Citrus Sinensis ID: 030138

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180--
MSTTTLYNCATTKLCSSLINNSSSFSKSRLFFSSSHFAPRVSSIRRPLSLRGASRSSSSSSSARAISTMGDATTDAGMDAVQRRLMFEDECILVDENDRVVGHENKYNCHLMEKIESLNLLHRAFSVFLFNSKYELLLQVCLFCILWVKTCLSMDCHWVVQICGLTWEMTDSNILFVMTHKS
ccccccccccccEEEcccccccccHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHccccEEEEcccccEEEEEEcccccccccccccccEEEEEEEEEEEccccEEEEEEEcccccccccccccccccHHHccccHHHHcccccccccccc
ccccHHHcHHHHHHcccccccHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHcccEEEEEcccccccccccHcccccccccccccEEEEEEEEEEcccccEEEEEEEccccccccccccccccccccccccccHHHHHccccccccc
mstttlyncattkLCSSLinnsssfsksrlffssshfaprvssirrplslrgasrssssssSARAISTmgdattdaGMDAVQRRLMfedecilvdendrvvghenkynCHLMEKIESLNLLHRAFSVFLFNSKYELLLQVCLFCILWVktclsmdcHWVVQICGltwemtdsNILFVMTHKS
mstttlyncattkLCSSLINNSSSFSKSRLFFssshfaprvssirrplslrgasrsssssssarAISTMGDATTDAGMDAVQRRLMFEDECILVDENDRVVGHENKYNCHLMEKIESLNLLHRAFSVFLFNSKYELLLQVCLFCILWVKTCLSMDCHWVVQICGLTWEMTDSNILFVMTHKS
MSTTTLYNCATTKLCsslinnsssfsksrlffssshfAPRVSSIrrplslrgasrsssssssaraisTMGDATTDAGMDAVQRRLMFEDECILVDENDRVVGHENKYNCHLMEKIESLNLLHRAFSVFLFNSKYELLLQVCLFCILWVKTCLSMDCHWVVQICGLTWEMTDSNILFVMTHKS
*****LYNCATTKLCSSLIN***********************************************************AVQRRLMFEDECILVDENDRVVGHENKYNCHLMEKIESLNLLHRAFSVFLFNSKYELLLQVCLFCILWVKTCLSMDCHWVVQICGLTWEMTDSNILFVM****
********CATTKLCSSL***********************SSI**************************************RRLMFEDECILVDENDRVVGHENKYNCHLMEKIESLNLLHRAFSVFLFNSKYELLLQVCLFCILWVKTCLSMDCHWVVQIC*****MTDSNI*FVM****
MSTTTLYNCATTKLCSSLINNSSSFSKSRLFFSSSHFAPRVSSIRRP**********************GDATTDAGMDAVQRRLMFEDECILVDENDRVVGHENKYNCHLMEKIESLNLLHRAFSVFLFNSKYELLLQVCLFCILWVKTCLSMDCHWVVQICGLTWEMTDSNILFVMTHKS
*******N*ATTKLCSSLINNSSSFSKSRLFFSSSHFAPRVSSIRRPL***************************AGMDAVQRRLMFEDECILVDENDRVVGHENKYNCHLMEKIESLNLLHRAFSVFLFNSKYELLLQVCLFCILWVKTCLSMDCHWVVQI***TWEMT************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSTTTLYNCATTKLCSSLINNSSSFSKSRLFFSSSHFAPRVSSIRRPLSLRGASRSSSSSSSARAISTMGDATTDAGMDAVQRRLMFEDECILVDENDRVVGHENKYNCHLMEKIESLNLLHRAFSVFLFNSKYELLLQVCLFCILWVKTCLSMDCHWVVQICGLTWEMTDSNILFVMTHKS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query182 2.2.26 [Sep-21-2011]
O48965 309 Isopentenyl-diphosphate D N/A no 0.615 0.362 0.635 7e-37
Q38929 291 Isopentenyl-diphosphate D yes no 0.598 0.374 0.652 1e-35
Q39472 287 Isopentenyl-diphosphate D N/A no 0.571 0.362 0.669 5e-34
O48964 235 Isopentenyl-diphosphate D N/A no 0.467 0.361 0.766 6e-34
Q39664 290 Isopentenyl-diphosphate D N/A no 0.719 0.451 0.569 4e-33
Q39471 286 Isopentenyl-diphosphate D N/A no 0.571 0.363 0.641 5e-33
Q42553 284 Isopentenyl-diphosphate D no no 0.560 0.359 0.660 3e-32
P15496 288 Isopentenyl-diphosphate D yes no 0.543 0.343 0.437 3e-13
Q1LZ95 227 Isopentenyl-diphosphate D no no 0.373 0.299 0.605 4e-13
Q5R8R6 227 Isopentenyl-diphosphate D yes no 0.373 0.299 0.563 8e-12
>sp|O48965|IDI2_CAMAC Isopentenyl-diphosphate Delta-isomerase II OS=Camptotheca acuminata GN=IPI2 PE=2 SV=1 Back     alignment and function desciption
 Score =  153 bits (386), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 82/129 (63%), Positives = 89/129 (68%), Gaps = 17/129 (13%)

Query: 30  LFFSSSHFAPRVSSIRRPLSLRGASRSSSSSSSARAISTMGDATTDAGMDAVQRRLMFED 89
           +F SSSH + RVSS              SS ++    S MGD  TDAGMDAVQRRLMFED
Sbjct: 48  VFCSSSHLSVRVSSYH------------SSVAAKATTSAMGDTATDAGMDAVQRRLMFED 95

Query: 90  ECILVDENDRVVGHENKYNCHLMEKIESLNLLHRAFSVFLFNSKYELLLQV-----CLFC 144
           ECILVDEND VVGH+ KYNCHLMEKIES NLLHRAFSVFLFNSKYELLLQ        F 
Sbjct: 96  ECILVDENDHVVGHDTKYNCHLMEKIESDNLLHRAFSVFLFNSKYELLLQQRSATKVTFP 155

Query: 145 ILWVKTCLS 153
           ++W  TC S
Sbjct: 156 LVWTNTCCS 164
Catalyzes the 1,3-allylic rearrangement of the homoallylic substrate isopentenyl (IPP) to its highly electrophilic allylic isomer, dimethylallyl diphosphate (DMAPP).
Camptotheca acuminata (taxid: 16922)
EC: 5EC: .EC: 3EC: .EC: 3EC: .EC: 2
>sp|Q38929|IDI1_ARATH Isopentenyl-diphosphate Delta-isomerase I, chloroplastic OS=Arabidopsis thaliana GN=IPP1 PE=2 SV=3 Back     alignment and function description
>sp|Q39472|IDI1_CLABR Isopentenyl-diphosphate Delta-isomerase I OS=Clarkia breweri GN=IPI1 PE=2 SV=2 Back     alignment and function description
>sp|O48964|IDI1_CAMAC Isopentenyl-diphosphate Delta-isomerase I OS=Camptotheca acuminata GN=IPI1 PE=2 SV=1 Back     alignment and function description
>sp|Q39664|IDI2_CLAXA Isopentenyl-diphosphate Delta-isomerase II OS=Clarkia xantiana GN=IPI2 PE=3 SV=1 Back     alignment and function description
>sp|Q39471|IDI2_CLABR Isopentenyl-diphosphate Delta-isomerase II OS=Clarkia breweri GN=IPI2 PE=3 SV=2 Back     alignment and function description
>sp|Q42553|IDI2_ARATH Isopentenyl-diphosphate Delta-isomerase II, chloroplastic OS=Arabidopsis thaliana GN=IPP2 PE=2 SV=1 Back     alignment and function description
>sp|P15496|IDI1_YEAST Isopentenyl-diphosphate Delta-isomerase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IDI1 PE=1 SV=2 Back     alignment and function description
>sp|Q1LZ95|IDI1_BOVIN Isopentenyl-diphosphate Delta-isomerase 1 OS=Bos taurus GN=IDI1 PE=2 SV=2 Back     alignment and function description
>sp|Q5R8R6|IDI1_PONAB Isopentenyl-diphosphate Delta-isomerase 1 OS=Pongo abelii GN=IDI1 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query182
359902127 321 isopentenyl-diphosphate isomerase [Humul 0.725 0.411 0.628 2e-37
359903129 321 isopentenyl-diphosphate isomerase [Humul 0.725 0.411 0.621 4e-36
74027234 296 isopentenyl diphosphate isomerase [Ipomo 0.763 0.469 0.578 5e-36
6225532 309 RecName: Full=Isopentenyl-diphosphate De 0.615 0.362 0.635 3e-35
309754781 301 isopentyl diphosphate isomerase [Santalu 0.576 0.348 0.675 4e-34
79514626 291 Isopentenyl-diphosphate Delta-isomerase 0.598 0.374 0.652 6e-34
1213442262 isopentenyl pyrophosphate isomerase [Ara 0.598 0.416 0.652 6e-34
157072591 305 isopentenyl pyrophosphate isomerase [Sal 0.609 0.363 0.634 1e-33
297807669 289 isopentenyl pyrophosphate isomerase [Ara 0.587 0.370 0.669 5e-33
347664497 290 isopentenyl diphosphate isomerase II(IPI 0.747 0.468 0.573 5e-33
>gi|359902127|gb|AEV89961.1| isopentenyl-diphosphate isomerase [Humulus lupulus] Back     alignment and taxonomy information
 Score =  160 bits (405), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 93/148 (62%), Positives = 104/148 (70%), Gaps = 16/148 (10%)

Query: 16  SSLINNSSSF---SKSRLFFSSSHFA--P--RVSSIRRPLSLRGASRSSSSSSSARAIST 68
           S L+N S+      ++ LF SSS FA  P  R+ SI +PLS   A  S SS +S    ST
Sbjct: 2   SHLLNTSAKLYFAPRAHLFTSSSSFARNPFLRIPSIPKPLSPLIARVSLSSKASN---ST 58

Query: 69  MGDATTDAGMDAVQRRLMFEDECILVDENDRVVGHENKYNCHLMEKIESLNLLHRAFSVF 128
           MGD + DAGMDAVQRRLMFEDECILVDENDRVVGH+ KYNCHLMEKIE  NLLHRAFSVF
Sbjct: 59  MGD-SADAGMDAVQRRLMFEDECILVDENDRVVGHDTKYNCHLMEKIEKENLLHRAFSVF 117

