Citrus Sinensis ID: 030083


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180---
MLTTFTPCMNFLTNSSGSGTSPSSDCCGSLKNLTGNSLDCVCLIVTASVPFRVPINRTLAISLPRACNMPSVPVQCKASGAPLPAPGPASLGSAPSPGESPAASPKAPVVPQPTPSGEAPESDTTPGLTPPSPPSPDVGSGSGTPTGTPASRPDLTPSAAMPSYIFSPSLLLFVLGFVVLKYY
cccccccccccccccccccccccccHHHHHHHHHccccccEEEEEEccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHcc
ccccccccccHEEcccccccccccHHHHHHHHHHccccccEEEEEcccccccccccHHHHHcccHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHcc
mlttftpcmnfltnssgsgtspssdccgslknltgnslDCVCLIVtasvpfrvpinrtlaislpracnmpsvpvqckasgaplpapgpaslgsapspgespaaspkapvvpqptpsgeapesdttpgltppsppspdvgsgsgtptgtpasrpdltpsaampsyifspSLLLFVLGFVVLKYY
MLTTFTPCMNFltnssgsgtspsSDCCGSLKNLTGNSLDCVCLIVTASVPFRVPINRTLAISLPRACNMPSVPVQCKASGAPLPAPGPASLGSAPSPGESPAASPKAPVVPQPTPSGEAPESDTTPGLTPPSPPSPDVGSGSGTPTGTPASRPDLTPSAAMPSYIFSPSLLLFVLGFVVLKYY
MLTTFTPCMNFLTNssgsgtspssdccgsLKNLTGNSLDCVCLIVTASVPFRVPINRTLAISLPRACNMPSVPVQCkasgaplpapgpaslgsapspgespaaspkapvvpqpTPSGEAPEsdttpgltppsppspdvgsgsgtptgtpASRPDLTPSAAMPSYIFSPSlllfvlgfvvlKYY
*************************CCGSLKNLTGNSLDCVCLIVTASVPFRVPINRTLAISLPRACNMPSV******************************************************************************************SYIFSPSLLLFVLGFVVLKY*
MLTTFTPCMNFLTN************CGSLKNLTGNSLDCVCLIVTASVPFRVPINRTLAISLPRACNMPSV************************************************************************************************SLLLFVLGFVVLKYY
MLTTFTPCMNFLTNS***********CGSLKNLTGNSLDCVCLIVTASVPFRVPINRTLAISLPRACNMPSVPVQCKASGAPLPAP****************************************************************SRPDLTPSAAMPSYIFSPSLLLFVLGFVVLKYY
MLTTFTPCMNFLTNSS*SGTSPSSDCCGSLKNLTGNSLDCVCLIVTASVPFRVPINRTLAISLPRACNMPSVPVQCKA**************************************************************************************IFSPSLLLFVLGFVVLKYY
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiii
ooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLTTFTPCMNFLTNSSGSGTSPSSDCCGSLKNLTGNSLDCVCLIVTASVPFRVPINRTLAISLPRACNMPSVPVQCKASGAPLPAPGPASLGSAPSPGESPAASPKAPVVPQPTPSGEAPESDTTPGLTPPSPPSPDVGSGSGTPTGTPASRPDLTPSAAMPSYIFSPSLLLFVLGFVVLKYY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query183
356534201227 PREDICTED: non-specific lipid-transfer p 0.972 0.784 0.607 3e-48
255552121206 lipid binding protein, putative [Ricinus 0.923 0.820 0.668 1e-47
225432724217 PREDICTED: uncharacterized protein LOC10 0.972 0.820 0.607 6e-43
297737081195 unnamed protein product [Vitis vinifera] 0.972 0.912 0.607 1e-42
351726126202 uncharacterized protein LOC100527734 pre 0.885 0.801 0.558 4e-41
388503524208 unknown [Lotus japonicus] 0.918 0.807 0.516 5e-39
224112975196 predicted protein [Populus trichocarpa] 0.863 0.806 0.576 7e-39
357480989212 hypothetical protein MTR_5g006940 [Medic 0.939 0.811 0.535 3e-37
359479645214 PREDICTED: uncharacterized protein LOC10 0.961 0.822 0.551 7e-37
296085222178 unnamed protein product [Vitis vinifera] 0.961 0.988 0.551 3e-36
>gi|356534201|ref|XP_003535646.1| PREDICTED: non-specific lipid-transfer protein-like protein At2g13820-like [Glycine max] Back     alignment and taxonomy information
 Score =  196 bits (499), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 116/191 (60%), Positives = 138/191 (72%), Gaps = 13/191 (6%)

Query: 3   TTFTPCMNFLTNSSGSGTSPSSDCCGSLKNLTGNSLDCVCLIVTASVPFRVPINRTLAIS 62
           T FTPCMNFLTNSSG+GTSP+++CC +LK+LT   +DC+CLIVT SVPFR+P+NRTLAIS
Sbjct: 40  TFFTPCMNFLTNSSGNGTSPTTECCSALKSLTSGGMDCLCLIVTGSVPFRIPVNRTLAIS 99

Query: 63  LPRACNMPSVPVQCKASGAPLPAPGPASLG--------SAPSPGESPAASPKAP-VVPQP 113
           LPRACNM  VPVQCKASG+PLPAPGP SLG         +   G +P  SP+A  V+P P
Sbjct: 100 LPRACNMAGVPVQCKASGSPLPAPGPVSLGPSPSPASAPSAPSGFTPTPSPQASTVLPSP 159

Query: 114 TPSGEAPESD-TTPGLTPPSPPSPDVGSGSGTPTGTPASRPDLTPSAAMPSYIFSPSLLL 172
           T    AP+SD TTP L  P  PS D G+ S  PTG  + R +L+PS+AM SY  SPSLL 
Sbjct: 160 TSPSLAPQSDTTTPSLLTPPSPSADSGNPS-VPTG--SGRTNLSPSSAMTSYSVSPSLLF 216

Query: 173 FVLGFVVLKYY 183
             LGF +LKYY
Sbjct: 217 IALGFALLKYY 227




Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|255552121|ref|XP_002517105.1| lipid binding protein, putative [Ricinus communis] gi|223543740|gb|EEF45268.1| lipid binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|225432724|ref|XP_002278974.1| PREDICTED: uncharacterized protein LOC100257872 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297737081|emb|CBI26282.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|351726126|ref|NP_001236604.1| uncharacterized protein LOC100527734 precursor [Glycine max] gi|255633076|gb|ACU16893.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|388503524|gb|AFK39828.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|224112975|ref|XP_002332676.1| predicted protein [Populus trichocarpa] gi|222836470|gb|EEE74877.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|357480989|ref|XP_003610780.1| hypothetical protein MTR_5g006940 [Medicago truncatula] gi|355512115|gb|AES93738.1| hypothetical protein MTR_5g006940 [Medicago truncatula] Back     alignment and taxonomy information
>gi|359479645|ref|XP_003632315.1| PREDICTED: uncharacterized protein LOC100852532 [Vitis vinifera] Back     alignment and taxonomy information
>gi|296085222|emb|CBI28717.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query183
TAIR|locus:2828523203 AT3G22620 [Arabidopsis thalian 0.415 0.374 0.526 1.1e-22
TAIR|locus:2201046205 AT1G05450 "AT1G05450" [Arabido 0.398 0.356 0.552 6.7e-17
TAIR|locus:2039341200 EDA4 "AT2G48140" [Arabidopsis 0.415 0.38 0.480 1.6e-15
TAIR|locus:2039366183 AT2G48130 [Arabidopsis thalian 0.393 0.393 0.324 1.6e-06
TAIR|locus:2077001170 AT3G22600 [Arabidopsis thalian 0.393 0.423 0.285 3.4e-05
TAIR|locus:2828523 AT3G22620 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 228 (85.3 bits), Expect = 1.1e-22, Sum P(2) = 1.1e-22
 Identities = 40/76 (52%), Positives = 51/76 (67%)

Query:     1 MLTTFTPCMNFLTNXXXXXXXXXXXXXXXLKNLTGNSLDCVCLIVTASVPFRVPINRTLA 60
             M+TT +PCM F+TN               L++LT   + C+CLIVT +VPF +PINRT A
Sbjct:    33 MMTTVSPCMGFITNSSSNGTSPSSDCCNSLRSLTTGGMGCLCLIVTGTVPFNIPINRTTA 92

Query:    61 ISLPRACNMPSVPVQC 76
             +SLPRACNMP VP+QC
Sbjct:    93 VSLPRACNMPRVPLQC 108


GO:0005886 "plasma membrane" evidence=ISM
GO:0006869 "lipid transport" evidence=ISS
GO:0008289 "lipid binding" evidence=ISS
GO:0009941 "chloroplast envelope" evidence=IDA
GO:0010167 "response to nitrate" evidence=RCA
GO:0015706 "nitrate transport" evidence=RCA
TAIR|locus:2201046 AT1G05450 "AT1G05450" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2039341 EDA4 "AT2G48140" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2039366 AT2G48130 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2077001 AT3G22600 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query183
pfam1436895 pfam14368, LTP_2, Probable lipid transfer 2e-13
cd0001063 cd00010, AAI_LTSS, AAI_LTSS: Alpha-Amylase Inhibit 1e-10
smart0049979 smart00499, AAI, Plant lipid transfer protein / se 2e-06
PRK07764 824 PRK07764, PRK07764, DNA polymerase III subunits ga 8e-06
pfam0023474 pfam00234, Tryp_alpha_amyl, Protease inhibitor/see 2e-05
PRK14954 620 PRK14954, PRK14954, DNA polymerase III subunits ga 3e-05
PRK12270 1228 PRK12270, kgd, alpha-ketoglutarate decarboxylase; 2e-04
PRK14950 585 PRK14950, PRK14950, DNA polymerase III subunits ga 2e-04
PRK14951618 PRK14951, PRK14951, DNA polymerase III subunits ga 3e-04
TIGR02927 579 TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogena 4e-04
PRK12270 1228 PRK12270, kgd, alpha-ketoglutarate decarboxylase; 5e-04
PRK07764 824 PRK07764, PRK07764, DNA polymerase III subunits ga 0.001
PRK12270 1228 PRK12270, kgd, alpha-ketoglutarate decarboxylase; 0.001
TIGR00601 378 TIGR00601, rad23, UV excision repair protein Rad23 0.001
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 0.001
PRK07764 824 PRK07764, PRK07764, DNA polymerase III subunits ga 0.002
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 0.002
PRK14950 585 PRK14950, PRK14950, DNA polymerase III subunits ga 0.002
PRK14951 618 PRK14951, PRK14951, DNA polymerase III subunits ga 0.002
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 0.002
PRK05996 423 PRK05996, motB, flagellar motor protein MotB; Vali 0.002
PRK11854 633 PRK11854, aceF, pyruvate dehydrogenase dihydrolipo 0.002
pfam05616502 pfam05616, Neisseria_TspB, Neisseria meningitidis 0.002
PRK07994 647 PRK07994, PRK07994, DNA polymerase III subunits ga 0.002
PRK12323 700 PRK12323, PRK12323, DNA polymerase III subunits ga 0.003
PRK14951 618 PRK14951, PRK14951, DNA polymerase III subunits ga 0.004
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 0.004
PRK07003 830 PRK07003, PRK07003, DNA polymerase III subunits ga 0.004
>gnl|CDD|222713 pfam14368, LTP_2, Probable lipid transfer Back     alignment and domain information
 Score = 62.5 bits (152), Expect = 2e-13
 Identities = 23/74 (31%), Positives = 37/74 (50%), Gaps = 2/74 (2%)

Query: 3  TTFTPCMNFLTNSSGSGTSPSSDCCGSLKNLTGNSLDCVCLIVTASVPFRVPINRTLAIS 62
           +  PC+           +PS  CC +LK      + C+C +VT+ +     IN T A++
Sbjct: 24 DSLLPCLG--YCYVNGTAAPSPACCAALKAAVKADVPCLCDLVTSPLAAGFGINLTRAVA 81

Query: 63 LPRACNMPSVPVQC 76
          LP+AC + S P +C
Sbjct: 82 LPKACGLTSPPSKC 95


The members of this family are probably involved in lipid transfer. The family has several highly conserved cysteines, paired in various ways. Length = 95

>gnl|CDD|237980 cd00010, AAI_LTSS, AAI_LTSS: Alpha-Amylase Inhibitors (AAI), Lipid Transfer (LT) and Seed Storage (SS) Protein family; a protein family unique to higher plants that includes cereal-type alpha-amylase inhibitors, lipid transfer proteins, seed storage proteins, and similar proteins Back     alignment and domain information
>gnl|CDD|214698 smart00499, AAI, Plant lipid transfer protein / seed storage protein / trypsin-alpha amylase inhibitor domain family Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|215810 pfam00234, Tryp_alpha_amyl, Protease inhibitor/seed storage/LTP family Back     alignment and domain information
>gnl|CDD|184918 PRK14954, PRK14954, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|200219 TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase Back     alignment and domain information
>gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|233045 TIGR00601, rad23, UV excision repair protein Rad23 Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|235665 PRK05996, motB, flagellar motor protein MotB; Validated Back     alignment and domain information
>gnl|CDD|236999 PRK11854, aceF, pyruvate dehydrogenase dihydrolipoyltransacetylase; Validated Back     alignment and domain information
>gnl|CDD|218658 pfam05616, Neisseria_TspB, Neisseria meningitidis TspB protein Back     alignment and domain information
>gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|235906 PRK07003, PRK07003, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 183
cd0001063 AAI_LTSS AAI_LTSS: Alpha-Amylase Inhibitors (AAI), 99.46
cd0196089 nsLTP1 nsLTP1: Non-specific lipid-transfer protein 99.45
cd0466073 nsLTP_like nsLTP_like: Non-specific lipid-transfer 99.39
PF1436896 LTP_2: Probable lipid transfer; PDB: 2RKN_A 1N89_A 99.31
cd0195966 nsLTP2 nsLTP2: Non-specific lipid-transfer protein 99.08
smart0049979 AAI Plant lipid transfer protein / seed storage pr 98.92
PF0023490 Tryp_alpha_amyl: Protease inhibitor/seed storage/L 98.38
cd0195885 HPS_like HPS_like: Hydrophobic Protein from Soybea 92.79
PF1454785 Hydrophob_seed: Hydrophobic seed protein 91.3
>cd00010 AAI_LTSS AAI_LTSS: Alpha-Amylase Inhibitors (AAI), Lipid Transfer (LT) and Seed Storage (SS) Protein family; a protein family unique to higher plants that includes cereal-type alpha-amylase inhibitors, lipid transfer proteins, seed storage proteins, and similar proteins Back     alignment and domain information
Probab=99.46  E-value=4.6e-14  Score=96.51  Aligned_cols=62  Identities=34%  Similarity=0.795  Sum_probs=53.3

Q ss_pred             ccCcHHHhhcCCCCCCCCCHHHHHHHHHhhCCCCCceeeeecCCCCcccCC-CHHHHhhccccCCC
Q 030083            5 FTPCMNFLTNSSGSGTSPSSDCCGSLKNLTGNSLDCVCLIVTASVPFRVPI-NRTLAISLPRACNM   69 (183)
Q Consensus         5 LaPCl~Yltg~s~~~~sPs~~CC~gLksl~~~~~~CLC~~~~~~~~~~i~I-N~trAlsLP~~Cgv   69 (183)
                      |++|++|++++   ...|+.+||++|+++++.+..|+|..+++......++ |.++++.||++||+
T Consensus         1 L~~C~~y~~~~---~~~Ps~~CC~~l~~~~~~~~~ClC~~~~~~~~~~~~~~~~~~a~~LP~~Cgv   63 (63)
T cd00010           1 LAPCLSYLTGG---ATAPPSDCCSGLKSVVKSDPKCLCAALNGPGASLLGLKNATRALALPAACGL   63 (63)
T ss_pred             CcchHHHHcCC---CCCCChHHHHHHHHHHhcChhhHHHHHcCccccccCcccHHHHHhchHhcCC
Confidence            68999999985   3689999999999999889999999998754333345 89999999999996



Proteins in this family are known to play important roles, in defending plants from insects and pathogens, lipid transport between intracellular membranes, and nutrient storage. Many proteins of this family have been identified as allergens in humans. These proteins contain a common pattern of eight cysteines that form four disulfide bridges.

>cd01960 nsLTP1 nsLTP1: Non-specific lipid-transfer protein type 1 (nsLTP1) subfamily; Plant nsLTPs are small, soluble proteins that facilitate the transfer of fatty acids, phospholipids, glycolipids, and steroids between membranes Back     alignment and domain information
>cd04660 nsLTP_like nsLTP_like: Non-specific lipid-transfer protein (nsLTP)-like subfamily; composed of predominantly uncharacterized proteins with similarity to nsLTPs, including Medicago truncatula MtN5, the root-specific Phaseolus vulgaris PVR3, Antirrhinum majus FIL1, and Lilium longiflorum LIM3 Back     alignment and domain information
>PF14368 LTP_2: Probable lipid transfer; PDB: 2RKN_A 1N89_A 1TUK_A Back     alignment and domain information
>cd01959 nsLTP2 nsLTP2: Non-specific lipid-transfer protein type 2 (nsLTP2) subfamily; Plant nsLTPs are small, soluble proteins that facilitate the transfer of fatty acids, phospholipids, glycolipids, and steroids between membranes Back     alignment and domain information
>smart00499 AAI Plant lipid transfer protein / seed storage protein / trypsin-alpha amylase inhibitor domain family Back     alignment and domain information
>PF00234 Tryp_alpha_amyl: Protease inhibitor/seed storage/LTP family This is a small subfamily; InterPro: IPR003612 This domain is found is several proteins, including plant lipid transfer proteins [], seed storage proteins [] and trypsin-alpha amylase inhibitors [, ] Back     alignment and domain information
>cd01958 HPS_like HPS_like: Hydrophobic Protein from Soybean (HPS)-like subfamily; composed of proteins with similarity to HPS, a small hydrophobic protein with unknown function related to cereal-type alpha-amylase inhibitors and lipid transfer proteins Back     alignment and domain information
>PF14547 Hydrophob_seed: Hydrophobic seed protein Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query183
1afh_A93 Maize nonspecific lipid transfer protein; lipid-bi 4e-06
3v1v_A 433 2-MIB synthase, 2-methylisoborneol synthase; class 3e-05
3v1v_A 433 2-MIB synthase, 2-methylisoborneol synthase; class 9e-04
3nwa_A 703 GB, GB-1, GB1, envelope glycoprotein B; coiled-coi 1e-04
3nwa_A 703 GB, GB-1, GB1, envelope glycoprotein B; coiled-coi 3e-04
1twf_A 1733 B220, DNA-directed RNA polymerase II largest subun 2e-04
1twf_A 1733 B220, DNA-directed RNA polymerase II largest subun 2e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 6e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 3e-04
>1afh_A Maize nonspecific lipid transfer protein; lipid-binding protein, molecular modeling,; NMR {Zea mays} SCOP: a.52.1.1 PDB: 1fk0_A* 1fk1_A* 1fk2_A* 1fk3_A* 1fk4_A* 1fk5_A* 1fk6_A* 1fk7_A* 1mzl_A 1mzm_A* 1bv2_A 1rzl_A* 1uva_A* 1uvb_A* 1uvc_A* Length = 93 Back     alignment and structure
 Score = 42.5 bits (100), Expect = 4e-06
 Identities = 16/72 (22%), Positives = 29/72 (40%), Gaps = 8/72 (11%)

Query: 2  LTTFTPCMNFLTNSSGSGTSPSSDCCGSLKNL-----TGNSLDCVCLIVTASVPFRVPIN 56
           +   PC+++     G G+ PS+ CC  +++L     T       C  +  +      +N
Sbjct: 8  ASAIAPCISYAR---GQGSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLN 64

Query: 57 RTLAISLPRACN 68
             A S+P  C 
Sbjct: 65 AGNAASIPSKCG 76


>3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 Back     alignment and structure
>3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 Back     alignment and structure
>3nwa_A GB, GB-1, GB1, envelope glycoprotein B; coiled-coil, membrane fusion, viral P glycoprotein B, HSV-1, membrane; HET: NAG; 2.26A {Human herpesvirus 1} PDB: 3nwf_A* 3nw8_A* 3nwd_A* Length = 703 Back     alignment and structure
>3nwa_A GB, GB-1, GB1, envelope glycoprotein B; coiled-coil, membrane fusion, viral P glycoprotein B, HSV-1, membrane; HET: NAG; 2.26A {Human herpesvirus 1} PDB: 3nwf_A* 3nw8_A* 3nwd_A* Length = 703 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query183
2ljo_A93 Non-specific lipid-transfer protein 2; lipid trans 99.52
1afh_A93 Maize nonspecific lipid transfer protein; lipid-bi 99.51
1t12_A91 LTP 1, nonspecific lipid-transfer protein 1; cyste 99.49
2alg_A92 Non-specific lipid transfer protein; LTP, NS-LTP, 99.49
1siy_A91 LTP 1, NS-LTP1, nonspecific lipid-transfer protein 99.48
1bwo_A90 NS-LTP1, nonspecific lipid-transfer protein; wheat 99.48
2rkn_A77 DIR1 protein, AT5G48485; LTP, defense signaling pr 99.43
1n89_A67 Lipid transfer protein; lipid transport; HET: PGM; 99.3
1l6h_A69 LTP2, non-specific lipid transfer protein; NSLTP2, 99.27
1hyp_A80 Hydrophobic protein from soybean; hydrophobic SEED 93.07
3ob4_A500 Conglutin, maltose ABC transporter periplasmic pro 89.38
>2ljo_A Non-specific lipid-transfer protein 2; lipid transport; NMR {Lens culinaris} Back     alignment and structure
Probab=99.52  E-value=2.8e-16  Score=116.60  Aligned_cols=74  Identities=24%  Similarity=0.578  Sum_probs=58.6

Q ss_pred             CCcccCcHHHhhcCCCCCCCCCHHHHHHHHHhhCC-----CCCceeeeecCCCCcccCCCHHHHhhccccCCCCCCC---
Q 030083            2 LTTFTPCMNFLTNSSGSGTSPSSDCCGSLKNLTGN-----SLDCVCLIVTASVPFRVPINRTLAISLPRACNMPSVP---   73 (183)
Q Consensus         2 l~~LaPCl~Yltg~s~~~~sPs~~CC~gLksl~~~-----~~~CLC~~~~~~~~~~i~IN~trAlsLP~~Cgv~~pp---   73 (183)
                      +..|+||++||+|+    ..|+..||+++|+|++.     |+.|+|..+++......+||.+||++||++|||++++   
T Consensus         8 ~~~L~pCl~Yv~g~----~~p~~~CC~gv~~l~~~a~t~~dr~~~C~clk~~a~~~~~in~~~a~~LP~~CgV~~p~~Is   83 (93)
T 2ljo_A            8 TSDLSPCLTYLTGG----PGPSPQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGKCGVNIPYKIS   83 (93)
T ss_dssp             HHHHHHHHHHHTTS----SCCCHHHHHHHHHHHHSCCSHHHHHHHHHHHHHHGGGCTTCCHHHHHHHHHHHTCCCSSCCS
T ss_pred             HHHHHhHHHHHcCC----CCCCCchhhHHHHHHHHhcCcccHHHHHHhHHhhhhccCCcCHHHHHhhhHhcCCCCCCCCC
Confidence            45799999999985    36999999999999864     4567776666533333479999999999999999985   


Q ss_pred             --CCcCCC
Q 030083           74 --VQCKAS   79 (183)
Q Consensus        74 --~~C~~~   79 (183)
                        +||++.
T Consensus        84 ~~~dC~~v   91 (93)
T 2ljo_A           84 TTTNCNTV   91 (93)
T ss_dssp             TTCCGGGC
T ss_pred             CCCCCCCC
Confidence              489864



>1afh_A Maize nonspecific lipid transfer protein; lipid-binding protein, molecular modeling,; NMR {Zea mays} SCOP: a.52.1.1 PDB: 1fk0_A* 1fk1_A* 1fk2_A* 1fk3_A* 1fk4_A* 1fk5_A* 1fk6_A* 1fk7_A* 1mzl_A 1mzm_A* 1bv2_A 1rzl_A* 1uva_A* 1uvb_A* 1uvc_A* Back     alignment and structure
>1t12_A LTP 1, nonspecific lipid-transfer protein 1; cystein rich protein, lipid transport; NMR {Nicotiana tabacum} Back     alignment and structure
>2alg_A Non-specific lipid transfer protein; LTP, NS-LTP, FOOD allergen, lipid transport; HET: DAO P6G; 2.30A {Prunus persica} PDB: 2b5s_A* Back     alignment and structure
>1siy_A LTP 1, NS-LTP1, nonspecific lipid-transfer protein 1; alpha helix, lipid binding protein; NMR {Vigna radiata var} Back     alignment and structure
>1bwo_A NS-LTP1, nonspecific lipid-transfer protein; wheat, lipid binding, crystallography; HET: LPC; 2.10A {Triticum aestivum} SCOP: a.52.1.1 PDB: 1cz2_A* 1gh1_A 1be2_A* 1jtb_A* 1lip_A 1mid_A* 3cee_A* 3gsh_A* Back     alignment and structure
>2rkn_A DIR1 protein, AT5G48485; LTP, defense signaling protein, signaling protein, lipid TRA; HET: LP3; 1.60A {Arabidopsis thaliana} Back     alignment and structure
>1n89_A Lipid transfer protein; lipid transport; HET: PGM; NMR {Triticum turgidum subsp} SCOP: a.52.1.1 PDB: 1tuk_A* Back     alignment and structure
>1l6h_A LTP2, non-specific lipid transfer protein; NSLTP2, plant LTP, lipid transport; NMR {Oryza sativa} SCOP: a.52.1.1 Back     alignment and structure
>1hyp_A Hydrophobic protein from soybean; hydrophobic SEED protein; 1.80A {Glycine max} SCOP: a.52.1.1 Back     alignment and structure
>3ob4_A Conglutin, maltose ABC transporter periplasmic protein, ARAH; alpha-amylase inhibitors (AAI), lipid transfer (LT) and SEED (SS) protein family; HET: MLR; 2.71A {Escherichia coli} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 183
d1fk5a_93 a.52.1.1 (A:) Plant non-specific lipid-transfer pr 1e-09
d1mida_91 a.52.1.1 (A:) Plant non-specific lipid-transfer pr 8e-08
>d1fk5a_ a.52.1.1 (A:) Plant non-specific lipid-transfer protein (ns-LTP, ns-LTP1) {Maize (Zea mays) [TaxId: 4577]} Length = 93 Back     information, alignment and structure

class: All alpha proteins
fold: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin
superfamily: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin
family: Plant lipid-transfer and hydrophobic proteins
domain: Plant non-specific lipid-transfer protein (ns-LTP, ns-LTP1)
species: Maize (Zea mays) [TaxId: 4577]
 Score = 50.6 bits (121), Expect = 1e-09
 Identities = 12/69 (17%), Positives = 23/69 (33%), Gaps = 2/69 (2%)

Query: 2  LTTFTPCMNFLTNSSGSGTSPSSDCCGSLKNLTGNSLD--CVCLIVTASVPFRVPINRTL 59
           +   PC+++        ++       SL N    + D    C  +  +      +N   
Sbjct: 8  ASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGN 67

Query: 60 AISLPRACN 68
          A S+P  C 
Sbjct: 68 AASIPSKCG 76


>d1mida_ a.52.1.1 (A:) Plant non-specific lipid-transfer protein (ns-LTP, ns-LTP1) {Barley (Hordeum vulgare) [TaxId: 4513]} Length = 91 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query183
d1fk5a_93 Plant non-specific lipid-transfer protein (ns-LTP, 99.52
d1mida_91 Plant non-specific lipid-transfer protein (ns-LTP, 99.49
d1tuka167 Non-specific lipid-transfer protein homologue (ns- 98.14
d1l6ha_69 Non-specific lipid-transfer protein homologue (ns- 98.05
d1hypa_75 Soybean hydrophobic protein {Soybean (Glycine max) 89.26
>d1fk5a_ a.52.1.1 (A:) Plant non-specific lipid-transfer protein (ns-LTP, ns-LTP1) {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
class: All alpha proteins
fold: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin
superfamily: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin
family: Plant lipid-transfer and hydrophobic proteins
domain: Plant non-specific lipid-transfer protein (ns-LTP, ns-LTP1)
species: Maize (Zea mays) [TaxId: 4577]
Probab=99.52  E-value=1.7e-16  Score=115.60  Aligned_cols=75  Identities=20%  Similarity=0.514  Sum_probs=59.2

Q ss_pred             CCcccCcHHHhhcCCCCCCCCCHHHHHHHHHhhCC-----CCCceeeeecCCCCcccCCCHHHHhhccccCCCCCCC---
Q 030083            2 LTTFTPCMNFLTNSSGSGTSPSSDCCGSLKNLTGN-----SLDCVCLIVTASVPFRVPINRTLAISLPRACNMPSVP---   73 (183)
Q Consensus         2 l~~LaPCl~Yltg~s~~~~sPs~~CC~gLksl~~~-----~~~CLC~~~~~~~~~~i~IN~trAlsLP~~Cgv~~pp---   73 (183)
                      +..|+||++||+|+   +..|+..||+++++|++.     ++.|+|..+++......+||.+|+++||++||+++++   
T Consensus         8 ~~~l~pCl~Yltg~---~~~Ps~~CC~gv~~l~~~a~t~~dr~~lC~cl~~~~~~~~~in~~ra~~LP~~C~v~l~~pis   84 (93)
T d1fk5a_           8 ASAIAPCISYARGQ---GSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTIS   84 (93)
T ss_dssp             HHHHGGGHHHHTTC---SSSCCHHHHHHHHHHHHHCCSHHHHHHHHHHHHHHHHTCTTCCHHHHHHHHHHTTCCCSSCCS
T ss_pred             HHHhhhhHHHHhCC---CCCCCCchhHHHHHHHHHccCCccHHHHHHhhhhcccccCCcCHHHHHhhhHhcCCCCCCCCC
Confidence            45799999999986   468999999999999863     4556766665432233579999999999999998875   


Q ss_pred             --CCcCCC
Q 030083           74 --VQCKAS   79 (183)
Q Consensus        74 --~~C~~~   79 (183)
                        +||+..
T Consensus        85 ~~~dCs~i   92 (93)
T d1fk5a_          85 TSTDCSRV   92 (93)
T ss_dssp             TTCCGGGC
T ss_pred             CCCCCCcC
Confidence              489864



>d1mida_ a.52.1.1 (A:) Plant non-specific lipid-transfer protein (ns-LTP, ns-LTP1) {Barley (Hordeum vulgare) [TaxId: 4513]} Back     information, alignment and structure
>d1tuka1 a.52.1.1 (A:1-67) Non-specific lipid-transfer protein homologue (ns-LTP2) {Triticum turgidum [TaxId: 4571]} Back     information, alignment and structure
>d1l6ha_ a.52.1.1 (A:) Non-specific lipid-transfer protein homologue (ns-LTP2) {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1hypa_ a.52.1.1 (A:) Soybean hydrophobic protein {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure