O-acetyltransferase; LEFT-handed beta-heli | 99.57 | |
| 3st8_A | 501 | Bifunctional protein GLMU; acetyltransferase, pyro | 99.56 | |
| 3f1x_A | 310 | Serine acetyltransferase; NESG X-RAY BVR62 A6KZB9 | 99.56 | |
| 3srt_A | 188 | Maltose O-acetyltransferase; structural genomics, | 99.56 | |
| 3q1x_A | 313 | Serine acetyltransferase; cysteine biosynthesis, L | 99.55 | |
| 4hur_A | 220 | Virginiamycin A acetyltransferase; structural geno | 99.54 | |
| 1krr_A | 203 | Galactoside O-acetyltransferase; LEFT-handed paral | 99.54 | |
| 4hur_A | 220 | Virginiamycin A acetyltransferase; structural geno | 99.54 | |
| 2p2o_A | 185 | Maltose transacetylase; GK1921, GKA001001921.1, ge | 99.53 | |
| 2p2o_A | 185 | Maltose transacetylase; GK1921, GKA001001921.1, ge | 99.53 | |
| 1ocx_A | 182 | Maltose O-acetyltransferase; LEFT-handed parallel | 99.52 | |
| 1ssq_A | 267 | SAT, serine acetyltransferase; LEFT-handed paralle | 99.52 | |
| 1ocx_A | 182 | Maltose O-acetyltransferase; LEFT-handed parallel | 99.52 | |
| 2wlg_A | 215 | Polysialic acid O-acetyltransferase; enzyme, LEFT- | 99.51 | |
| 1t3d_A | 289 | SAT, serine acetyltransferase; LEFT-handed-beta-he | 99.5 | |
| 2rij_A | 387 | Putative 2,3,4,5-tetrahydropyridine-2-carboxylate | 99.49 | |
| 2v0h_A | 456 | Bifunctional protein GLMU; cell WALL, magnesium, c | 99.48 | |
| 2pig_A | 334 | Putative transferase; SCR6, NESG, YDCK, structural | 99.47 | |
| 3f1x_A | 310 | Serine acetyltransferase; NESG X-RAY BVR62 A6KZB9 | 99.46 | |
| 4fce_A | 459 | Bifunctional protein GLMU; GLMU. csgid, niaid, str | 99.46 | |
| 1hm9_A | 468 | GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltr | 99.45 | |
| 1yp2_A | 451 | Glucose-1-phosphate adenylyltransferase small subu | 99.45 | |
| 2rij_A | 387 | Putative 2,3,4,5-tetrahydropyridine-2-carboxylate | 99.44 | |
| 1krr_A | 203 | Galactoside O-acetyltransferase; LEFT-handed paral | 99.43 | |
| 4e8l_A | 219 | Virginiamycin A acetyltransferase; structural geno | 99.4 | |
| 3mc4_A | 287 | WW/RSP5/WWP domain:bacterial transferase hexapept | 99.38 | |
| 3eev_A | 212 | Chloramphenicol acetyltransferase; beta-helix, str | 99.38 | |
| 1ssq_A | 267 | SAT, serine acetyltransferase; LEFT-handed paralle | 99.35 | |
| 1mr7_A | 209 | Streptogramin A acetyltransferase; LEFT-handed par | 99.32 | |
| 3brk_X | 420 | Glucose-1-phosphate adenylyltransferase; ADP-gluco | 99.31 | |
| 1t3d_A | 289 | SAT, serine acetyltransferase; LEFT-handed-beta-he | 99.31 | |
| 3eev_A | 212 | Chloramphenicol acetyltransferase; beta-helix, str | 99.26 | |
| 1xat_A | 212 | Xenobiotic acetyltransferase; chloramphenicol, LEF | 99.17 | |
| 1mr7_A | 209 | Streptogramin A acetyltransferase; LEFT-handed par | 99.15 | |
| 4e8l_A | 219 | Virginiamycin A acetyltransferase; structural geno | 99.14 | |
| 1xat_A | 212 | Xenobiotic acetyltransferase; chloramphenicol, LEF | 99.03 |
| >4e79_A UDP-3-O-acylglucosamine N-acyltransferase; lipopolysaccaride synthesis; 2.66A {Acinetobacter baumannii} PDB: 4e75_A | Back alignment and structure |
|---|
Probab=99.89 E-value=1.4e-21 Score=157.16 Aligned_cols=136 Identities=35% Similarity=0.501 Sum_probs=98.2
Q ss_pred CCcEEccceEECCCcEECCCcEEccCcEECCCcEECCCCEECCCCEECCCcEECCCcEE-eceEECCCCEECCCcEECCC
Q 030076 45 GGGIFHQSACIDSTVLIEVGAIVHSKAVLGANVCIGSGTVVGPAVTIGQSTNIGFNVAL-SNCIIGDSCIIHNGVCIGQD 123 (183)
Q Consensus 45 ~~~~i~~~~~i~~~~~i~~~~~i~~~~~ig~~~~I~~~~~I~~~~~Ig~~~~Ig~~~~i-~~~~I~~~~~Ig~~~~i~~~ 123 (183)
....+++++.|++++.|++++.|++++.||++|.|+++++|+++++||++|.|++++.| .+++|+++|.|++++.|+.+
T Consensus 107 p~a~I~~~a~ig~~~~I~~~~~I~~~~~IG~~~~I~~~~~I~~~~~IG~~~~I~~~~~I~~~~~IG~~~~I~~g~~Ig~d 186 (357)
T 4e79_A 107 STARIHPSAVISETAYIGHYVVIGENCVVGDNTVIQSHTKLDDNVEVGKDCFIDSYVTITGSSKLRDRVRIHSSTVIGGE 186 (357)
T ss_dssp TTCEECTTCEECTTCEECTTCEECTTCEECTTCEECTTCEECTTCEECSSCEECTTCEECTTCEECSSCEECTTCEESCC
T ss_pred CCCEECCCCEECCCCEECCCCEECCCCEECCCCEECCCCEECCCCEECCCCEECCCcEEecccEEEeEeeccCCeEECcc
Confidence 34444445555555555555555556666666666666666666777777777777777 67889999999999999998
Q ss_pred CCceeeccCCccccCCceeceEECCCCEECCCcEEcCCCCCCeEECCCCEECCCCeEe
Q 030076 124 GFGFFVDEHGNMLKKPQLLNARIGNHVEIGANSCIDRGSWRDTVIGDHSKIDNLVQVG 181 (183)
Q Consensus 124 ~~~~~~~~~~~~~~~~~~~~~~Ig~~~~Ig~~~~v~~g~~~~~~Ig~~~~I~~~~~v~ 181 (183)
+|+|.. .++...+..+.+.++||++|+|+++++|.++..++++||+++.|+++++|+
T Consensus 187 gfg~~~-~~g~~~~i~~~g~v~IGd~v~IG~~~~I~~g~~~~t~Ig~~~~I~~~v~I~ 243 (357)
T 4e79_A 187 GFGFAP-YQGKWHRIAQLGSVLIGNDVRIGSNCSIDRGALDNTILEDGVIIDNLVQIA 243 (357)
T ss_dssp CCCEEE-ETTEEEECCCCCCEEECTTCEECTTCEECCCSSSCEEECTTCEECTTCEEC
T ss_pred cCcccc-cCCceeeccccCcEEEcCCcEEccccEEeccccCCccccCCcccCCCcccC
Confidence 888876 345455566777899999999999999987766667777776666666654
|
| >3pmo_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr; lipid A biosynthesis pathway, transferase; 1.30A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3eh0_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltransferase; LPXD, LEFT-handed parallel beta helix, acyl carrier protein, antibiotic resistance; 2.60A {Escherichia coli} | Back alignment and structure |
|---|
| >3mqg_A Lipopolysaccharides biosynthesis acetyltransferas; beta helix, acetyl transferase, transferase; HET: ACO U5P UDP PE4; 1.43A {Bordetella petrii} PDB: 3mqh_A* | Back alignment and structure |
|---|
| >2iu8_A LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; UDP-3- O-acyl-glucosamine N-acyltransferase, lipid A biosynthesis; HET: PLM UD1; 2.2A {Chlamydia trachomatis} PDB: 2iu9_A* 2iua_A* | Back alignment and structure |
|---|
| >2ggo_A 401AA long hypothetical glucose-1-phosphate thymidylyltransferase; beta barrel; 1.80A {Sulfolobus tokodaii} PDB: 2ggq_A* | Back alignment and structure |
|---|
| >3ixc_A Hexapeptide transferase family protein; niaid, ssgcid, seattle structural genomics center for infect disease, GRAM-negative bacteria; 1.61A {Anaplasma phagocytophilum} | Back alignment and structure |
|---|
| >3vbi_A ANTD, galactoside O-acetyltransferase; anthrose, acylated sugar, LEFT-handed beta helix, sugar N-AC transferase; HET: COA 0FX; 1.80A {Bacillus cereus} PDB: 3vbj_A* 3vbm_A* 3vbk_A* 3vbp_A* 3vbl_A* 3vbn_A* | Back alignment and structure |
|---|
| >3tv0_A Dynactin subunit 6; LEFT-handed beta-helix, ARP11, cytosol, structural; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >3r0s_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; structural genomics; 2.30A {Campylobacter jejuni subsp} SCOP: b.81.1.0 | Back alignment and structure |
|---|
| >4eqy_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; ssgcid, beta helix, structural genomics, seattle structural center for infectious disease, transferase; 1.80A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >3r8y_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- acetyltransferase; structural genomics, csgid; 1.70A {Bacillus anthracis} PDB: 3cj8_A* | Back alignment and structure |
|---|
| >1xhd_A Putative acetyltransferase/acyltransferase; structural genomics, protein structure initiative, medwest C structural genomics, MCSG; 1.90A {Bacillus cereus} SCOP: b.81.1.5 PDB: 3vnp_A 2eg0_A | Back alignment and structure |
|---|
| >4e6u_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; lipopolysaccaride synthesis; 1.41A {Acinetobacter baumannii} PDB: 4e6t_A* | Back alignment and structure |
|---|
| >3r3r_A Ferripyochelin binding protein; structural genomics, csgid, center for structural genomics O infectious diseases, all beta protein; 1.20A {Salmonella enterica subsp} SCOP: b.81.1.0 PDB: 3tio_A 3tis_A | Back alignment and structure |
|---|
| >1j2z_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; UDP-N-acetylglucosamine acyltransferase, LPXA, LEFT-handed B structure; HET: SOG TLA; 2.10A {Helicobacter pylori} SCOP: b.81.1.1 | Back alignment and structure |
|---|
| >3gos_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succinyltransferase; 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransfera acyltransferase; 1.80A {Yersinia pestis} SCOP: b.81.1.2 PDB: 1kgq_A* 1kgt_A* 2tdt_A* 3tdt_A* 3bxy_A 1tdt_A | Back alignment and structure |
|---|
| >3t57_A UDP-N-acetylglucosamine O-acyltransferase domain- protein; LEFT-handed parallel beta helix, lipid A biosynthesis, lipid synthesis; 2.10A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >4e79_A UDP-3-O-acylglucosamine N-acyltransferase; lipopolysaccaride synthesis; 2.66A {Acinetobacter baumannii} PDB: 4e75_A | Back alignment and structure |
|---|
| >3pmo_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr; lipid A biosynthesis pathway, transferase; 1.30A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3eg4_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succinyltransferase; ssgcid, beta helix, acyltransferase, amino-acid biosynthesis, cytoplasm; 1.87A {Brucella suis} | Back alignment and structure |
|---|
| >2qia_A UDP-N-acetylglucosamine acyltransferase; LEFT-handed parallel beta helix; HET: U20; 1.74A {Escherichia coli K12} SCOP: b.81.1.1 PDB: 1lxa_A 2jf3_A* 2aq9_A* 2qiv_X* 2jf2_A | Back alignment and structure |
|---|
| >3r1w_A Carbonic anhydrase; beta-helix, lyase; 1.73A {Unidentified} | Back alignment and structure |
|---|
| >1v3w_A Ferripyochelin binding protein; beta-helix, carbonic anhydrase, structural genomics, riken S genomics/proteomics initiative, RSGI, lyase; 1.50A {Pyrococcus horikoshii} SCOP: b.81.1.5 PDB: 1v67_A 2fko_A | Back alignment and structure |
|---|
| >2iu8_A LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; UDP-3- O-acyl-glucosamine N-acyltransferase, lipid A biosynthesis; HET: PLM UD1; 2.2A {Chlamydia trachomatis} PDB: 2iu9_A* 2iua_A* | Back alignment and structure |
|---|
| >1v3w_A Ferripyochelin binding protein; beta-helix, carbonic anhydrase, structural genomics, riken S genomics/proteomics initiative, RSGI, lyase; 1.50A {Pyrococcus horikoshii} SCOP: b.81.1.5 PDB: 1v67_A 2fko_A | Back alignment and structure |
|---|
| >3eh0_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltransferase; LPXD, LEFT-handed parallel beta helix, acyl carrier protein, antibiotic resistance; 2.60A {Escherichia coli} | Back alignment and structure |
|---|
| >1qre_A Carbonic anhydrase; beta-helix, lyase; 1.46A {Methanosarcina thermophila} SCOP: b.81.1.5 PDB: 1qq0_A 1qrf_A 1qrg_A 1qrm_A 1qrl_A 1thj_A 3otm_A 3ow5_A 3ou9_A 3otz_A 3oup_A | Back alignment and structure |
|---|
| >1xhd_A Putative acetyltransferase/acyltransferase; structural genomics, protein structure initiative, medwest C structural genomics, MCSG; 1.90A {Bacillus cereus} SCOP: b.81.1.5 PDB: 3vnp_A 2eg0_A | Back alignment and structure |
|---|
| >3kwd_A Carbon dioxide concentrating mechanism protein; LEFT-handed beta helix, gamma carbonic anhydrase, disulfide dependent activity; 1.10A {Thermosynechococcus elongatus} PDB: 3kwe_A 3kwc_A | Back alignment and structure |
|---|
| >3hsq_A Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosamine O-acyltransferase; L.interrogans LPXA, LPXA, LPXA acyltransferase; 2.10A {Leptospira interrogans} SCOP: b.81.1.0 PDB: 3i3a_A* 3i3x_A* | Back alignment and structure |
|---|
| >3fs8_A QDTC; acetyltransferase, natural product, deoxysugar; HET: ACO; 1.70A {Thermoanaerobacteriumthermosaccharolyticum} PDB: 3fsb_A* 3fsc_A* | Back alignment and structure |
|---|
| >3tk8_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succinyltransferase; ssgcid; 1.80A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >3tv0_A Dynactin subunit 6; LEFT-handed beta-helix, ARP11, cytosol, structural; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >3kwd_A Carbon dioxide concentrating mechanism protein; LEFT-handed beta helix, gamma carbonic anhydrase, disulfide dependent activity; 1.10A {Thermosynechococcus elongatus} PDB: 3kwe_A 3kwc_A | Back alignment and structure |
|---|
| >3hsq_A Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosamine O-acyltransferase; L.interrogans LPXA, LPXA, LPXA acyltransferase; 2.10A {Leptospira interrogans} SCOP: b.81.1.0 PDB: 3i3a_A* 3i3x_A* | Back alignment and structure |
|---|
| >4fce_A Bifunctional protein GLMU; GLMU. csgid, niaid, structural genomics, national institute allergy and infectious diseases; HET: GP1; 1.96A {Yersinia pseudotuberculosis} PDB: 3fww_A 1hv9_A* 2oi5_A* 2oi6_A* 2oi7_A* 1fxj_A* 1fwy_A* | Back alignment and structure |
|---|
| >3r3r_A Ferripyochelin binding protein; structural genomics, csgid, center for structural genomics O infectious diseases, all beta protein; 1.20A {Salmonella enterica subsp} SCOP: b.81.1.0 PDB: 3tio_A 3tis_A | Back alignment and structure |
|---|
| >3r1w_A Carbonic anhydrase; beta-helix, lyase; 1.73A {Unidentified} | Back alignment and structure |
|---|
| >3fs8_A QDTC; acetyltransferase, natural product, deoxysugar; HET: ACO; 1.70A {Thermoanaerobacteriumthermosaccharolyticum} PDB: 3fsb_A* 3fsc_A* | Back alignment and structure |
|---|
| >3ixc_A Hexapeptide transferase family protein; niaid, ssgcid, seattle structural genomics center for infect disease, GRAM-negative bacteria; 1.61A {Anaplasma phagocytophilum} | Back alignment and structure |
|---|
| >2v0h_A Bifunctional protein GLMU; cell WALL, magnesium, cell shape, transferase, peptidoglycan synthesis, associative mechanism; 1.79A {Haemophilus influenzae} PDB: 2v0i_A* 2v0j_A* 2v0k_A* 2v0l_A* 2vd4_A* 2w0v_A* 2w0w_A* 3twd_A* | Back alignment and structure |
|---|
| >3t57_A UDP-N-acetylglucosamine O-acyltransferase domain- protein; LEFT-handed parallel beta helix, lipid A biosynthesis, lipid synthesis; 2.10A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >4ea9_A Perosamine N-acetyltransferase; beta helix, acetyl coenzyme A, GDP-perosa transferase; HET: JBT; 0.90A {Caulobacter vibrioides} PDB: 4ea8_A* 4ea7_A* 4eaa_A* 4eab_A* | Back alignment and structure |
|---|
| >1hm9_A GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltransfe; acetyltransferase, bifunctional, drug design; HET: ACO UD1; 1.75A {Streptococcus pneumoniae} SCOP: b.81.1.4 c.68.1.5 PDB: 1hm8_A* 1hm0_A* 4ac3_A* 4aaw_A* 1g97_A* 1g95_A* | Back alignment and structure |
|---|
| >3bfp_A Acetyltransferase; LEFT-handed beta helix, COA binding protein, N-glycan biosynthesis, bacillosamine, structural genomics, MKBSGI; HET: FLC; 1.75A {Campylobacter jejuni} SCOP: b.81.1.8 PDB: 2vhe_A* 3bsw_A* 3bss_A* 3bsy_A* 2npo_A | Back alignment and structure |
|---|
| >3mqg_A Lipopolysaccharides biosynthesis acetyltransferas; beta helix, acetyl transferase, transferase; HET: ACO U5P UDP PE4; 1.43A {Bordetella petrii} PDB: 3mqh_A* | Back alignment and structure |
|---|
| >4ea9_A Perosamine N-acetyltransferase; beta helix, acetyl coenzyme A, GDP-perosa transferase; HET: JBT; 0.90A {Caulobacter vibrioides} PDB: 4ea8_A* 4ea7_A* 4eaa_A* 4eab_A* | Back alignment and structure |
|---|
| >3bfp_A Acetyltransferase; LEFT-handed beta helix, COA binding protein, N-glycan biosynthesis, bacillosamine, structural genomics, MKBSGI; HET: FLC; 1.75A {Campylobacter jejuni} SCOP: b.81.1.8 PDB: 2vhe_A* 3bsw_A* 3bss_A* 3bsy_A* 2npo_A | Back alignment and structure |
|---|
| >3jqy_B NEUO, polysialic acid O-acetyltransferase; LEFT-handed beta-helix polysia; HET: PEG; 1.70A {Escherichia coli} | Back alignment and structure |
|---|
| >2qia_A UDP-N-acetylglucosamine acyltransferase; LEFT-handed parallel beta helix; HET: U20; 1.74A {Escherichia coli K12} SCOP: b.81.1.1 PDB: 1lxa_A 2jf3_A* 2aq9_A* 2qiv_X* 2jf2_A | Back alignment and structure |
|---|
| >4eqy_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; ssgcid, beta helix, structural genomics, seattle structural center for infectious disease, transferase; 1.80A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >1qre_A Carbonic anhydrase; beta-helix, lyase; 1.46A {Methanosarcina thermophila} SCOP: b.81.1.5 PDB: 1qq0_A 1qrf_A 1qrg_A 1qrm_A 1qrl_A 1thj_A 3otm_A 3ow5_A 3ou9_A 3otz_A 3oup_A | Back alignment and structure |
|---|
| >3r5d_A Tetrahydrodipicolinate N-succinyletransferase; 1.80A {Pseudomonas aeruginosa} PDB: 3r5b_A* 3r5c_A* 3r5a_A | Back alignment and structure |
|---|
| >2wlg_A Polysialic acid O-acetyltransferase; enzyme, LEFT-handed beta HEL; HET: SOP; 1.90A {Neisseria meningitidis serogroup Y} PDB: 2wld_A 2wle_A* 2wlf_A* 2wlc_A* | Back alignment and structure |
|---|
| >3r8y_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- acetyltransferase; structural genomics, csgid; 1.70A {Bacillus anthracis} PDB: 3cj8_A* | Back alignment and structure |
|---|
| >3gos_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succinyltransferase; 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransfera acyltransferase; 1.80A {Yersinia pestis} SCOP: b.81.1.2 PDB: 1kgq_A* 1kgt_A* 2tdt_A* 3tdt_A* 3bxy_A 1tdt_A | Back alignment and structure |
|---|
| >1yp2_A Glucose-1-phosphate adenylyltransferase small subunit; ADP-glucose synthase, ADP-glucose pyrophosphorylase, agpase B; HET: PMB; 2.11A {Solanum tuberosum} SCOP: b.81.1.4 c.68.1.6 PDB: 1yp3_A* 1yp4_A* | Back alignment and structure |
|---|
| >3vbi_A ANTD, galactoside O-acetyltransferase; anthrose, acylated sugar, LEFT-handed beta helix, sugar N-AC transferase; HET: COA 0FX; 1.80A {Bacillus cereus} PDB: 3vbj_A* 3vbm_A* 3vbk_A* 3vbp_A* 3vbl_A* 3vbn_A* | Back alignment and structure |
|---|
| >4e6u_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; lipopolysaccaride synthesis; 1.41A {Acinetobacter baumannii} PDB: 4e6t_A* | Back alignment and structure |
|---|
| >3fsy_A Tetrahydrodipicolinate N-succinyltransferase; beta helix, L beta H domain, acyltransferase; HET: SCA; 1.97A {Mycobacterium tuberculosis} PDB: 3fsx_A* | Back alignment and structure |
|---|
| >1j2z_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; UDP-N-acetylglucosamine acyltransferase, LPXA, LEFT-handed B structure; HET: SOG TLA; 2.10A {Helicobacter pylori} SCOP: b.81.1.1 | Back alignment and structure |
|---|
| >3c8v_A Putative acetyltransferase; YP_390128.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; 2.28A {Desulfovibrio desulfuricans subsp} | Back alignment and structure |
|---|
| >3r0s_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; structural genomics; 2.30A {Campylobacter jejuni subsp} SCOP: b.81.1.0 | Back alignment and structure |
|---|
| >3eg4_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succinyltransferase; ssgcid, beta helix, acyltransferase, amino-acid biosynthesis, cytoplasm; 1.87A {Brucella suis} | Back alignment and structure |
|---|
| >3q1x_A Serine acetyltransferase; cysteine biosynthesis, LEFT handed helix, OASS; 1.59A {Entamoeba histolytica} PDB: 3p47_A 3p1b_A | Back alignment and structure |
|---|
| >3tk8_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succinyltransferase; ssgcid; 1.80A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >2pig_A Putative transferase; SCR6, NESG, YDCK, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.38A {Salmonella paratyphi} PDB: 2f9c_A | Back alignment and structure |
|---|
| >3nz2_A Hexapeptide-repeat containing-acetyltransferase; structural genomics, center for structural genomics of infec diseases, csgid; HET: ACO; 2.35A {Vibrio cholerae o1 biovar eltor} SCOP: b.81.1.0 PDB: 3ect_A* | Back alignment and structure |
|---|
| >3srt_A Maltose O-acetyltransferase; structural genomics, the center structural genomics of infectious diseases, csgid; 2.50A {Clostridium difficile} PDB: 4ebh_A* | Back alignment and structure |
|---|
| >3hjj_A Maltose O-acetyltransferase; LEFT-handed beta-helix, acyltransferase, struct genomics; 2.15A {Bacillus anthracis} SCOP: b.81.1.0 PDB: 3igj_A* | Back alignment and structure |
|---|
| >2ggo_A 401AA long hypothetical glucose-1-phosphate thymidylyltransferase; beta barrel; 1.80A {Sulfolobus tokodaii} PDB: 2ggq_A* | Back alignment and structure |
|---|
| >3fsy_A Tetrahydrodipicolinate N-succinyltransferase; beta helix, L beta H domain, acyltransferase; HET: SCA; 1.97A {Mycobacterium tuberculosis} PDB: 3fsx_A* | Back alignment and structure |
|---|
| >3ftt_A Putative acetyltransferase sacol2570; galactoside O-acetyltransferase, enzyme, structural genomics, acyltransferase; 1.60A {Staphylococcus aureus subsp} PDB: 3v4e_A* 4dcl_A 4egg_A | Back alignment and structure |
|---|
| >3r5d_A Tetrahydrodipicolinate N-succinyletransferase; 1.80A {Pseudomonas aeruginosa} PDB: 3r5b_A* 3r5c_A* 3r5a_A | Back alignment and structure |
|---|
| >3mc4_A WW/RSP5/WWP domain:bacterial transferase hexapept repeat:serine O-acetyltransferase...; ssgcid, structural genomics; 1.95A {Brucella melitensis biovar abortus} | Back alignment and structure |
|---|
| >3st8_A Bifunctional protein GLMU; acetyltransferase, pyrophosphorylase, rossmann fold, LEFT-handed-beta-helix, cell shape; HET: COA GP1 UD1; 1.98A {Mycobacterium tuberculosis} PDB: 3spt_A* 3foq_A 3dk5_A 3d8v_A 3d98_A* 3dj4_A 2qkx_A* | Back alignment and structure |
|---|
| >3c8v_A Putative acetyltransferase; YP_390128.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; 2.28A {Desulfovibrio desulfuricans subsp} | Back alignment and structure |
|---|
| >3nz2_A Hexapeptide-repeat containing-acetyltransferase; structural genomics, center for structural genomics of infec diseases, csgid; HET: ACO; 2.35A {Vibrio cholerae o1 biovar eltor} SCOP: b.81.1.0 PDB: 3ect_A* | Back alignment and structure |
|---|
| >3ftt_A Putative acetyltransferase sacol2570; galactoside O-acetyltransferase, enzyme, structural genomics, acyltransferase; 1.60A {Staphylococcus aureus subsp} PDB: 3v4e_A* 4dcl_A 4egg_A | Back alignment and structure |
|---|
| >3jqy_B NEUO, polysialic acid O-acetyltransferase; LEFT-handed beta-helix polysia; HET: PEG; 1.70A {Escherichia coli} | Back alignment and structure |
|---|
| >3brk_X Glucose-1-phosphate adenylyltransferase; ADP-glucose pyrophosphorylase, allostery, kinetics, structure-function relationships; 2.10A {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >3hjj_A Maltose O-acetyltransferase; LEFT-handed beta-helix, acyltransferase, struct genomics; 2.15A {Bacillus anthracis} SCOP: b.81.1.0 PDB: 3igj_A* | Back alignment and structure |
|---|
| >3st8_A Bifunctional protein GLMU; acetyltransferase, pyrophosphorylase, rossmann fold, LEFT-handed-beta-helix, cell shape; HET: COA GP1 UD1; 1.98A {Mycobacterium tuberculosis} PDB: 3spt_A* 3foq_A 3dk5_A 3d8v_A 3d98_A* 3dj4_A 2qkx_A* | Back alignment and structure |
|---|
| >3f1x_A Serine acetyltransferase; NESG X-RAY BVR62 A6KZB9 A6KZB9_BACV8, structural genomics, P protein structure initiative; 2.00A {Bacteroides vulgatus atcc 8482} | Back alignment and structure |
|---|
| >3srt_A Maltose O-acetyltransferase; structural genomics, the center structural genomics of infectious diseases, csgid; 2.50A {Clostridium difficile} PDB: 4ebh_A* | Back alignment and structure |
|---|
| >3q1x_A Serine acetyltransferase; cysteine biosynthesis, LEFT handed helix, OASS; 1.59A {Entamoeba histolytica} PDB: 3p47_A 3p1b_A | Back alignment and structure |
|---|
| >4hur_A Virginiamycin A acetyltransferase; structural genomics, antibiotic resistance, center for struc genomics of infectious diseases (csgid); HET: ACO; 2.15A {Staphylococcus aureus} PDB: 4hus_A* 4e8l_A | Back alignment and structure |
|---|
| >1krr_A Galactoside O-acetyltransferase; LEFT-handed parallel beta helix; HET: ACO; 2.50A {Escherichia coli} SCOP: b.81.1.3 PDB: 1kqa_A* 1kru_A* 1krv_A* | Back alignment and structure |
|---|
| >4hur_A Virginiamycin A acetyltransferase; structural genomics, antibiotic resistance, center for struc genomics of infectious diseases (csgid); HET: ACO; 2.15A {Staphylococcus aureus} PDB: 4hus_A* 4e8l_A | Back alignment and structure |
|---|
| >2p2o_A Maltose transacetylase; GK1921, GKA001001921.1, geobacillus kaustophilus structural genomics, PSI; 1.74A {Geobacillus kaustophilus} PDB: 2ic7_A | Back alignment and structure |
|---|
| >2p2o_A Maltose transacetylase; GK1921, GKA001001921.1, geobacillus kaustophilus structural genomics, PSI; 1.74A {Geobacillus kaustophilus} PDB: 2ic7_A | Back alignment and structure |
|---|
| >1ocx_A Maltose O-acetyltransferase; LEFT-handed parallel beta-helix; 2.15A {Escherichia coli} SCOP: b.81.1.3 | Back alignment and structure |
|---|
| >1ssq_A SAT, serine acetyltransferase; LEFT-handed parallel beta helix; 1.85A {Haemophilus influenzae} SCOP: b.81.1.6 PDB: 1sst_A* 1s80_A 1ssm_A 3gvd_A* | Back alignment and structure |
|---|
| >1ocx_A Maltose O-acetyltransferase; LEFT-handed parallel beta-helix; 2.15A {Escherichia coli} SCOP: b.81.1.3 | Back alignment and structure |
|---|
| >2wlg_A Polysialic acid O-acetyltransferase; enzyme, LEFT-handed beta HEL; HET: SOP; 1.90A {Neisseria meningitidis serogroup Y} PDB: 2wld_A 2wle_A* 2wlf_A* 2wlc_A* | Back alignment and structure |
|---|
| >1t3d_A SAT, serine acetyltransferase; LEFT-handed-beta-helix, dimer of trimers; 2.20A {Escherichia coli} SCOP: b.81.1.6 | Back alignment and structure |
|---|
| >2rij_A Putative 2,3,4,5-tetrahydropyridine-2-carboxylate succinyltransferase; structural genomics, joint center for structural genomics; HET: MSE CIT; 1.90A {Campylobacter jejuni} | Back alignment and structure |
|---|
| >2v0h_A Bifunctional protein GLMU; cell WALL, magnesium, cell shape, transferase, peptidoglycan synthesis, associative mechanism; 1.79A {Haemophilus influenzae} PDB: 2v0i_A* 2v0j_A* 2v0k_A* 2v0l_A* 2vd4_A* 2w0v_A* 2w0w_A* 3twd_A* | Back alignment and structure |
|---|
| >2pig_A Putative transferase; SCR6, NESG, YDCK, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.38A {Salmonella paratyphi} PDB: 2f9c_A | Back alignment and structure |
|---|
| >3f1x_A Serine acetyltransferase; NESG X-RAY BVR62 A6KZB9 A6KZB9_BACV8, structural genomics, P protein structure initiative; 2.00A {Bacteroides vulgatus atcc 8482} | Back alignment and structure |
|---|
| >4fce_A Bifunctional protein GLMU; GLMU. csgid, niaid, structural genomics, national institute allergy and infectious diseases; HET: GP1; 1.96A {Yersinia pseudotuberculosis} PDB: 3fww_A 1hv9_A* 2oi5_A* 2oi6_A* 2oi7_A* 1fxj_A* 1fwy_A* | Back alignment and structure |
|---|
| >1hm9_A GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltransfe; acetyltransferase, bifunctional, drug design; HET: ACO UD1; 1.75A {Streptococcus pneumoniae} SCOP: b.81.1.4 c.68.1.5 PDB: 1hm8_A* 1hm0_A* 4ac3_A* 4aaw_A* 1g97_A* 1g95_A* | Back alignment and structure |
|---|
| >1yp2_A Glucose-1-phosphate adenylyltransferase small subunit; ADP-glucose synthase, ADP-glucose pyrophosphorylase, agpase B; HET: PMB; 2.11A {Solanum tuberosum} SCOP: b.81.1.4 c.68.1.6 PDB: 1yp3_A* 1yp4_A* | Back alignment and structure |
|---|
| >2rij_A Putative 2,3,4,5-tetrahydropyridine-2-carboxylate succinyltransferase; structural genomics, joint center for structural genomics; HET: MSE CIT; 1.90A {Campylobacter jejuni} | Back alignment and structure |
|---|
| >1krr_A Galactoside O-acetyltransferase; LEFT-handed parallel beta helix; HET: ACO; 2.50A {Escherichia coli} SCOP: b.81.1.3 PDB: 1kqa_A* 1kru_A* 1krv_A* | Back alignment and structure |
|---|
| >4e8l_A Virginiamycin A acetyltransferase; structural genomics, antibiotic resistance, center for struc genomics of infectious diseases (csgid); 2.70A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3mc4_A WW/RSP5/WWP domain:bacterial transferase hexapept repeat:serine O-acetyltransferase...; ssgcid, structural genomics; 1.95A {Brucella melitensis biovar abortus} | Back alignment and structure |
|---|
| >3eev_A Chloramphenicol acetyltransferase; beta-helix, structural genomics, center for STR genomics of infectious diseases, csgid; 2.61A {Vibrio cholerae o1 biovar el tor} SCOP: b.81.1.3 | Back alignment and structure |
|---|
| >1ssq_A SAT, serine acetyltransferase; LEFT-handed parallel beta helix; 1.85A {Haemophilus influenzae} SCOP: b.81.1.6 PDB: 1sst_A* 1s80_A 1ssm_A 3gvd_A* | Back alignment and structure |
|---|
| >1mr7_A Streptogramin A acetyltransferase; LEFT-handed parallel beta-helix domain; 1.80A {Enterococcus faecium} SCOP: b.81.1.3 PDB: 1khr_A* 1kk5_A 1kk4_A 1kk6_A 1mr9_A* 1mrl_A* 3dho_A* | Back alignment and structure |
|---|
| >3brk_X Glucose-1-phosphate adenylyltransferase; ADP-glucose pyrophosphorylase, allostery, kinetics, structure-function relationships; 2.10A {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >1t3d_A SAT, serine acetyltransferase; LEFT-handed-beta-helix, dimer of trimers; 2.20A {Escherichia coli} SCOP: b.81.1.6 | Back alignment and structure |
|---|
| >3eev_A Chloramphenicol acetyltransferase; beta-helix, structural genomics, center for STR genomics of infectious diseases, csgid; 2.61A {Vibrio cholerae o1 biovar el tor} SCOP: b.81.1.3 | Back alignment and structure |
|---|
| >1xat_A Xenobiotic acetyltransferase; chloramphenicol, LEFT-handed helix; 3.20A {Pseudomonas aeruginosa} SCOP: b.81.1.3 PDB: 2xat_A* | Back alignment and structure |
|---|
| >1mr7_A Streptogramin A acetyltransferase; LEFT-handed parallel beta-helix domain; 1.80A {Enterococcus faecium} SCOP: b.81.1.3 PDB: 1khr_A* 1kk5_A 1kk4_A 1kk6_A 1mr9_A* 1mrl_A* 3dho_A* | Back alignment and structure |
|---|
| >4e8l_A Virginiamycin A acetyltransferase; structural genomics, antibiotic resistance, center for struc genomics of infectious diseases (csgid); 2.70A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1xat_A Xenobiotic acetyltransferase; chloramphenicol, LEFT-handed helix; 3.20A {Pseudomonas aeruginosa} SCOP: b.81.1.3 PDB: 2xat_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 183 | ||||
| d2jf2a1 | 262 | b.81.1.1 (A:1-262) UDP N-acetylglucosamine acyltra | 2e-15 | |
| d2f9ca1 | 320 | b.81.1.7 (A:3-322) Hypothetical protein YdcK {Salm | 6e-13 | |
| d1j2za_ | 259 | b.81.1.1 (A:) UDP N-acetylglucosamine acyltransfer | 4e-11 | |
| d1fxja1 | 78 | b.81.1.4 (A:252-329) N-acetylglucosamine 1-phospha | 5e-06 | |
| d1fxja1 | 78 | b.81.1.4 (A:252-329) N-acetylglucosamine 1-phospha | 6e-05 | |
| d1fxja1 | 78 | b.81.1.4 (A:252-329) N-acetylglucosamine 1-phospha | 0.002 | |
| d3tdta_ | 274 | b.81.1.2 (A:) Tetrahydrodipicolinate-N-succinlytra | 5e-06 | |
| d1yp2a1 | 135 | b.81.1.4 (A:317-451) Glucose-1-phosphate adenylylt | 3e-05 | |
| d2oi6a1 | 201 | b.81.1.4 (A:252-452) N-acetylglucosamine 1-phospha | 9e-05 | |
| d1mr7a_ | 203 | b.81.1.3 (A:) Xenobiotic acetyltransferase {Entero | 2e-04 | |
| d1qrea_ | 210 | b.81.1.5 (A:) gamma-carbonic anhydrase {Archaeon M | 0.002 |
| >d2jf2a1 b.81.1.1 (A:1-262) UDP N-acetylglucosamine acyltransferase {Escherichia coli, gene lpxA [TaxId: 562]} Length = 262 | Back information, alignment and structure |
|---|
class: All beta proteins fold: Single-stranded left-handed beta-helix superfamily: Trimeric LpxA-like enzymes family: UDP N-acetylglucosamine acyltransferase domain: UDP N-acetylglucosamine acyltransferase species: Escherichia coli, gene lpxA [TaxId: 562]
Score = 70.3 bits (171), Expect = 2e-15
Identities = 32/132 (24%), Positives = 52/132 (39%), Gaps = 10/132 (7%)
Query: 55 IDSTVLIEVGAIVHSKAVLGANVCIGSGTVVGPAVTIGQSTNIGFNVALSNCIIGDSCII 114
ID + + AIV A +GAN IG +VGP V IG+ T + S+ ++ I
Sbjct: 2 IDKSAFVHPTAIVEEGASIGANAHIGPFCIVGPHVEIGEGTVLK-----SHVVVNGHTKI 56
Query: 115 HNGVCIGQDGFGFFVDEHGNMLKKPQLLNARIGNHVEIGANSCIDRGS---WRDTVIGDH 171
I Q V++ +P + IG+ I + I RG+ T +G
Sbjct: 57 GRDNEIYQFASIGEVNQDLKYAGEPTRVE--IGDRNRIRESVTIHRGTVQGGGLTKVGSD 114
Query: 172 SKIDNLVQVGFC 183
+ + +
Sbjct: 115 NLLMINAHIAHD 126
|
| >d2f9ca1 b.81.1.7 (A:3-322) Hypothetical protein YdcK {Salmonella enterica [TaxId: 28901]} Length = 320 | Back information, alignment and structure |
|---|
| >d1j2za_ b.81.1.1 (A:) UDP N-acetylglucosamine acyltransferase {Helicobacter pylori [TaxId: 210]} Length = 259 | Back information, alignment and structure |
|---|
| >d1fxja1 b.81.1.4 (A:252-329) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 78 | Back information, alignment and structure |
|---|
| >d1fxja1 b.81.1.4 (A:252-329) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 78 | Back information, alignment and structure |
|---|
| >d1fxja1 b.81.1.4 (A:252-329) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 78 | Back information, alignment and structure |
|---|
| >d3tdta_ b.81.1.2 (A:) Tetrahydrodipicolinate-N-succinlytransferase, THDP-succinlytransferase, DapD {Mycobacterium bovis [TaxId: 1765]} Length = 274 | Back information, alignment and structure |
|---|
| >d1yp2a1 b.81.1.4 (A:317-451) Glucose-1-phosphate adenylyltransferase small subunit, C-terminal domain {Potato (Solanum tuberosum) [TaxId: 4113]} Length = 135 | Back information, alignment and structure |
|---|
| >d2oi6a1 b.81.1.4 (A:252-452) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 201 | Back information, alignment and structure |
|---|
| >d1mr7a_ b.81.1.3 (A:) Xenobiotic acetyltransferase {Enterococcus faecium, VAT(D) [TaxId: 1352]} Length = 203 | Back information, alignment and structure |
|---|
| >d1qrea_ b.81.1.5 (A:) gamma-carbonic anhydrase {Archaeon Methanosarcina thermophila [TaxId: 2210]} Length = 210 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 183 | |||
| d1j2za_ | 259 | UDP N-acetylglucosamine acyltransferase {Helicobac | 99.82 | |
| d2jf2a1 | 262 | UDP N-acetylglucosamine acyltransferase {Escherich | 99.79 | |
| d1qrea_ | 210 | gamma-carbonic anhydrase {Archaeon Methanosarcina | 99.76 | |
| d1g97a1 | 196 | N-acetylglucosamine 1-phosphate uridyltransferase | 99.74 | |
| d2jf2a1 | 262 | UDP N-acetylglucosamine acyltransferase {Escherich | 99.74 | |
| d1qrea_ | 210 | gamma-carbonic anhydrase {Archaeon Methanosarcina | 99.71 | |
| d3bswa1 | 193 | Acetyltransferase PglD {Campylobacter jejuni [TaxI | 99.71 | |
| d1xhda_ | 172 | Putative acetyltransferase/acyltransferase BC4754 | 99.71 | |
| d1krra_ | 200 | Galactoside acetyltransferase {Escherichia coli [T | 99.69 | |
| d1j2za_ | 259 | UDP N-acetylglucosamine acyltransferase {Helicobac | 99.69 | |
| d3bswa1 | 193 | Acetyltransferase PglD {Campylobacter jejuni [TaxI | 99.68 | |
| d1xhda_ | 172 | Putative acetyltransferase/acyltransferase BC4754 | 99.63 | |
| d1ocxa_ | 182 | Maltose O-acetyltransferase {Escherichia coli [Tax | 99.61 | |
| d1v3wa_ | 173 | Ferripyochelin binding protein {Archaeon Pyrococcu | 99.61 | |
| d2oi6a1 | 201 | N-acetylglucosamine 1-phosphate uridyltransferase | 99.61 | |
| d1fxja1 | 78 | N-acetylglucosamine 1-phosphate uridyltransferase | 99.6 | |
| d3tdta_ | 274 | Tetrahydrodipicolinate-N-succinlytransferase, THDP | 99.59 | |
| d1yp2a1 | 135 | Glucose-1-phosphate adenylyltransferase small subu | 99.59 | |
| d3tdta_ | 274 | Tetrahydrodipicolinate-N-succinlytransferase, THDP | 99.57 | |
| d1krra_ | 200 | Galactoside acetyltransferase {Escherichia coli [T | 99.55 | |
| d1mr7a_ | 203 | Xenobiotic acetyltransferase {Enterococcus faecium | 99.55 | |
| d1g97a1 | 196 | N-acetylglucosamine 1-phosphate uridyltransferase | 99.54 | |
| d1v3wa_ | 173 | Ferripyochelin binding protein {Archaeon Pyrococcu | 99.53 | |
| d1fxja1 | 78 | N-acetylglucosamine 1-phosphate uridyltransferase | 99.52 | |
| d1ocxa_ | 182 | Maltose O-acetyltransferase {Escherichia coli [Tax | 99.49 | |
| d1ssqa_ | 241 | Serine acetyltransferase {Haemophilus influenzae [ | 99.42 | |
| d1mr7a_ | 203 | Xenobiotic acetyltransferase {Enterococcus faecium | 99.39 | |
| d1xata_ | 208 | Xenobiotic acetyltransferase {Pseudomonas aerugino | 99.38 | |
| d1yp2a1 | 135 | Glucose-1-phosphate adenylyltransferase small subu | 99.36 | |
| d1ssqa_ | 241 | Serine acetyltransferase {Haemophilus influenzae [ | 99.26 | |
| d1xata_ | 208 | Xenobiotic acetyltransferase {Pseudomonas aerugino | 99.19 | |
| d2f9ca1 | 320 | Hypothetical protein YdcK {Salmonella enterica [Ta | 99.1 | |
| d2oi6a1 | 201 | N-acetylglucosamine 1-phosphate uridyltransferase | 99.1 | |
| d2f9ca1 | 320 | Hypothetical protein YdcK {Salmonella enterica [Ta | 98.77 |
| >d1j2za_ b.81.1.1 (A:) UDP N-acetylglucosamine acyltransferase {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: Single-stranded left-handed beta-helix superfamily: Trimeric LpxA-like enzymes family: UDP N-acetylglucosamine acyltransferase domain: UDP N-acetylglucosamine acyltransferase species: Helicobacter pylori [TaxId: 210]
Probab=99.82 E-value=3.9e-19 Score=135.22 Aligned_cols=135 Identities=20% Similarity=0.148 Sum_probs=80.6
Q ss_pred CCCcEEccceEECCCcEECCCcEEccCcEECCCcEECCCCEECCCCEECCCcEECCCcEEe-------------ceEECC
Q 030076 44 NGGGIFHQSACIDSTVLIEVGAIVHSKAVLGANVCIGSGTVVGPAVTIGQSTNIGFNVALS-------------NCIIGD 110 (183)
Q Consensus 44 ~~~~~i~~~~~i~~~~~i~~~~~i~~~~~ig~~~~I~~~~~I~~~~~Ig~~~~Ig~~~~i~-------------~~~I~~ 110 (183)
.++..|+|.+.|++++.|+++|+|++++.|+++|.|++++.|.+++.||+++.|.+++.|. ...+++
T Consensus 4 h~sAiI~~~a~Ig~~V~IG~~~vIg~~v~Ig~~~~I~~~v~I~~~t~IG~~~~i~~~~~Ig~~~~~~~~~~~~~~~~ig~ 83 (259)
T d1j2za_ 4 AKTAIISPKAEINKGVEIGEFCVIGDGVKLDEGVKLHNNVTLQGHTFVGKNTEIFPFAVLGTQPQDLKYKGEYSELIIGE 83 (259)
T ss_dssp CTTCEECTTSEECTTCEECTTCEECTTCEECTTCEECTTCEECSEEEECTTCEECTTCEESCCCSCSSCCSCCCEEEECS
T ss_pred CCCCEECCCCEECCCCEECCCCEECCCCEECCCCEECCCEEEeCCCEEeeecccCCccEECCCCcccccccccceEEecc
Confidence 3444556666666666666666666666666666666666666666666666666666651 123344
Q ss_pred CCEECCCcEECCCCC---cee------------------eccCCcccc-CCc-eeceEECCCCEECCCcEEcCCCCCCeE
Q 030076 111 SCIIHNGVCIGQDGF---GFF------------------VDEHGNMLK-KPQ-LLNARIGNHVEIGANSCIDRGSWRDTV 167 (183)
Q Consensus 111 ~~~Ig~~~~i~~~~~---~~~------------------~~~~~~~~~-~~~-~~~~~Ig~~~~Ig~~~~v~~g~~~~~~ 167 (183)
++.++.++.+....+ ... ...+...+. ... .+.+.||++||||.++.+.++ +.
T Consensus 84 ~~~i~~~~~i~~~~~~~~~~t~iG~~~~i~~~~~i~~~~~ig~~~~i~~~~~i~g~v~Ig~~v~IG~~s~I~~g----v~ 159 (259)
T d1j2za_ 84 DNLIREFCMINPGTEGGIKKTLIGDKNLLMAYVHVAHDCVIGSHCILANGVTLAGHIEIGDYVNIGGLTAIHQF----VR 159 (259)
T ss_dssp SCEECTTCEECCCCTTTTSEEEECSSCEECTTCEECTTCEECSSCEECTTCEECTTCEECSSCEECTTCEECTT----CE
T ss_pred ccccccccccccccccccccccccCceEEeccccccceecccceeeeeccccccccccccccceecceeeeecc----cE
Confidence 444433333332110 000 011111111 111 147999999999999999998 99
Q ss_pred ECCCCEECCCCeEee
Q 030076 168 IGDHSKIDNLVQVGF 182 (183)
Q Consensus 168 Ig~~~~I~~~~~v~~ 182 (183)
||++|+|+++++|.+
T Consensus 160 IG~~a~IgagSvV~k 174 (259)
T d1j2za_ 160 IAKGCMIAGKSALGK 174 (259)
T ss_dssp ECTTCEECTTCEECS
T ss_pred eccceeeeeeeeecc
Confidence 999999999999964
|
| >d2jf2a1 b.81.1.1 (A:1-262) UDP N-acetylglucosamine acyltransferase {Escherichia coli, gene lpxA [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qrea_ b.81.1.5 (A:) gamma-carbonic anhydrase {Archaeon Methanosarcina thermophila [TaxId: 2210]} | Back information, alignment and structure |
|---|
| >d1g97a1 b.81.1.4 (A:252-447) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d2jf2a1 b.81.1.1 (A:1-262) UDP N-acetylglucosamine acyltransferase {Escherichia coli, gene lpxA [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qrea_ b.81.1.5 (A:) gamma-carbonic anhydrase {Archaeon Methanosarcina thermophila [TaxId: 2210]} | Back information, alignment and structure |
|---|
| >d3bswa1 b.81.1.8 (A:3-195) Acetyltransferase PglD {Campylobacter jejuni [TaxId: 197]} | Back information, alignment and structure |
|---|
| >d1xhda_ b.81.1.5 (A:) Putative acetyltransferase/acyltransferase BC4754 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1krra_ b.81.1.3 (A:) Galactoside acetyltransferase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1j2za_ b.81.1.1 (A:) UDP N-acetylglucosamine acyltransferase {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d3bswa1 b.81.1.8 (A:3-195) Acetyltransferase PglD {Campylobacter jejuni [TaxId: 197]} | Back information, alignment and structure |
|---|
| >d1xhda_ b.81.1.5 (A:) Putative acetyltransferase/acyltransferase BC4754 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1ocxa_ b.81.1.3 (A:) Maltose O-acetyltransferase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1v3wa_ b.81.1.5 (A:) Ferripyochelin binding protein {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2oi6a1 b.81.1.4 (A:252-452) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1fxja1 b.81.1.4 (A:252-329) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3tdta_ b.81.1.2 (A:) Tetrahydrodipicolinate-N-succinlytransferase, THDP-succinlytransferase, DapD {Mycobacterium bovis [TaxId: 1765]} | Back information, alignment and structure |
|---|
| >d1yp2a1 b.81.1.4 (A:317-451) Glucose-1-phosphate adenylyltransferase small subunit, C-terminal domain {Potato (Solanum tuberosum) [TaxId: 4113]} | Back information, alignment and structure |
|---|
| >d3tdta_ b.81.1.2 (A:) Tetrahydrodipicolinate-N-succinlytransferase, THDP-succinlytransferase, DapD {Mycobacterium bovis [TaxId: 1765]} | Back information, alignment and structure |
|---|
| >d1krra_ b.81.1.3 (A:) Galactoside acetyltransferase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1mr7a_ b.81.1.3 (A:) Xenobiotic acetyltransferase {Enterococcus faecium, VAT(D) [TaxId: 1352]} | Back information, alignment and structure |
|---|
| >d1g97a1 b.81.1.4 (A:252-447) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1v3wa_ b.81.1.5 (A:) Ferripyochelin binding protein {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1fxja1 b.81.1.4 (A:252-329) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ocxa_ b.81.1.3 (A:) Maltose O-acetyltransferase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ssqa_ b.81.1.6 (A:) Serine acetyltransferase {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1mr7a_ b.81.1.3 (A:) Xenobiotic acetyltransferase {Enterococcus faecium, VAT(D) [TaxId: 1352]} | Back information, alignment and structure |
|---|
| >d1xata_ b.81.1.3 (A:) Xenobiotic acetyltransferase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1yp2a1 b.81.1.4 (A:317-451) Glucose-1-phosphate adenylyltransferase small subunit, C-terminal domain {Potato (Solanum tuberosum) [TaxId: 4113]} | Back information, alignment and structure |
|---|
| >d1ssqa_ b.81.1.6 (A:) Serine acetyltransferase {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1xata_ b.81.1.3 (A:) Xenobiotic acetyltransferase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2f9ca1 b.81.1.7 (A:3-322) Hypothetical protein YdcK {Salmonella enterica [TaxId: 28901]} | Back information, alignment and structure |
|---|
| >d2oi6a1 b.81.1.4 (A:252-452) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2f9ca1 b.81.1.7 (A:3-322) Hypothetical protein YdcK {Salmonella enterica [TaxId: 28901]} | Back information, alignment and structure |
|---|