Query: 129 LFNSKYELLLQV-----CLFCILWVKTC 151
           LFNSKYELLLQ        F ++W  TC
Sbjct: 118 LFNSKYELLLQQRSATKVTFPLVWTNTC 145

Source: Humulus lupulus

Species: Humulus lupulus

Genus: Humulus

Family: Cannabaceae

Order: Rosales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|359903129|gb|AEV89962.1| isopentenyl-diphosphate isomerase [Humulus lupulus] Back     alignment and taxonomy information
>gi|74027234|gb|AAZ94730.1| isopentenyl diphosphate isomerase [Ipomoea batatas] Back     alignment and taxonomy information
>gi|6225532|sp|O48965.1|IDI2_CAMAC RecName: Full=Isopentenyl-diphosphate Delta-isomerase II; AltName: Full=Isopentenyl pyrophosphate isomerase II; Short=IPP isomerase II gi|2736288|gb|AAB94133.1| isopentenyl diphosphate isomerase II [Camptotheca acuminata] Back     alignment and taxonomy information
>gi|309754781|gb|ADO87008.1| isopentyl diphosphate isomerase [Santalum album] Back     alignment and taxonomy information
>gi|79514626|ref|NP_197148.3| Isopentenyl-diphosphate Delta-isomerase I [Arabidopsis thaliana] gi|334302895|sp|Q38929.3|IDI1_ARATH RecName: Full=Isopentenyl-diphosphate Delta-isomerase I, chloroplastic; AltName: Full=Isopentenyl pyrophosphate isomerase I; Short=IPP isomerase I; Flags: Precursor gi|9759126|dbj|BAB09611.1| isopentenyl pyrophosphate:dimethyllallyl pyrophosphate isomerase [Arabidopsis thaliana] gi|332004909|gb|AED92292.1| Isopentenyl-diphosphate Delta-isomerase I [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|1213442|gb|AAB67741.1| isopentenyl pyrophosphate isomerase [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|157072591|gb|ABV08818.1| isopentenyl pyrophosphate isomerase [Salvia miltiorrhiza] Back     alignment and taxonomy information
>gi|297807669|ref|XP_002871718.1| isopentenyl pyrophosphate isomerase [Arabidopsis lyrata subsp. lyrata] gi|297317555|gb|EFH47977.1| isopentenyl pyrophosphate isomerase [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|347664497|gb|AEP17009.1| isopentenyl diphosphate isomerase II(IPI2) [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query182
TAIR|locus:2171382 291 IPP1 "isopentenyl diphosphate 0.467 0.292 0.758 8.8e-31
TAIR|locus:2075412 284 IPP2 "isopentenyl pyrophosphat 0.445 0.285 0.755 1.3e-29
UNIPROTKB|I3LDY2 287 LOC100739304 "Uncharacterized 0.472 0.299 0.505 1.5e-14
UNIPROTKB|Q1LZ95 227 IDI1 "Isopentenyl-diphosphate 0.373 0.299 0.605 2.3e-14
UNIPROTKB|G4MT46 254 MGG_07125 "Isopentenyl-diphosp 0.450 0.322 0.516 2.3e-14
UNIPROTKB|F1NZX3 233 IDI1 "Uncharacterized protein" 0.379 0.296 0.541 2.1e-13
ASPGD|ASPL0000061206 268 AN0579 [Emericella nidulans (t 0.527 0.358 0.429 3.4e-13
UNIPROTKB|C9JKM8122 IDI1 "Isopentenyl-diphosphate 0.329 0.491 0.596 5.6e-13
UNIPROTKB|Q13907 227 IDI1 "Isopentenyl-diphosphate 0.329 0.264 0.596 5.6e-13
UNIPROTKB|Q9BXS1 227 IDI2 "Isopentenyl-diphosphate 0.357 0.286 0.529 9.1e-13
TAIR|locus:2171382 IPP1 "isopentenyl diphosphate isomerase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 339 (124.4 bits), Expect = 8.8e-31, P = 8.8e-31
 Identities = 69/91 (75%), Positives = 74/91 (81%)

Query:    68 TMGDATTDAGMDAVQRRLMFEDECILVDENDRVVGHENKYNCHLMEKIESLNLLHRAFSV 127
             TM D+  DAGMDAVQRRLMFEDECILVDENDRVVGH+ KYNCHLMEKIE+ NLLHRAFSV
Sbjct:    58 TMTDSN-DAGMDAVQRRLMFEDECILVDENDRVVGHDTKYNCHLMEKIEAENLLHRAFSV 116

Query:   128 FLFNSKYELLLQV-----CLFCILWVKTCLS 153
             FLFNSKYELLLQ        F ++W  TC S
Sbjct:   117 FLFNSKYELLLQQRSKTKVTFPLVWTNTCCS 147
GO:0004452 "isopentenyl-diphosphate delta-isomerase activity" evidence=IEA;IDA;IMP
GO:0008299 "isoprenoid biosynthetic process" evidence=IEA;TAS
GO:0009507 "chloroplast" evidence=ISM;IDA
GO:0016787 "hydrolase activity" evidence=IEA
GO:0005829 "cytosol" evidence=IDA
GO:0009240 "isopentenyl diphosphate biosynthetic process" evidence=IMP
GO:0009536 "plastid" evidence=IDA
GO:0015995 "chlorophyll biosynthetic process" evidence=TAS
TAIR|locus:2075412 IPP2 "isopentenyl pyrophosphate:dimethylallyl pyrophosphate isomerase 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|I3LDY2 LOC100739304 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q1LZ95 IDI1 "Isopentenyl-diphosphate Delta-isomerase 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|G4MT46 MGG_07125 "Isopentenyl-diphosphate Delta-isomerase" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
UNIPROTKB|F1NZX3 IDI1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ASPGD|ASPL0000061206 AN0579 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
UNIPROTKB|C9JKM8 IDI1 "Isopentenyl-diphosphate Delta-isomerase 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q13907 IDI1 "Isopentenyl-diphosphate Delta-isomerase 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q9BXS1 IDI2 "Isopentenyl-diphosphate Delta-isomerase 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer5.3.3.20.824
3rd Layer5.3.30.766

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query182
PLN02552 247 PLN02552, PLN02552, isopentenyl-diphosphate delta- 6e-45
cd02885165 cd02885, IPP_Isomerase, Isopentenyl diphosphate (I 2e-22
TIGR02150158 TIGR02150, IPP_isom_1, isopentenyl-diphosphate del 9e-18
COG1443185 COG1443, Idi, Isopentenyldiphosphate isomerase [Li 7e-15
PRK03759184 PRK03759, PRK03759, isopentenyl-diphosphate delta- 5e-07
>gnl|CDD|215303 PLN02552, PLN02552, isopentenyl-diphosphate delta-isomerase Back     alignment and domain information 
 Score =  148 bits (375), Expect = 6e-45
 Identities = 63/92 (68%), Positives = 67/92 (72%), Gaps = 5/92 (5%)

Query: 67  STMGDATTDAGMDAVQRRLMFEDECILVDENDRVVGHENKYNCHLMEKIESLNLLHRAFS 126
                  T AGMDAVQRRLMFEDECILVDEND VVGH++KYNCHL EKIE   LLHRAFS
Sbjct: 1   MGTMADATWAGMDAVQRRLMFEDECILVDENDNVVGHDSKYNCHLFEKIEPRGLLHRAFS 60

Query: 127 VFLFNSKYELLLQV-----CLFCILWVKTCLS 153
           VFLFNSKYELLLQ        F ++W  TC S
Sbjct: 61  VFLFNSKYELLLQQRAATKVTFPLVWTNTCCS 92

Length = 247
>gnl|CDD|239218 cd02885, IPP_Isomerase, Isopentenyl diphosphate (IPP) isomerase, a member of the Nudix hydrolase superfamily, is a key enzyme in the isoprenoid biosynthetic pathway Back     alignment and domain information
>gnl|CDD|233749 TIGR02150, IPP_isom_1, isopentenyl-diphosphate delta-isomerase, type 1 Back     alignment and domain information
>gnl|CDD|224360 COG1443, Idi, Isopentenyldiphosphate isomerase [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|235156 PRK03759, PRK03759, isopentenyl-diphosphate delta-isomerase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 182
PLN02552 247 isopentenyl-diphosphate delta-isomerase 100.0
KOG0142225 consensus Isopentenyl pyrophosphate:dimethylallyl 99.96
COG1443185 Idi Isopentenyldiphosphate isomerase [Lipid metabo 99.94
PLN02791 770 Nudix hydrolase homolog 99.92
cd03676180 Nudix_hydrolase_3 Members of the Nudix hydrolase s 99.91
PRK03759184 isopentenyl-diphosphate delta-isomerase; Provision 99.9
cd02885165 IPP_Isomerase Isopentenyl diphosphate (IPP) isomer 99.89
PRK15393180 NUDIX hydrolase YfcD; Provisional 99.89
TIGR02150158 IPP_isom_1 isopentenyl-diphosphate delta-isomerase 99.89
cd04692144 Nudix_Hydrolase_33 Members of the Nudix hydrolase 99.63
cd04697126 Nudix_Hydrolase_38 Members of the Nudix hydrolase 99.51
cd04693127 Nudix_Hydrolase_34 Members of the Nudix hydrolase 99.39
PRK15472141 nucleoside triphosphatase NudI; Provisional 99.31
PF00293134 NUDIX: NUDIX domain; InterPro: IPR000086 The gener 99.13
cd04682122 Nudix_Hydrolase_23 Members of the Nudix hydrolase 99.08
cd04694143 Nudix_Hydrolase_35 Members of the Nudix hydrolase 99.05
cd04681130 Nudix_Hydrolase_22 Members of the Nudix hydrolase 99.05
cd04664129 Nudix_Hydrolase_7 Members of the Nudix hydrolase s 99.02
cd04696125 Nudix_Hydrolase_37 Members of the Nudix hydrolase 99.0
cd04678129 Nudix_Hydrolase_19 Members of the Nudix hydrolase 99.0
cd03430144 GDPMH GDP-mannose glycosyl hydrolase (AKA GDP-mann 98.97
PRK09438148 nudB dihydroneopterin triphosphate pyrophosphatase 98.97
cd03426157 CoAse Coenzyme A pyrophosphatase (CoAse), a member 98.97
cd03674138 Nudix_Hydrolase_1 Members of the Nudix hydrolase s 98.93
cd04685133 Nudix_Hydrolase_26 Members of the Nudix hydrolase 98.93
PRK00714156 RNA pyrophosphohydrolase; Reviewed 98.92
cd04679125 Nudix_Hydrolase_20 Members of the Nudix hydrolase 98.92
cd04680120 Nudix_Hydrolase_21 Members of the Nudix hydrolase 98.91
PRK15434159 GDP-mannose mannosyl hydrolase NudD; Provisional 98.9
cd03671147 Ap4A_hydrolase_plant_like Diadenosine tetraphospha 98.9
cd03424137 ADPRase_NUDT5 ADP-ribose pyrophosphatase (ADPRase) 98.89
cd04700142 DR1025_like DR1025 from Deinococcus radiodurans, a 98.88
cd04670127 Nudix_Hydrolase_12 Members of the Nudix hydrolase 98.87
cd04699129 Nudix_Hydrolase_39 Members of the Nudix hydrolase 98.86
cd04683120 Nudix_Hydrolase_24 Members of the Nudix hydrolase 98.86
cd04677132 Nudix_Hydrolase_18 Members of the Nudix hydrolase 98.85
cd03429131 NADH_pyrophosphatase NADH pyrophosphatase, a membe 98.85
cd04673122 Nudix_Hydrolase_15 Members of the Nudix hydrolase 98.76
PLN02839 372 nudix hydrolase 98.75
cd04671123 Nudix_Hydrolase_13 Members of the Nudix hydrolase 98.74
cd04684128 Nudix_Hydrolase_25 Contains a crystal structure of 98.73
cd04676129 Nudix_Hydrolase_17 Members of the Nudix hydrolase 98.7
cd02883123 Nudix_Hydrolase Nudix hydrolase is a superfamily o 98.69
cd03425124 MutT_pyrophosphohydrolase The MutT pyrophosphohydr 98.68
cd03427137 MTH1 MutT homolog-1 (MTH1) is a member of the Nudi 98.67
PRK10776129 nucleoside triphosphate pyrophosphohydrolase; Prov 98.67
cd03673131 Ap6A_hydrolase Diadenosine hexaphosphate (Ap6A) hy 98.6
cd04688126 Nudix_Hydrolase_29 Members of the Nudix hydrolase 98.57
cd04691117 Nudix_Hydrolase_32 Members of the Nudix hydrolase 98.54
PRK10546135 pyrimidine (deoxy)nucleoside triphosphate pyrophos 98.53
cd04690118 Nudix_Hydrolase_31 Members of the Nudix hydrolase 98.52
cd04687128 Nudix_Hydrolase_28 Members of the Nudix hydrolase 98.52
cd03672145 Dcp2p mRNA decapping enzyme 2 (Dcp2p), the catalyt 98.47
cd04669121 Nudix_Hydrolase_11 Members of the Nudix hydrolase 98.47
TIGR00586128 mutt mutator mutT protein. All proteins in this fa 98.47
cd04672123 Nudix_Hydrolase_14 Members of the Nudix hydrolase 98.46
cd04511130 Nudix_Hydrolase_4 Members of the Nudix hydrolase s 98.37
cd03428130 Ap4A_hydrolase_human_like Diadenosine tetraphospha 98.37
cd04689125 Nudix_Hydrolase_30 Members of the Nudix hydrolase 98.34
PLN02325144 nudix hydrolase 98.29
cd04695131 Nudix_Hydrolase_36 Members of the Nudix hydrolase 98.28
cd03675134 Nudix_Hydrolase_2 Contains a crystal structure of 98.22
cd04686131 Nudix_Hydrolase_27 Members of the Nudix hydrolase 98.11
cd04667112 Nudix_Hydrolase_10 Members of the Nudix hydrolase 98.09
COG1051145 ADP-ribose pyrophosphatase [Nucleotide transport a 98.09
PRK08999 312 hypothetical protein; Provisional 98.09
cd04674118 Nudix_Hydrolase_16 Members of the Nudix hydrolase 97.95
PRK00241256 nudC NADH pyrophosphatase; Reviewed 97.95
PRK05379340 bifunctional nicotinamide mononucleotide adenylylt 97.88
cd04662126 Nudix_Hydrolase_5 Members of the Nudix hydrolase s 97.88
PRK11762185 nudE adenosine nucleotide hydrolase NudE; Provisio 97.84
cd04666122 Nudix_Hydrolase_9 Members of the Nudix hydrolase s 97.71
COG0494161 MutT NTP pyrophosphohydrolases including oxidative 97.7
cd04665118 Nudix_Hydrolase_8 Members of the Nudix hydrolase s 97.61
cd03431118 DNA_Glycosylase_C DNA glycosylase (MutY in bacteri 97.6
cd04661132 MRP_L46 Mitochondrial ribosomal protein L46 (MRP L 97.57
TIGR00052185 nudix-type nucleoside diphosphatase, YffH/AdpP fam 97.49
PRK10729202 nudF ADP-ribose pyrophosphatase NudF; Provisional 97.39
PRK10707190 putative NUDIX hydrolase; Provisional 97.11
cd04663126 Nudix_Hydrolase_6 Members of the Nudix hydrolase s 96.98
TIGR02705156 nudix_YtkD nucleoside triphosphatase YtkD. The fun 96.59
PRK15009191 GDP-mannose pyrophosphatase NudK; Provisional 96.57
COG2816279 NPY1 NTP pyrophosphohydrolases containing a Zn-fin 96.33
PLN02709 222 nudix hydrolase 96.3
cd03670186 ADPRase_NUDT9 ADP-ribose pyrophosphatase (ADPRase) 96.2
KOG3084345 consensus NADH pyrophosphatase I of the Nudix fami 96.09
KOG4313 306 consensus Thiamine pyrophosphokinase [Nucleotide t 95.89
PLN03143291 nudix hydrolase; Provisional 95.22
KOG2839145 consensus Diadenosine and diphosphoinositol polyph 94.96
KOG3041225 consensus Nucleoside diphosphate-sugar hydrolase o 94.73
KOG0648 295 consensus Predicted NUDIX hydrolase FGF-2 and rela 93.78
PF14815114 NUDIX_4: NUDIX domain; PDB: 1VRL_A 1RRQ_A 3G0Q_A 3 90.18
COG4112203 Predicted phosphoesterase (MutT family) [General f 82.22
>PLN02552 isopentenyl-diphosphate delta-isomerase Back     alignment and domain information 
Probab=100.00  E-value=2e-34  Score=247.56  Aligned_cols=108  Identities=58%  Similarity=0.819  Sum_probs=98.7

Q ss_pred             cCCCCccccccHHHHHhhhcCeEEEeecCCcEEeeeechhchhhhccccCCccEEEEEEEEEcCCCcEEEEe-----ecC
Q 030138           69 MGDATTDAGMDAVQRRLMFEDECILVDENDRVVGHENKYNCHLMEKIESLNLLHRAFSVFLFNSKYELLLQV-----CLF  143 (182)
Q Consensus        69 ~~~~~~~~~~d~~Q~~~M~eE~vdLVDe~d~~iG~~~R~~~Hr~e~i~~~GLlHRAfsVfLFNs~GeLLLQq-----~~f  143 (182)
                      +|.|...++||+.|+++|++|.|+|||+||+++|.++|++||+++++.++|+|||||+|||||++|+|||||     ++|
T Consensus         3 ~~~~~~~~~~~~~q~~~~~~e~v~lvDe~d~~~G~~~r~~~H~~~~~~~~gl~Hra~~v~i~n~~g~lLLQkRs~~K~~~   82 (247)
T PLN02552          3 TMADATWAGMDAVQRRLMFEDECILVDENDNVVGHDSKYNCHLFEKIEPRGLLHRAFSVFLFNSKYELLLQQRAATKVTF   82 (247)
T ss_pred             ccccccccccCHHHHhhhhcCeEEEEcCCCCEEeeeEHhhhhccccccCCCceEEEEEEEEEcCCCeEEEEEecCCCCCC
Confidence            577889999999999999889999999999999999999999865554489999999999999999999999     789


Q ss_pred             CCceecccccCcCCCCC-----------------HHHHHHhhhhccCceE
Q 030138          144 CILWVKTCLSMDCHWVV-----------------QICGLTWEMTDSNILF  176 (182)
Q Consensus       144 PglWDnTcgGHplaGEs-----------------~~eAA~REl~ee~~~~  176 (182)
                      ||+||+||||||.+||+                 ..+||+|||.||.+.-
T Consensus        83 Pg~Wd~s~~GHp~~ge~~~e~~~e~~~~~~~~~~~~eAA~REL~EElGI~  132 (247)
T PLN02552         83 PLVWTNTCCSHPLYGQDPNEVDRESELIDGNVLGVKNAAQRKLLHELGIP  132 (247)
T ss_pred             CcceecccCCccccccccccccccccccccchhhHHHHHHhHHHHHhCCC
Confidence            99999999999999854                 5789999999998764

>KOG0142 consensus Isopentenyl pyrophosphate:dimethylallyl pyrophosphate isomerase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG1443 Idi Isopentenyldiphosphate isomerase [Lipid metabolism] Back     alignment and domain information
>PLN02791 Nudix hydrolase homolog Back     alignment and domain information
>cd03676 Nudix_hydrolase_3 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PRK03759 isopentenyl-diphosphate delta-isomerase; Provisional Back     alignment and domain information
>cd02885 IPP_Isomerase Isopentenyl diphosphate (IPP) isomerase, a member of the Nudix hydrolase superfamily, is a key enzyme in the isoprenoid biosynthetic pathway Back     alignment and domain information
>PRK15393 NUDIX hydrolase YfcD; Provisional Back     alignment and domain information
>TIGR02150 IPP_isom_1 isopentenyl-diphosphate delta-isomerase, type 1 Back     alignment and domain information
>cd04692 Nudix_Hydrolase_33 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04697 Nudix_Hydrolase_38 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04693 Nudix_Hydrolase_34 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PRK15472 nucleoside triphosphatase NudI; Provisional Back     alignment and domain information
>PF00293 NUDIX: NUDIX domain; InterPro: IPR000086 The generic name 'NUDIX hydrolases' (NUcleoside DIphosphate linked to some other moiety X) has been coined for this domain family [] Back     alignment and domain information
>cd04682 Nudix_Hydrolase_23 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04694 Nudix_Hydrolase_35 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04681 Nudix_Hydrolase_22 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04664 Nudix_Hydrolase_7 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04696 Nudix_Hydrolase_37 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04678 Nudix_Hydrolase_19 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd03430 GDPMH GDP-mannose glycosyl hydrolase (AKA GDP-mannose mannosyl hydrolase (GDPMH)) is a member of the Nudix hydrolase superfamily Back     alignment and domain information
>PRK09438 nudB dihydroneopterin triphosphate pyrophosphatase; Provisional Back     alignment and domain information
>cd03426 CoAse Coenzyme A pyrophosphatase (CoAse), a member of the Nudix hydrolase superfamily, functions to catalyze the elimination of oxidized inactive CoA, which can inhibit CoA-utilizing enzymes Back     alignment and domain information
>cd03674 Nudix_Hydrolase_1 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04685 Nudix_Hydrolase_26 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PRK00714 RNA pyrophosphohydrolase; Reviewed Back     alignment and domain information
>cd04679 Nudix_Hydrolase_20 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04680 Nudix_Hydrolase_21 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PRK15434 GDP-mannose mannosyl hydrolase NudD; Provisional Back     alignment and domain information
>cd03671 Ap4A_hydrolase_plant_like Diadenosine tetraphosphate (Ap4A) hydrolase is a member of the Nudix hydrolase superfamily Back     alignment and domain information
>cd03424 ADPRase_NUDT5 ADP-ribose pyrophosphatase (ADPRase) catalyzes the hydrolysis of ADP-ribose and a variety of additional ADP-sugar conjugates to AMP and ribose-5-phosphate Back     alignment and domain information
>cd04700 DR1025_like DR1025 from Deinococcus radiodurans, a member of the Nudix hydrolase superfamily, show nucleoside triphosphatase and dinucleoside polyphosphate pyrophosphatase activities Back     alignment and domain information
>cd04670 Nudix_Hydrolase_12 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04699 Nudix_Hydrolase_39 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04683 Nudix_Hydrolase_24 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04677 Nudix_Hydrolase_18 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd03429 NADH_pyrophosphatase NADH pyrophosphatase, a member of the Nudix hydrolase superfamily, catalyzes the cleavage of NADH into reduced nicotinamide mononucleotide (NMNH) and AMP Back     alignment and domain information
>cd04673 Nudix_Hydrolase_15 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PLN02839 nudix hydrolase Back     alignment and domain information
>cd04671 Nudix_Hydrolase_13 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04684 Nudix_Hydrolase_25 Contains a crystal structure of the Nudix hydrolase from Enterococcus faecalis, which has an unknown function Back     alignment and domain information
>cd04676 Nudix_Hydrolase_17 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd02883 Nudix_Hydrolase Nudix hydrolase is a superfamily of enzymes found in all three kingdoms of life, and it catalyzes the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd03425 MutT_pyrophosphohydrolase The MutT pyrophosphohydrolase is a prototypical Nudix hydrolase that catalyzes the hydrolysis of nucleoside and deoxynucleoside triphosphates (NTPs and dNTPs) by substitution at a beta-phosphorus to yield a nucleotide monophosphate (NMP) and inorganic pyrophosphate (PPi) Back     alignment and domain information
>cd03427 MTH1 MutT homolog-1 (MTH1) is a member of the Nudix hydrolase superfamily Back     alignment and domain information
>PRK10776 nucleoside triphosphate pyrophosphohydrolase; Provisional Back     alignment and domain information
>cd03673 Ap6A_hydrolase Diadenosine hexaphosphate (Ap6A) hydrolase is a member of the Nudix hydrolase superfamily Back     alignment and domain information
>cd04688 Nudix_Hydrolase_29 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04691 Nudix_Hydrolase_32 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PRK10546 pyrimidine (deoxy)nucleoside triphosphate pyrophosphohydrolase; Provisional Back     alignment and domain information
>cd04690 Nudix_Hydrolase_31 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04687 Nudix_Hydrolase_28 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd03672 Dcp2p mRNA decapping enzyme 2 (Dcp2p), the catalytic subunit, and Dcp1p are the two components of the decapping enzyme complex Back     alignment and domain information
>cd04669 Nudix_Hydrolase_11 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>TIGR00586 mutt mutator mutT protein Back     alignment and domain information
>cd04672 Nudix_Hydrolase_14 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04511 Nudix_Hydrolase_4 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd03428 Ap4A_hydrolase_human_like Diadenosine tetraphosphate (Ap4A) hydrolase is a member of the Nudix hydrolase superfamily Back     alignment and domain information
>cd04689 Nudix_Hydrolase_30 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PLN02325 nudix hydrolase Back     alignment and domain information
>cd04695 Nudix_Hydrolase_36 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd03675 Nudix_Hydrolase_2 Contains a crystal structure of the Nudix hydrolase from Nitrosomonas europaea, which has an unknown function Back     alignment and domain information
>cd04686 Nudix_Hydrolase_27 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04667 Nudix_Hydrolase_10 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>COG1051 ADP-ribose pyrophosphatase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK08999 hypothetical protein; Provisional Back     alignment and domain information
>cd04674 Nudix_Hydrolase_16 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PRK00241 nudC NADH pyrophosphatase; Reviewed Back     alignment and domain information
>PRK05379 bifunctional nicotinamide mononucleotide adenylyltransferase/ADP-ribose pyrophosphatase; Provisional Back     alignment and domain information
>cd04662 Nudix_Hydrolase_5 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PRK11762 nudE adenosine nucleotide hydrolase NudE; Provisional Back     alignment and domain information
>cd04666 Nudix_Hydrolase_9 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>COG0494 MutT NTP pyrophosphohydrolases including oxidative damage repair enzymes [DNA replication, recombination, and repair / General function prediction only] Back     alignment and domain information
>cd04665 Nudix_Hydrolase_8 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd03431 DNA_Glycosylase_C DNA glycosylase (MutY in bacteria and hMYH in humans) is responsible for repairing misread A*oxoG residues to C*G by removing the inappropriately paired adenine base from the DNA backbone Back     alignment and domain information
>cd04661 MRP_L46 Mitochondrial ribosomal protein L46 (MRP L46) is a component of the large subunit (39S) of the mammalian mitochondrial ribosome and a member of the Nudix hydrolase superfamily Back     alignment and domain information
>TIGR00052 nudix-type nucleoside diphosphatase, YffH/AdpP family Back     alignment and domain information
>PRK10729 nudF ADP-ribose pyrophosphatase NudF; Provisional Back     alignment and domain information
>PRK10707 putative NUDIX hydrolase; Provisional Back     alignment and domain information
>cd04663 Nudix_Hydrolase_6 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>TIGR02705 nudix_YtkD nucleoside triphosphatase YtkD Back     alignment and domain information
>PRK15009 GDP-mannose pyrophosphatase NudK; Provisional Back     alignment and domain information
>COG2816 NPY1 NTP pyrophosphohydrolases containing a Zn-finger, probably nucleic-acid-binding [DNA replication, recombination, and repair] Back     alignment and domain information
>PLN02709 nudix hydrolase Back     alignment and domain information
>cd03670 ADPRase_NUDT9 ADP-ribose pyrophosphatase (ADPRase) catalyzes the hydrolysis of ADP-ribose to AMP and ribose-5-P Back     alignment and domain information
>KOG3084 consensus NADH pyrophosphatase I of the Nudix family of hydrolases [Replication, recombination and repair] Back     alignment and domain information
>KOG4313 consensus Thiamine pyrophosphokinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PLN03143 nudix hydrolase; Provisional Back     alignment and domain information
>KOG2839 consensus Diadenosine and diphosphoinositol polyphosphate phosphohydrolase [Signal transduction mechanisms] Back     alignment and domain information
>KOG3041 consensus Nucleoside diphosphate-sugar hydrolase of the MutT (NUDIX) family [Replication, recombination and repair] Back     alignment and domain information
>KOG0648 consensus Predicted NUDIX hydrolase FGF-2 and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF14815 NUDIX_4: NUDIX domain; PDB: 1VRL_A 1RRQ_A 3G0Q_A 3FSQ_A 1RRS_A 3FSP_A Back     alignment and domain information
>COG4112 Predicted phosphoesterase (MutT family) [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query182
2i6k_A 235 Crystal Structure Of Human Type I Ipp Isomerase Com 2e-12
2pny_A 246 Structure Of Human Isopentenyl-Diphosphate Delta-Is 2e-12
2icj_A 233 The Crystal Structure Of Human Isopentenyl Diphopha 3e-12
2dho_A 235 Crystal Structure Of Human Ipp Isomerase I In Space 3e-12
>pdb|2I6K|A Chain A, Crystal Structure Of Human Type I Ipp Isomerase Complexed With A Substrate Analog Length = 235 Back     alignment and structure 
Iteration: 1

 Score = 68.6 bits (166), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 37/62 (59%), Positives = 45/62 (72%), Gaps = 2/62 (3%)
Query: 78  MDAVQRRLMFEDECILVDENDRVVGHENKYNCHLMEKIESLNLLHRAFSVFLFNSKYELL 137
           +D  Q +L+ E  CIL+DEND  +G E K NCHL E IE   LLHRAFSVFLFN++ +LL
Sbjct: 17  LDKQQVQLLAE-XCILIDENDNKIGAETKKNCHLNENIEK-GLLHRAFSVFLFNTENKLL 74
Query: 138 LQ 139
           LQ
Sbjct: 75  LQ 76
>pdb|2PNY|A Chain A, Structure Of Human Isopentenyl-Diphosphate Delta-Isomerase 2 Length = 246 Back     alignment and structure
>pdb|2ICJ|A Chain A, The Crystal Structure Of Human Isopentenyl Diphophate Isomerase Length = 233 Back     alignment and structure
>pdb|2DHO|A Chain A, Crystal Structure Of Human Ipp Isomerase I In Space Group P212121 Length = 235 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query182
2pny_A 246 Isopentenyl-diphosphate delta-isomerase 2; caroten 6e-24
2dho_A 235 Isopentenyl-diphosphate delta-isomerase 1; alpha/b 2e-23
1hzt_A190 Isopentenyl diphosphate delta-isomerase; dimethyla 2e-18
1q27_A171 Putative nudix hydrolase DR0079; radiation resista 6e-17
2fkb_A180 Putative nudix hydrolase YFCD; putative protein, M 2e-15
>2pny_A Isopentenyl-diphosphate delta-isomerase 2; carotenoid biosynthesis, cholesterol biosynthesis, isomerase isoprene biosynthesis, lipid synthesis; HET: GOL; 1.81A {Homo sapiens} Length = 246 Back     alignment and structure
 Score = 93.7 bits (232), Expect = 6e-24
 Identities = 38/80 (47%), Positives = 50/80 (62%), Gaps = 3/80 (3%)

Query: 60  SSSARAISTMGDATTDAGMDAVQRRLMFEDECILVDENDRVVGHENKYNCHLMEKIESLN 119
           SS      +M D   D  +D  Q + + E+  I+VDEND+V+G + K NCHL E IE   
Sbjct: 11  SSGLVPRGSMSDINLD-WVDRRQLQRL-EEMLIVVDENDKVIGADTKRNCHLNENIEK-G 67

Query: 120 LLHRAFSVFLFNSKYELLLQ 139
           LLHRAFSV LFN+K  +L+Q
Sbjct: 68  LLHRAFSVVLFNTKNRILIQ 87
>2dho_A Isopentenyl-diphosphate delta-isomerase 1; alpha/beta protein; 1.60A {Homo sapiens} PDB: 2i6k_A* 2icj_A 2ick_A* Length = 235 Back     alignment and structure
>1hzt_A Isopentenyl diphosphate delta-isomerase; dimethylallyl, isoprenoids; 1.45A {Escherichia coli} SCOP: d.113.1.2 PDB: 1hx3_A 1r67_A 1x84_A* 1x83_A* 1ppv_A* 1nfz_A* 1nfs_A* 1ppw_A* 1pvf_A 2veh_A* 2vej_A 2vnp_A* 2vnq_A 2g74_A 2g73_A* 2b2k_A 1i9a_A 1q54_A* 1ow2_A* 3hyq_A* Length = 190 Back     alignment and structure
>1q27_A Putative nudix hydrolase DR0079; radiation resistance; NMR {Deinococcus radiodurans} SCOP: d.113.1.2 PDB: 2o5f_A Length = 171 Back     alignment and structure
>2fkb_A Putative nudix hydrolase YFCD; putative protein, MAD, structural genomics, escherichia coli putative nudix hydrolase, PSI; HET: MSE; 2.00A {Escherichia coli K12} SCOP: d.113.1.2 Length = 180 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query182
2pny_A 246 Isopentenyl-diphosphate delta-isomerase 2; caroten 99.96
2dho_A 235 Isopentenyl-diphosphate delta-isomerase 1; alpha/b 99.95
3dup_A 300 MUTT/nudix family protein; nudix superfamily hydro 99.84
1hzt_A190 Isopentenyl diphosphate delta-isomerase; dimethyla 99.82
2fkb_A180 Putative nudix hydrolase YFCD; putative protein, M 99.81
1q27_A171 Putative nudix hydrolase DR0079; radiation resista 99.71
1f3y_A165 Diadenosine 5',5'''-P1,P4-tetraphosphate hydrolase 99.26
1sjy_A159 MUTT/nudix family protein; nudix fold, alpha-beta- 99.05
3oga_A165 Nucleoside triphosphatase NUDI; salmonella enteric 99.03
3eds_A153 MUTT/nudix family protein; MUT/nudix protein, prot 99.0
3grn_A153 MUTT related protein; structural genomics, hydrola 98.97
1rya_A160 GDP-mannose mannosyl hydrolase; GDP-glucose, nudix 98.93
3r03_A144 Nudix hydrolase; structural genomics, PSI2, protei 98.92
3fcm_A197 Hydrolase, nudix family; protein structure initiat 98.91
2kdv_A164 RNA pyrophosphohydrolase; nudix family, magnesium, 98.91
2rrk_A140 ORF135, CTP pyrophosphohydrolase; NMR {Escherichia 98.89
3gg6_A156 Nudix motif 18, nucleoside diphosphate-linked moie 98.88
3hhj_A158 Mutator MUTT protein; niaid, ssgcid, decode, UW, S 98.87
3ees_A153 Probable pyrophosphohydrolase; nudix, RNA pyrophos 98.83
2o1c_A150 DATP pyrophosphohydrolase; nudix NTP hydrolase NTP 98.82
2fvv_A194 Diphosphoinositol polyphosphate phosphohydrolase 1 98.82
3f6a_A159 Hydrolase, nudix family; protein structure initiat 98.81
1mut_A129 MUTT, nucleoside triphosphate pyrophosphohydrolase 98.79
3gwy_A140 Putative CTP pyrophosphohydrolase; structural geno 98.79
3exq_A161 Nudix family hydrolase; protein structure initiati 98.78
3e57_A211 Uncharacterized protein TM1382; structural genomic 98.78
2yvp_A182 NDX2, MUTT/nudix family protein; nudix protein, AD 98.77
4dyw_A157 MUTT/nudix family protein; structural genomics, ni 98.76
2jvb_A146 Protein PSU1, mRNA-decapping enzyme subunit 2; DCP 98.76
1v8y_A170 ADP-ribose pyrophosphatase; nudix motif, loop-heli 98.75
1ktg_A138 Diadenosine tetraphosphate hydrolase; nudix, AMP, 98.75
1nqz_A194 COA pyrophosphatase (MUTT/nudix family protein); D 98.72
2pqv_A154 MUTT/nudix family protein; structu genomics, PSI-2 98.72
3q93_A176 7,8-dihydro-8-oxoguanine triphosphatase; structura 98.71
2b06_A155 MUTT/nudix family protein; structural genomics, P 98.7
1vcd_A126 NDX1; nudix protein, diadenosine polyphosphate, AP 98.7
1k2e_A156 Nudix homolog; nudix/MUTT-like fold, mixed alpha/b 98.69
3son_A149 Hypothetical nudix hydrolase; structural genomics, 98.68
2yyh_A139 MUTT domain, 8-OXO-DGTPase domain; nudix family pr 98.66
3shd_A153 Phosphatase NUDJ; nudix fold, nudix motif, hydrola 98.65
2w4e_A145 MUTT/nudix family protein; ADP-ribose pyrophosphat 98.62
2pbt_A134 AP4A hydrolase; nudix protein, diadenosine polypho 98.62
3u53_A155 BIS(5'-nucleosyl)-tetraphosphatase [asymmetrical]; 98.62
2azw_A148 MUTT/nudix family protein; MUTT/nudix ,enterococcu 98.57
3id9_A171 MUTT/nudix family protein; hydrolase, protein stru 98.55
3cng_A189 Nudix hydrolase; structural genomics, APC7497, PSI 98.54
3h95_A 199 Nucleoside diphosphate-linked moiety X motif 6; NU 98.53
2b0v_A153 Nudix hydrolase; structural genomics, PSI, protein 98.5
3fk9_A 188 Mutator MUTT protein; structural genomics, hydrola 98.5
2fb1_A 226 Conserved hypothetical protein; structural genomic 98.49
1mk1_A207 ADPR pyrophosphatase; nudix hydrolase, adprase, ad 98.47
3i7u_A134 AP4A hydrolase; nudix protein, diadenosine polypho 98.47
3i9x_A187 MUTT/nudix family protein; structural genomics, hy 98.44
3o6z_A191 GDP-mannose pyrophosphatase NUDK; nudix, hydrolase 98.44
3q1p_A205 Phosphohydrolase (MUTT/nudix family protein); asym 98.43
2qjo_A341 Bifunctional NMN adenylyltransferase/nudix hydrol; 98.4
1vhz_A198 ADP compounds hydrolase NUDE; structural genomics; 98.39
2a6t_A 271 SPAC19A8.12; alpha/beta/alpha, RNA binding protein 98.39
2qjt_B352 Nicotinamide-nucleotide adenylyltransferase; two i 98.39
1u20_A 212 U8 snoRNA-binding protein X29; modified nudix hydr 98.37
3gz5_A 240 MUTT/nudix family protein; DNA binding protein, nu 98.33
1g0s_A209 Hypothetical 23.7 kDa protein in ICC-TOLC intergen 98.31
3q91_A218 Uridine diphosphate glucose pyrophosphatase; struc 98.3
3f13_A163 Putative nudix hydrolase family member; structural 98.29
1x51_A155 A/G-specific adenine DNA glycosylase; nudix domain 98.28
3o8s_A206 Nudix hydrolase, ADP-ribose pyrophosphatase; struc 98.26
2fml_A 273 MUTT/nudix family protein; structural genomics, PS 98.11
3fsp_A369 A/G-specific adenine glycosylase; protein-DNA comp 98.11
1vk6_A269 NADH pyrophosphatase; 1790429, structural genomics 98.01
1q33_A 292 Pyrophosphatase, ADP-ribose pyrophosphatase; nudix 97.98
2dsc_A212 ADP-sugar pyrophosphatase; nudix domain, ADPR, ADP 97.98
3fjy_A 364 Probable MUTT1 protein; dimer, protein structure i 97.65
3qsj_A 232 Nudix hydrolase; structural genomics, PSI-biology, 97.35
3kvh_A 214 Protein syndesmos; NUDT16-like, NUDT16L1, nudix, R 97.32
2xsq_A 217 U8 snoRNA-decapping enzyme; hydrolase, mRNA decapp 97.24
3bho_A208 Cleavage and polyadenylation specificity factor su 95.78
3rh7_A321 Hypothetical oxidoreductase; FMN-binding split bar 93.28
>2pny_A Isopentenyl-diphosphate delta-isomerase 2; carotenoid biosynthesis, cholesterol biosynthesis, isomerase isoprene biosynthesis, lipid synthesis; HET: GOL; 1.81A {Homo sapiens} Back     alignment and structure
Probab=99.96  E-value=4.5e-30  Score=215.79  Aligned_cols=106  Identities=34%  Similarity=0.409  Sum_probs=97.3

Q ss_pred             ccCCCCccccccHHHHHhhhcCeEEEeecCCcEEeeeechhchhhhccccCCccEEEEEEEEEcCCCcEEEEe-----ec
Q 030138           68 TMGDATTDAGMDAVQRRLMFEDECILVDENDRVVGHENKYNCHLMEKIESLNLLHRAFSVFLFNSKYELLLQV-----CL  142 (182)
Q Consensus        68 ~~~~~~~~~~~d~~Q~~~M~eE~vdLVDe~d~~iG~~~R~~~Hr~e~i~~~GLlHRAfsVfLFNs~GeLLLQq-----~~  142 (182)
                      ..|++..+++||+.|+++| +|+|+|||++|+++|.++|.+||.+++|+ +|++||||+|+|||++|+|||||     .+
T Consensus        18 ~~~~~~~~~~~~~~q~~~~-~E~~~lvd~~~~~iG~~~r~~~h~~~~~~-~g~~h~av~v~v~~~~g~lLLqrRs~~K~~   95 (246)
T 2pny_A           18 GSMSDINLDWVDRRQLQRL-EEMLIVVDENDKVIGADTKRNCHLNENIE-KGLLHRAFSVVLFNTKNRILIQQRSDTKVT   95 (246)
T ss_dssp             SCGGGGCCTTSCHHHHHHT-TCEEEEECTTCCEEEEEEHHHHTBHHHHT-TTCCEEEEEEEEECTTCCEEEEEECTTCSS
T ss_pred             ccccccccccCCHHHHhhc-cceEEEEcCCCCEEEEEEhHHhccccccC-CCcEEEEEEEEEEeCCCEEEEEEecCCCCC
Confidence            4567779999999999988 68999999999999999999999877776 79999999999999999999998     57


Q ss_pred             CCCceecccccCcCCC------CCH---HHHHHhhhhccCce
Q 030138          143 FCILWVKTCLSMDCHW------VVQ---ICGLTWEMTDSNIL  175 (182)
Q Consensus       143 fPglWDnTcgGHplaG------Es~---~eAA~REl~ee~~~  175 (182)
                      |||+|+++|||||.+|      |+.   .+||+|||.||.+.
T Consensus        96 ~pG~W~~p~gG~v~~G~~E~~~Et~~~~~eAA~REl~EElGi  137 (246)
T 2pny_A           96 FPGYFTDSCSSHPLYNPAELEEKDAIGVRRAAQRRLQAELGI  137 (246)
T ss_dssp             STTCBCCSEEECCBSSHHHHCCGGGHHHHHHHHHHHHHHHCC
T ss_pred             CCCceEeccCceeccCCcccccccchhHHHHHHHHHHHHHCC
Confidence            9999999999999999      887   89999999999653
>2dho_A Isopentenyl-diphosphate delta-isomerase 1; alpha/beta protein; 1.60A {Homo sapiens} PDB: 2i6k_A* 2icj_A 2ick_A* Back     alignment and structure
>3dup_A MUTT/nudix family protein; nudix superfamily hydrolase, hydrolase 3 family, structural protein structure initiative, PSI; HET: MSE; 1.80A {Rhodospirillum rubrum atcc 11170} Back     alignment and structure
>1hzt_A Isopentenyl diphosphate delta-isomerase; dimethylallyl, isoprenoids; 1.45A {Escherichia coli} SCOP: d.113.1.2 PDB: 1hx3_A 1r67_A 1x84_A* 1x83_A* 1ppv_A* 1nfz_A* 1nfs_A* 1ppw_A* 1pvf_A 2veh_A* 2vej_A 2vnp_A* 2vnq_A 2g74_A 2g73_A* 2b2k_A 1i9a_A 1q54_A* 1ow2_A* 3hyq_A* Back     alignment and structure
>2fkb_A Putative nudix hydrolase YFCD; putative protein, MAD, structural genomics, escherichia coli putative nudix hydrolase, PSI; HET: MSE; 2.00A {Escherichia coli K12} SCOP: d.113.1.2 Back     alignment and structure
>1q27_A Putative nudix hydrolase DR0079; radiation resistance; NMR {Deinococcus radiodurans} SCOP: d.113.1.2 PDB: 2o5f_A Back     alignment and structure
>1f3y_A Diadenosine 5',5'''-P1,P4-tetraphosphate hydrolase; enzyme,mixed 4-stranded beta sheet, 2-stranded antiparallel sheet; NMR {Lupinus angustifolius} SCOP: d.113.1.1 PDB: 1jkn_A* Back     alignment and structure
>1sjy_A MUTT/nudix family protein; nudix fold, alpha-beta-alpha sandwich, structural genomics, BSGC structure funded by NIH; 1.39A {Deinococcus radiodurans} SCOP: d.113.1.1 PDB: 1soi_A 1su2_A* 1sz3_A* Back     alignment and structure
>3oga_A Nucleoside triphosphatase NUDI; salmonella enterica subsp. enterica serovar typhimurium STR. unknown function; HET: PO4; 1.75A {Salmonella enterica subsp} PDB: 3n77_A Back     alignment and structure
>3grn_A MUTT related protein; structural genomics, hydrolase, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics; 1.70A {Methanosarcina mazei} Back     alignment and structure
>1rya_A GDP-mannose mannosyl hydrolase; GDP-glucose, nudix, nudix Mg-complex; HET: GDP; 1.30A {Escherichia coli} SCOP: d.113.1.5 PDB: 2gt2_A 2gt4_A* 2i8t_A* 2i8u_A* Back     alignment and structure
>3r03_A Nudix hydrolase; structural genomics, PSI2, protein structure INIT NEW YORK SGX research center for structural genomics, nysgx; HET: ADP; 2.49A {Rhodospirillum rubrum} SCOP: d.113.1.0 Back     alignment and structure
>3fcm_A Hydrolase, nudix family; protein structure initiative II(PSI II), NYSGXRC, 11180J, structural genomics; 2.20A {Clostridium perfringens atcc 13124} Back     alignment and structure
>2kdv_A RNA pyrophosphohydrolase; nudix family, magnesium, manganese, zinc; NMR {Escherichia coli} PDB: 2kdw_A Back     alignment and structure
>2rrk_A ORF135, CTP pyrophosphohydrolase; NMR {Escherichia coli} Back     alignment and structure
>3gg6_A Nudix motif 18, nucleoside diphosphate-linked moiety X motif 18; NUDT18, NXR1, nucleotide hydrolase, hydrolase, structural genomics; 2.10A {Homo sapiens} Back     alignment and structure
>3hhj_A Mutator MUTT protein; niaid, ssgcid, decode, UW, SBRI, infectious diseases, hydrol structural genomics; 2.10A {Bartonella henselae} Back     alignment and structure
>3ees_A Probable pyrophosphohydrolase; nudix, RNA pyrophosphohydrolase; 1.90A {Bdellovibrio bacteriovorus} PDB: 3eeu_A 3ef5_A* 3ffu_A* Back     alignment and structure
>2o1c_A DATP pyrophosphohydrolase; nudix NTP hydrolase NTP pyrophosphohydrolase MUTT dihydroneo triphosphate pyrophosphohydrolase folate biosynthesis; 1.80A {Escherichia coli} PDB: 2o5w_A Back     alignment and structure
>2fvv_A Diphosphoinositol polyphosphate phosphohydrolase 1; nudix, inositol polyphosphate metabolism, structural genomics, structural genomics consortium; HET: IHP; 1.25A {Homo sapiens} SCOP: d.113.1.1 PDB: 2q9p_A* 2duk_A 3mcf_A* Back     alignment and structure
>3f6a_A Hydrolase, nudix family; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.02A {Clostridium perfringens atcc 13124} Back     alignment and structure
>1mut_A MUTT, nucleoside triphosphate pyrophosphohydrolase; DNA repair; NMR {Escherichia coli} SCOP: d.113.1.1 PDB: 1ppx_A* 1pun_A* 1puq_A* 1pus_A* 1tum_A* 3a6s_A* 3a6t_A* 3a6u_A* 3a6v_A* Back     alignment and structure
>3gwy_A Putative CTP pyrophosphohydrolase; structural genomics, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics; 2.00A {Bacteroides fragilis} SCOP: d.113.1.0 Back     alignment and structure
>3exq_A Nudix family hydrolase; protein structure initiative II(PSI II), NYSGXRC, 11180K, structural genomics; 2.00A {Lactobacillus brevis atcc 367} Back     alignment and structure
>3e57_A Uncharacterized protein TM1382; structural genomics, nudix hydrolase, PSI-2, protein structure initiative; 1.89A {Thermotoga maritima} Back     alignment and structure
>2yvp_A NDX2, MUTT/nudix family protein; nudix protein, ADP-ribose, FAD, hydrol structural genomics, NPPSFA; HET: RBY; 1.66A {Thermus thermophilus} PDB: 2yvn_A 2yvm_A* 2yvo_A* Back     alignment and structure
>4dyw_A MUTT/nudix family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.50A {Burkholderia pseudomallei} Back     alignment and structure
>2jvb_A Protein PSU1, mRNA-decapping enzyme subunit 2; DCP2, mRNA decay, cytoplasm, hydrolase, manganese, metal-binding, mRNA processing; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1v8y_A ADP-ribose pyrophosphatase; nudix motif, loop-helix-loop, MUTT family, riken structural genomics/proteomics initiative, RSGI; HET: APR; 1.65A {Thermus thermophilus} SCOP: d.113.1.1 PDB: 1v8v_A* 1v8n_A 1v8l_A* 1v8m_A* 1v8i_A 1v8r_A* 1v8s_A* 1v8t_A* 1v8w_A 1v8u_A Back     alignment and structure
>1ktg_A Diadenosine tetraphosphate hydrolase; nudix, AMP, magnesium cluster; HET: AMP; 1.80A {Caenorhabditis elegans} SCOP: d.113.1.1 PDB: 1kt9_A* Back     alignment and structure
>1nqz_A COA pyrophosphatase (MUTT/nudix family protein); D.radiodurans, hydrolase; 1.70A {Deinococcus radiodurans} SCOP: d.113.1.1 PDB: 1nqy_A Back     alignment and structure
>2pqv_A MUTT/nudix family protein; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; 1.63A {Streptococcus pneumoniae} Back     alignment and structure
>3q93_A 7,8-dihydro-8-oxoguanine triphosphatase; structural genomics, structural genomics consortium, SGC, NU MUTT-like, hydrolase, magnesium binding; 1.80A {Homo sapiens} PDB: 1iry_A 3zr0_A* 3zr1_A Back     alignment and structure
>2b06_A MUTT/nudix family protein; structural genomics, P protein structure initiative, midwest center for structural genomics, MCSG; 1.40A {Streptococcus pneumoniae} SCOP: d.113.1.1 Back     alignment and structure
>1vcd_A NDX1; nudix protein, diadenosine polyphosphate, AP6A, thermus THER HB8, hydrolase, riken structural genomics/proteomics initia RSGI; 1.70A {Thermus thermophilus} SCOP: d.113.1.1 PDB: 1vc8_A 1vc9_A* Back     alignment and structure
>1k2e_A Nudix homolog; nudix/MUTT-like fold, mixed alpha/beta, dimer, putative NUDI hydrolase, structural genomics, unknown function; 1.80A {Pyrobaculum aerophilum} SCOP: d.113.1.1 PDB: 1jrk_A 1k26_A Back     alignment and structure
>3son_A Hypothetical nudix hydrolase; structural genomics, joint center for structural GENO JCSG, protein structure initiative, PSI-biology; HET: MSE; 1.71A {Listeria monocytogenes} Back     alignment and structure
>2yyh_A MUTT domain, 8-OXO-DGTPase domain; nudix family protein, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.80A {Aquifex aeolicus} Back     alignment and structure
>3shd_A Phosphatase NUDJ; nudix fold, nudix motif, hydrolase, (D)NDP/(D)NTP binding, dephosphorylation; 2.50A {Escherichia coli} PDB: 3dku_A Back     alignment and structure
>2w4e_A MUTT/nudix family protein; ADP-ribose pyrophosphatase, hydrolase; 2.00A {Deinococcus radiodurans} Back     alignment and structure
>3u53_A BIS(5'-nucleosyl)-tetraphosphatase [asymmetrical]; hydrolase; 2.71A {Homo sapiens} PDB: 1xsa_A 1xsb_A 1xsc_A* Back     alignment and structure
>2azw_A MUTT/nudix family protein; MUTT/nudix ,enterococcus faecalis, structural genomics, PSI, structure initiative; HET: 1PE; 1.90A {Enterococcus faecalis} SCOP: d.113.1.1 Back     alignment and structure
>3id9_A MUTT/nudix family protein; hydrolase, protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.55A {Bacillus thuringiensis str} Back     alignment and structure
>3cng_A Nudix hydrolase; structural genomics, APC7497, PSI-2, protei structure initiative; 2.00A {Nitrosomonas europaea atcc 19718} Back     alignment and structure
>3h95_A Nucleoside diphosphate-linked moiety X motif 6; NUDT6, nudix, hydrolase, GFG, GFG-1, FGF2AS, structural GENO structural genomics consortium, SGC; HET: FLC; 1.70A {Homo sapiens} Back     alignment and structure
>2b0v_A Nudix hydrolase; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG, U function; 1.55A {Nitrosomonas europaea} SCOP: d.113.1.1 Back     alignment and structure
>3fk9_A Mutator MUTT protein; structural genomics, hydrolase, PSI-2, protein structure initiative; 2.50A {Bacillus halodurans} Back     alignment and structure
>2fb1_A Conserved hypothetical protein; structural genomics, PSI, protein STRU initiative, midwest center for structural genomics, MCSG; 2.50A {Bacteroides thetaiotaomicron} SCOP: a.4.5.68 d.113.1.6 Back     alignment and structure
>1mk1_A ADPR pyrophosphatase; nudix hydrolase, adprase, adenosine DI ribose, RV1700, hydrolase; HET: APR; 2.00A {Mycobacterium tuberculosis} SCOP: d.113.1.1 PDB: 1mp2_A 1mqe_A* 1mqw_A* 1mr2_A* Back     alignment and structure
>3i7u_A AP4A hydrolase; nudix protein, diadenosine polyphosphate, S genomics, NPPSFA, national project on protein structural AN functional analyses; HET: PGE PG4; 1.80A {Aquifex aeolicus} PDB: 3i7v_A* Back     alignment and structure
>3i9x_A MUTT/nudix family protein; structural genomics, hydrolase, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics; 2.20A {Listeria innocua} Back     alignment and structure
>3o6z_A GDP-mannose pyrophosphatase NUDK; nudix, hydrolase, biofilm; 2.05A {Escherichia coli} SCOP: d.113.1.1 PDB: 3o52_A* 1viu_A 3o69_A 3o61_A Back     alignment and structure
>3q1p_A Phosphohydrolase (MUTT/nudix family protein); asymmetric dimer, RNA exonuclease, CDP-CHO pyrophosphatase; 1.80A {Bacillus cereus} PDB: 3q4i_A Back     alignment and structure
>2qjo_A Bifunctional NMN adenylyltransferase/nudix hydrol; two individual domains, hydrolase; HET: APR NAD; 2.60A {Synechocystis SP} Back     alignment and structure
>1vhz_A ADP compounds hydrolase NUDE; structural genomics; HET: APR; 2.32A {Escherichia coli} SCOP: d.113.1.1 PDB: 1vhg_A* Back     alignment and structure
>2a6t_A SPAC19A8.12; alpha/beta/alpha, RNA binding protein,hydrolase; 2.50A {Schizosaccharomyces pombe} SCOP: a.242.1.1 d.113.1.7 PDB: 2qkm_B* Back     alignment and structure
>2qjt_B Nicotinamide-nucleotide adenylyltransferase; two individual domains, hydrolase; HET: AMP; 2.30A {Francisella tularensis} PDB: 2r5w_B Back     alignment and structure
>1u20_A U8 snoRNA-binding protein X29; modified nudix hydrolase fold, hydrolase; 2.10A {Xenopus laevis} SCOP: d.113.1.1 PDB: 2a8t_A* 2a8q_A* 2a8p_A* 2a8r_A* 2a8s_A* Back     alignment and structure
>3gz5_A MUTT/nudix family protein; DNA binding protein, nudix domain, WHTH domain; 2.20A {Shewanella oneidensis} PDB: 3gz6_A* 3gz8_A* Back     alignment and structure
>1g0s_A Hypothetical 23.7 kDa protein in ICC-TOLC intergenic region; nudix fold, hydrolase; 1.90A {Escherichia coli} SCOP: d.113.1.1 PDB: 1g9q_A* 1ga7_A 1khz_A* 1viq_A Back     alignment and structure
>3q91_A Uridine diphosphate glucose pyrophosphatase; structural genomics, structural genomics consortium, SGC, NU MUTT-like, hydrolase, magnesium binding; 2.70A {Homo sapiens} Back     alignment and structure
>3f13_A Putative nudix hydrolase family member; structural genomics, PSI-2, protein structure initiative; 1.70A {Chromobacterium violaceum} Back     alignment and structure
>1x51_A A/G-specific adenine DNA glycosylase; nudix domain, DNA repair, alpha-3 isoform, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.113.1.3 Back     alignment and structure
>3o8s_A Nudix hydrolase, ADP-ribose pyrophosphatase; structural genomics, joint center for structural genomics, J protein structure initiative; 2.27A {Streptococcus suis} Back     alignment and structure
>2fml_A MUTT/nudix family protein; structural genomics, PSI, protein structure initiative, midwest center structural genomics, MCSG; 2.26A {Enterococcus faecalis} SCOP: a.4.5.68 d.113.1.6 Back     alignment and structure
>3fsp_A A/G-specific adenine glycosylase; protein-DNA complex, DNA glycosylase, transition state analog, DNA repair; HET: NRI; 2.20A {Geobacillus stearothermophilus} PDB: 3fsq_A* 1rrs_A* 1vrl_A* 1rrq_A* 3g0q_A* Back     alignment and structure
>1vk6_A NADH pyrophosphatase; 1790429, structural genomics, JCSG, PS protein structure initiative, joint center for structural G hydrolase; HET: MSE; 2.20A {Escherichia coli} SCOP: d.113.1.4 d.113.1.4 g.41.14.1 PDB: 2gb5_A Back     alignment and structure
>1q33_A Pyrophosphatase, ADP-ribose pyrophosphatase; nudix fold, hydrolase; HET: BGC; 1.81A {Homo sapiens} SCOP: d.113.1.1 PDB: 1qvj_A* Back     alignment and structure
>2dsc_A ADP-sugar pyrophosphatase; nudix domain, ADPR, ADP-ribose pyrophosphatase, NUDT5, hydrolase; HET: APR; 2.00A {Homo sapiens} PDB: 2dsd_A* 3bm4_A* 2dsb_A 3aca_A* 3ac9_A* 3l85_A* Back     alignment and structure
>3fjy_A Probable MUTT1 protein; dimer, protein structure initiative II), NYSGXRC, 11181H, structural genomics; 2.15A {Bifidobacterium adolescentis atcc 1570ORGANISM_TAXID} Back     alignment and structure
>3qsj_A Nudix hydrolase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE; 1.70A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>3kvh_A Protein syndesmos; NUDT16-like, NUDT16L1, nudix, RNA regulation, RNA structural genomics consortium, SGC, RNA degradation, RNA B protein; 1.70A {Homo sapiens} Back     alignment and structure
>2xsq_A U8 snoRNA-decapping enzyme; hydrolase, mRNA decapping, mRNA turnover, structural genomic consortium, SGC; HET: IMP; 1.72A {Homo sapiens} PDB: 3cou_A 3mgm_A Back     alignment and structure
>3bho_A Cleavage and polyadenylation specificity factor subunit 5; CPSF5, RNA processing, cleavage factor, diadenosine tetraphosphate, mRNA processing; HET: B4P; 1.80A {Homo sapiens} PDB: 3bap_A 3mdg_A 3mdi_A 2cl3_A 3n9u_A 3q2s_A 3q2t_A 2j8q_A 3p5t_A 3p6y_A Back     alignment and structure
>3rh7_A Hypothetical oxidoreductase; FMN-binding split barrel, nudix, structural genomics, joint for structural genomics, JCSG; HET: FMN; 3.00A {Sinorhizobium meliloti} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 182
d2o5fa1162 d.113.1.2 (A:7-168) Hypothetical protein DR0079 {D 9e-09
d2fkba1161 d.113.1.2 (A:8-168) Hypothetical protein YfcD {Esc 2e-07
d1hzta_153 d.113.1.2 (A:) Isopentenyl diphosphate isomerase { 1e-04
>d2o5fa1 d.113.1.2 (A:7-168) Hypothetical protein DR0079 {Deinococcus radiodurans str. R1 (Deinococcus radiodurans R1) [TaxId: 243230]} Length = 162 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Nudix
superfamily: Nudix
family: IPP isomerase-like
domain: Hypothetical protein DR0079
species: Deinococcus radiodurans str. R1 (Deinococcus radiodurans R1) [TaxId: 243230]

 Score = 50.2 bits (119), Expect = 9e-09
 Identities = 14/49 (28%), Positives = 21/49 (42%), Gaps = 6/49 (12%)

Query: 91  CILVDENDRVVGHENKYNCHLMEKIESLNLLHRAFSVFLFNSKYELLLQ 139
             LV+E D VVG   + +  L           R  + FL NS+ +L + 
Sbjct: 3   LDLVNERDEVVGQILRTDPAL------RWERVRVVNAFLRNSQGQLWIP 45
>d2fkba1 d.113.1.2 (A:8-168) Hypothetical protein YfcD {Escherichia coli [TaxId: 562]} Length = 161 Back     information, alignment and structure
>d1hzta_ d.113.1.2 (A:) Isopentenyl diphosphate isomerase {Escherichia coli [TaxId: 562]} Length = 153 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query182
d2fkba1161 Hypothetical protein YfcD {Escherichia coli [TaxId 99.91
d2o5fa1162 Hypothetical protein DR0079 {Deinococcus radiodura 99.91
d1hzta_153 Isopentenyl diphosphate isomerase {Escherichia col 99.72
d1sjya_158 Hypothetical protein DR1025 {Deinococcus radiodura 99.15
d1ryaa_160 GDP-mannose mannosyl hydrolase NudD {Escherichia c 99.07
d1jkna_165 Diadenosine tetraphosphate hydrolase (Ap4A hydrola 99.05
d1puna_129 Nucleoside triphosphate pyrophosphorylase (MutT) { 98.87
d1irya_156 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 {Hum 98.79
d1vcda1126 AP6A hydrolase Ndx1 {Thermus thermophilus [TaxId: 98.76
d2fvva1135 Diphosphoinositol polyphosphate phosphohydrolase { 98.7
d2b06a1155 Hypothetical protein SP1235 (spr1115) {Streptococc 98.61
d1vk6a2131 NADH pyrophosphatase {Escherichia coli [TaxId: 562 98.57
d2fb1a2147 Hypothetical protein BT0354, N-terminal domain {Ba 98.5
d2a6ta2151 mRNA decapping enzyme Dcp2p catalytic domain {Schi 98.49
d1ktga_137 Diadenosine tetraphosphate hydrolase (Ap4A hydrola 98.48
d1k2ea_152 Hypothetical protein PAE3301 {Archaeon Pyrobaculum 98.45
d2b0va1146 Hypothetical protein NE0184 {Nitrosomonas europaea 98.39
d1nqza_187 Coenzyme A pyrophosphatase {Deinococcus radioduran 98.34
d1xsba_153 Diadenosine tetraphosphate hydrolase (Ap4A hydrola 98.22
d2azwa1147 Hypothetical protein EF1141 {Enterococcus faecalis 98.09
d1rrqa2127 Adenine glycosylase MutY, C-terminal domain {Bacil 98.06
d2fmla2202 Hypothetical protein EF2700, N-terminal domain {En 97.99
d1mqea_202 ADP-ribose pyrophosphatase {Mycobacterium tubercul 97.93
d1u20a1 196 U8 snorna-binding protein x29 {African clawed frog 97.89
d1v8ya_158 ADP-ribose pyrophosphatase {Thermus thermophilus [ 97.82
d1vhza_186 ADP compounds hydrolase NudE {Escherichia coli [Ta 97.5
d1g0sa_209 ADP-ribose pyrophosphatase {Escherichia coli [TaxI 97.43
d1viua_189 ADP-ribose pyrophosphatase homologue YffH {Escheri 97.24
d1q33a_ 292 NUDT9 (mitochondrial ADP-ribose pyrophosphatase) { 96.24
d1x51a1142 A/G-specific adenine DNA glycosylase {Human (Homo 96.15
>d2fkba1 d.113.1.2 (A:8-168) Hypothetical protein YfcD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Nudix
superfamily: Nudix
family: IPP isomerase-like
domain: Hypothetical protein YfcD
species: Escherichia coli [TaxId: 562]

Probab=99.91  E-value=3.9e-25  Score=170.52  Aligned_cols=82  Identities=13%  Similarity=0.054  Sum_probs=78.1

Q ss_pred             cCeEEEeecCCcEEeeeechhchhhhccccCCccEEEEEEEEEcCCCcEEEEe-----ecCCCceecccccCcCCCCCHH
Q 030138           88 EDECILVDENDRVVGHENKYNCHLMEKIESLNLLHRAFSVFLFNSKYELLLQV-----CLFCILWVKTCLSMDCHWVVQI  162 (182)
Q Consensus        88 eE~vdLVDe~d~~iG~~~R~~~Hr~e~i~~~GLlHRAfsVfLFNs~GeLLLQq-----~~fPglWDnTcgGHplaGEs~~  162 (182)
                      .|.|++||++|+++|..+|..+|.      +|++|++++|+|+|++|++||||     ..|||+|++.+|||+..||+.+
T Consensus         2 ~E~~~i~d~~~~~ig~~~R~~~~~------~~~~h~~v~v~v~~~~g~vLl~rR~~~~~~~pg~w~~~~GG~ie~gEs~~   75 (161)
T d2fkba1           2 TEWVDIVNEENEVIAQASREQMRA------QCLRHRATYIVVHDGMGKILVQRRTETKDFLPGMLDATAGGVVQADEQLL   75 (161)
T ss_dssp             CCEEEEECTTSCEEEEEEHHHHHH------HTCCEEEEEEEEECSSSCEEEEEECSSCSSSTTCEESSBCCBCBTTCCHH
T ss_pred             cEEEEEECCCCCEEeEEEHHHhhc------CCCcEeEEEEEEEeCCCCEEEEEecCccccccccccccccccccccCcHH
Confidence            489999999999999999999998      79999999999999999999998     6699999999999999999999


Q ss_pred             HHHHhhhhccCce
Q 030138          163 CGLTWEMTDSNIL  175 (182)
Q Consensus       163 eAA~REl~ee~~~  175 (182)
                      +||.|||.||-++
T Consensus        76 ~aa~REl~EE~Gi   88 (161)
T d2fkba1          76 ESARREAEEELGI   88 (161)
T ss_dssp             HHHHHHHHHHHCC
T ss_pred             HHHHHHHHHHhCC
Confidence            9999999999664
>d2o5fa1 d.113.1.2 (A:7-168) Hypothetical protein DR0079 {Deinococcus radiodurans str. R1 (Deinococcus radiodurans R1) [TaxId: 243230]} Back     information, alignment and structure
>d1hzta_ d.113.1.2 (A:) Isopentenyl diphosphate isomerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sjya_ d.113.1.1 (A:) Hypothetical protein DR1025 {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1ryaa_ d.113.1.5 (A:) GDP-mannose mannosyl hydrolase NudD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jkna_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Narrow-leaved blue lupine (Lupinus angustifolius) [TaxId: 3871]} Back     information, alignment and structure
>d1puna_ d.113.1.1 (A:) Nucleoside triphosphate pyrophosphorylase (MutT) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1irya_ d.113.1.1 (A:) 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vcda1 d.113.1.1 (A:1-126) AP6A hydrolase Ndx1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2fvva1 d.113.1.1 (A:8-142) Diphosphoinositol polyphosphate phosphohydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b06a1 d.113.1.1 (A:1-155) Hypothetical protein SP1235 (spr1115) {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1vk6a2 d.113.1.4 (A:126-256) NADH pyrophosphatase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fb1a2 d.113.1.6 (A:3-149) Hypothetical protein BT0354, N-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d2a6ta2 d.113.1.7 (A:95-245) mRNA decapping enzyme Dcp2p catalytic domain {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1ktga_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1k2ea_ d.113.1.1 (A:) Hypothetical protein PAE3301 {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d2b0va1 d.113.1.1 (A:4-149) Hypothetical protein NE0184 {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d1nqza_ d.113.1.1 (A:) Coenzyme A pyrophosphatase {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1xsba_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2azwa1 d.113.1.1 (A:2-148) Hypothetical protein EF1141 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1rrqa2 d.113.1.3 (A:234-360) Adenine glycosylase MutY, C-terminal domain {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2fmla2 d.113.1.6 (A:3-204) Hypothetical protein EF2700, N-terminal domain {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1mqea_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1u20a1 d.113.1.1 (A:14-209) U8 snorna-binding protein x29 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1v8ya_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1vhza_ d.113.1.1 (A:) ADP compounds hydrolase NudE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g0sa_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1viua_ d.113.1.1 (A:) ADP-ribose pyrophosphatase homologue YffH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q33a_ d.113.1.1 (A:) NUDT9 (mitochondrial ADP-ribose pyrophosphatase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x51a1 d.113.1.3 (A:8-149) A/G-specific adenine DNA glycosylase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure