Citrus Sinensis ID: 030189

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-
MEIDKAIRESDDRRLKTKYNNAINVIQRTLALYSIEEVAFSFNGGKDSTVLLHLLRAGYFLHKGEQSCSNGSLTFPIRTIYFESNSAFPEINSFTYDTASKYVLQLDIIRSDFKSGLEALLNAKPIRAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPILDWSYRLLINNKLFGFIGF
ccccHHHHHHccHHHHHHHHHHHHHHHHHHHHcccccEEEEEcccccHHHHHHHHHHHHHHHccccccccccccccEEEEEEccccccccHHHHHHHHHHHcccEEEEEEccHHHHHHHHHHHccccEEEEEEEccccccccccccccccccccccEEEEccccccccccHHHHHHHHccc
ccHHHHHHccccHHHHHHHHHHHHHHHHHHHHccccEEEEEEcccHHHHHHHHHHHHHHHHHccccccccccccccccEEEEEcccccHHHHHHHHHHHHHccccEEEccccHHHHHHHHHHccccEEEEEEEcccccccccccccccccccccccEEEcccccccHHHHHHHHHHHcccc
MEIDKAIRESDDRRLKTKYNNAINVIQRTLALYSIEEVAfsfnggkdSTVLLHLLRAGyflhkgeqscsngsltfpirtiyfesnsafpeinsftydtasKYVLQLDIIRSDFKSGLEALLNAKPIRAIFLgvrigdptavgqeqfspsspgwppfmrvnpildWSYRLLINNklfgfigf
meidkairesddrrlktkynnainVIQRTLALYSIEEVAFSFNGGKDSTVLLHLLRAGYFLHKGEQSCSNGSLTFPIRTIYFESNSAFPEINSFTYDTASKYVLQLDIIRSDFKSGLEALLNAKPIRAIFLGVRIGDPTAVGQEQfspsspgwppFMRVNPILDWSYRLLINNKLFGFIGF
MEIDKAIRESDDRRLKTKYNNAINVIQRTLALYSIEEVAFSFNGGKDSTVLLHLLRAGYFLHKGEQSCSNGSLTFPIRTIYFESNSAFPEINSFTYDTASKYVLQLDIIRSDFKSGLEALLNAKPIRAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPILDWSYRLLINNKLFGFIGF
****************TKYNNAINVIQRTLALYSIEEVAFSFNGGKDSTVLLHLLRAGYFLHKGEQSCSNGSLTFPIRTIYFESNSAFPEINSFTYDTASKYVLQLDIIRSDFKSGLEALLNAKPIRAIFLGVRIGDPTAVG*********GWPPFMRVNPILDWSYRLLINNKLFGFIG*
*EIDKAIRESDDRRLKTKYNNAINVIQRTLALYSIEEVAFSFNGGKDSTVLLHLLRAGYFLHKGEQS***GSLTFPIRTIYFESNSAFPEINSFTYDTASKYVLQLDIIRSDFKSGLEALLNAKPIRAIFLGVRIGDPTAVG**Q**PSSPGWPPFMRVNPILDWSYRLLINNKLFGFIGF
MEIDKAIRESDDRRLKTKYNNAINVIQRTLALYSIEEVAFSFNGGKDSTVLLHLLRAGYFLHKGEQSCSNGSLTFPIRTIYFESNSAFPEINSFTYDTASKYVLQLDIIRSDFKSGLEALLNAKPIRAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPILDWSYRLLINNKLFGFIGF
*EIDKAIRESDDRRLKTKYNNAINVIQRTLALYSIEEVAFSFNGGKDSTVLLHLLRAGYFLHKGEQSCSNGSLTFPIRTIYFESNSAFPEINSFTYDTASKYVLQLDIIRSDFKSGLEALLNAKPIRAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPILDWSYRLLINNKLFGFIGF
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEIDKAIRESDDRRLKTKYNNAINVIQRTLALYSIEEVAFSFNGGKDSTVLLHLLRAGYFLHKGEQSCSNGSLTFPIRTIYFESNSAFPEINSFTYDTASKYVLQLDIIRSDFKSGLEALLNAKPIRAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPILDWSYRLLINNKLFGFIGF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query181 2.2.26 [Sep-21-2011]
Q8NFF5587 FAD synthase OS=Homo sapi no no 0.812 0.250 0.387 4e-25
Q5RCH4491 FAD synthase OS=Pongo abe yes no 0.812 0.299 0.387 6e-25
Q8R123492 FAD synthase OS=Mus muscu yes no 0.812 0.298 0.374 7e-25
Q68EH8497 FAD synthase OS=Danio rer yes no 0.828 0.301 0.341 2e-21
Q6ING7496 FAD synthase OS=Xenopus l N/A no 0.812 0.296 0.348 3e-20
Q22017519 Probable FAD synthase OS= yes no 0.773 0.269 0.350 1e-17
O74841265 Probable FAD synthase OS= yes no 0.828 0.566 0.337 6e-17
Q626I0523 Probable FAD synthase OS= N/A no 0.773 0.267 0.331 2e-14
P38913306 FAD synthase OS=Saccharom yes no 0.784 0.464 0.295 4e-09
A4SRG9 309 Sulfate adenylyltransfera yes no 0.613 0.359 0.257 0.0006
>sp|Q8NFF5|FAD1_HUMAN FAD synthase OS=Homo sapiens GN=FLAD1 PE=1 SV=1 Back     alignment and function desciption
 Score =  114 bits (285), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 60/155 (38%), Positives = 82/155 (52%), Gaps = 8/155 (5%)

Query: 15  LKTKYNNAINVIQRTLALYSIEEVAFSFNGGKDSTVLLHLLRAGYFLHKGEQSCSNGSLT 74
           L  K   A+  I+ +LA YS+ ++   FNGGKD T LLHL  A   + +      N    
Sbjct: 376 LGKKVAGALQTIETSLAQYSLTQLCVGFNGGKDCTALLHLFHAA--VQRKLPDVPN---- 429

Query: 75  FPIRTIYFESNSAFPEINSFTYDTASKYVLQLDIIRSDFKSGLEALLNAKP-IRAIFLGV 133
            P++ +Y  S S FPE+  F  DT  +Y LQ+       K  L  L    P + A+ +G 
Sbjct: 430 -PLQILYIRSISPFPELEQFLQDTIKRYNLQMLEAEGSMKQALGELQARHPQLEAVLMGT 488

Query: 134 RIGDPTAVGQEQFSPSSPGWPPFMRVNPILDWSYR 168
           R  DP +     FSP+ PGWP FMR+NP+LDW+YR
Sbjct: 489 RRTDPYSCSLCPFSPTDPGWPAFMRINPLLDWTYR 523
Catalyzes the adenylation of flavin mononucleotide (FMN) to form flavin adenine dinucleotide (FAD) coenzyme.
Homo sapiens (taxid: 9606)
EC: 2EC: .EC: 7EC: .EC: 7EC: .EC: 2
>sp|Q5RCH4|FAD1_PONAB FAD synthase OS=Pongo abelii GN=FLAD1 PE=2 SV=1 Back     alignment and function description
>sp|Q8R123|FAD1_MOUSE FAD synthase OS=Mus musculus GN=Flad1 PE=1 SV=1 Back     alignment and function description
>sp|Q68EH8|FAD1_DANRE FAD synthase OS=Danio rerio GN=flad1 PE=2 SV=1 Back     alignment and function description
>sp|Q6ING7|FLAD1_XENLA FAD synthase OS=Xenopus laevis GN=flad1 PE=2 SV=1 Back     alignment and function description
>sp|Q22017|FLAD1_CAEEL Probable FAD synthase OS=Caenorhabditis elegans GN=R53.1 PE=3 SV=1 Back     alignment and function description
>sp|O74841|FAD1_SCHPO Probable FAD synthase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1235.04c PE=3 SV=1 Back     alignment and function description
>sp|Q626I0|FLAD1_CAEBR Probable FAD synthase OS=Caenorhabditis briggsae GN=CBG00973 PE=3 SV=1 Back     alignment and function description
>sp|P38913|FAD1_YEAST FAD synthase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FAD1 PE=1 SV=1 Back     alignment and function description
>sp|A4SRG9|CYSD_AERS4 Sulfate adenylyltransferase subunit 2 OS=Aeromonas salmonicida (strain A449) GN=cysD PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query181
255556898 512 molybdopterin-binding, putative [Ricinus 0.928 0.328 0.905 3e-83
110737271 408 hypothetical protein [Arabidopsis thalia 0.928 0.411 0.875 2e-81
14423558 497 putative protein [Arabidopsis thaliana] 0.928 0.338 0.875 2e-81
18414227 497 phosphoadenosine phosphosulfate (PAPS) r 0.928 0.338 0.875 2e-81
297810413 497 phosphoadenosine phosphosulfate reductas 0.928 0.338 0.875 2e-81
225441189 514 PREDICTED: uncharacterized protein LOC10 0.928 0.326 0.867 4e-81
356572474 506 PREDICTED: uncharacterized protein LOC10 0.928 0.332 0.846 8e-78
356505260 506 PREDICTED: uncharacterized protein LOC10 0.928 0.332 0.840 7e-77
449440409 512 PREDICTED: uncharacterized protein LOC10 0.928 0.328 0.822 8e-77
357510801 502 FAD synthetase [Medicago truncatula] gi| 0.928 0.334 0.822 2e-75
>gi|255556898|ref|XP_002519482.1| molybdopterin-binding, putative [Ricinus communis] gi|223541345|gb|EEF42896.1| molybdopterin-binding, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  312 bits (800), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 153/169 (90%), Positives = 158/169 (93%), Gaps = 1/169 (0%)

Query: 1   MEIDKAIRESDDRRLKTKYNNAINVIQRTLALYSIEEVAFSFNGGKDSTVLLHLLRAGYF 60
           MEIDKAI ESDDRRLKTKYNNAI VIQR LALYS+EEVAFSFNGGKDSTVLLHLLRAGYF
Sbjct: 5   MEIDKAISESDDRRLKTKYNNAIYVIQRALALYSVEEVAFSFNGGKDSTVLLHLLRAGYF 64

Query: 61  LHKGEQSCSNGSLT-FPIRTIYFESNSAFPEINSFTYDTASKYVLQLDIIRSDFKSGLEA 119
           L+KGE+SCSNG LT FPIRTIYFES+SAFPEINSFT+DTAS Y LQLDII SDFKSGLE 
Sbjct: 65  LYKGEKSCSNGGLTSFPIRTIYFESSSAFPEINSFTHDTASSYGLQLDIISSDFKSGLEN 124

Query: 120 LLNAKPIRAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPILDWSYR 168
           LL A PIRAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPILDWSYR
Sbjct: 125 LLKANPIRAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPILDWSYR 173

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|110737271|dbj|BAF00583.1| hypothetical protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|14423558|gb|AAK62461.1|AF387016_1 putative protein [Arabidopsis thaliana] gi|20148293|gb|AAM10037.1| putative protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|18414227|ref|NP_568117.1| phosphoadenosine phosphosulfate (PAPS) reductase family protein [Arabidopsis thaliana] gi|7378626|emb|CAB83302.1| putative protein [Arabidopsis thaliana] gi|332003219|gb|AED90602.1| phosphoadenosine phosphosulfate (PAPS) reductase family protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297810413|ref|XP_002873090.1| phosphoadenosine phosphosulfate reductase family protein [Arabidopsis lyrata subsp. lyrata] gi|297318927|gb|EFH49349.1| phosphoadenosine phosphosulfate reductase family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|225441189|ref|XP_002269812.1| PREDICTED: uncharacterized protein LOC100250368 [Vitis vinifera] gi|297739964|emb|CBI30146.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356572474|ref|XP_003554393.1| PREDICTED: uncharacterized protein LOC100816619 [Glycine max] Back     alignment and taxonomy information
>gi|356505260|ref|XP_003521410.1| PREDICTED: uncharacterized protein LOC100795114 [Glycine max] Back     alignment and taxonomy information
>gi|449440409|ref|XP_004137977.1| PREDICTED: uncharacterized protein LOC101215823 [Cucumis sativus] gi|449501110|ref|XP_004161280.1| PREDICTED: uncharacterized LOC101215823 [Cucumis sativus] Back     alignment and taxonomy information
>gi|357510801|ref|XP_003625689.1| FAD synthetase [Medicago truncatula] gi|355500704|gb|AES81907.1| FAD synthetase [Medicago truncatula] gi|388512539|gb|AFK44331.1| unknown [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query181
TAIR|locus:2831849 497 AT5G03430 [Arabidopsis thalian 0.928 0.338 0.875 7.3e-75
DICTYBASE|DDB_G0282955300 DDB_G0282955 "FAD synthetase" 0.502 0.303 0.434 8.4e-28
UNIPROTKB|F6R6Q1490 FLAD1 "Uncharacterized protein 0.812 0.3 0.393 6.6e-25
UNIPROTKB|E2QSS7490 E2QSS7 "Uncharacterized protei 0.850 0.314 0.392 6.6e-25
UNIPROTKB|F1PSQ8544 FLAD1 "Uncharacterized protein 0.850 0.283 0.392 1e-24
UNIPROTKB|F1RGP6551 FLAD1 "Uncharacterized protein 0.812 0.266 0.387 4.9e-24
RGD|1593292490 Flad1 "flavin adenine dinucleo 0.812 0.3 0.374 1.4e-23
UNIPROTKB|D4A4P4509 Flad1 "Protein Flad1" [Rattus 0.812 0.288 0.374 1.7e-23
MGI|MGI:2443030492 Flad1 "RFad1, flavin adenine d 0.812 0.298 0.374 3.2e-23
UNIPROTKB|Q8NFF5587 FLAD1 "FAD synthase" [Homo sap 0.812 0.250 0.387 3.4e-23
TAIR|locus:2831849 AT5G03430 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 755 (270.8 bits), Expect = 7.3e-75, P = 7.3e-75
 Identities = 148/169 (87%), Positives = 154/169 (91%)

Query:     1 MEIDKAIRESDDRRLKTKYNNAINVIQRTLALYSIEEVAFSFNGGKDSTVLLHLLRAGYF 60
             MEIDKAI ESDD+RLKTKYNNAI VI+R LALYSIEEVAFSFNGGKDSTVLLHLLRAGYF
Sbjct:     1 MEIDKAIGESDDKRLKTKYNNAIFVIKRALALYSIEEVAFSFNGGKDSTVLLHLLRAGYF 60

Query:    61 LHKGEQSCSNGSLT-FPIRTIYFESNSAFPEINSFTYDTASKYVLQLDIIRSDFKSGLEA 119
             LHK EQ+CSNG L+ FP+RTIYFES SAF EIN+FTYD A  Y LQLDIIR DFKSGLEA
Sbjct:    61 LHKKEQTCSNGGLSSFPVRTIYFESPSAFTEINAFTYDAAQTYNLQLDIIRQDFKSGLEA 120

Query:   120 LLNAKPIRAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPILDWSYR 168
             LL A PIRAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPILDWSYR
Sbjct:   121 LLKANPIRAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPILDWSYR 169
GO:0003824 "catalytic activity" evidence=IEA
GO:0005737 "cytoplasm" evidence=ISM
GO:0006777 "Mo-molybdopterin cofactor biosynthetic process" evidence=IEA
GO:0008152 "metabolic process" evidence=IEA;ISS
GO:0016740 "transferase activity" evidence=ISS
GO:0019761 "glucosinolate biosynthetic process" evidence=RCA
DICTYBASE|DDB_G0282955 DDB_G0282955 "FAD synthetase" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|F6R6Q1 FLAD1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2QSS7 E2QSS7 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1PSQ8 FLAD1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1RGP6 FLAD1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
RGD|1593292 Flad1 "flavin adenine dinucleotide synthetase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|D4A4P4 Flad1 "Protein Flad1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:2443030 Flad1 "RFad1, flavin adenine dinucleotide synthetase, homolog (yeast)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q8NFF5 FLAD1 "FAD synthase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.7.7LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
gw1.28.761.1
annotation not avaliable (500 aa)
(Populus trichocarpa)
Predicted Functional Partners:
gw1.VII.2337.1
hypothetical protein (379 aa)
      • 0.410

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query181
cd01713173 cd01713, PAPS_reductase, This domain is found in p 1e-20
pfam01507173 pfam01507, PAPS_reduct, Phosphoadenosine phosphosu 3e-10
COG0175261 COG0175, CysH, 3'-phosphoadenosine 5'-phosphosulfa 5e-09
TIGR02039 294 TIGR02039, CysD, sulfate adenylyltransferase, smal 8e-04
PRK13795 636 PRK13795, PRK13795, hypothetical protein; Provisio 0.002
PRK08557 417 PRK08557, PRK08557, hypothetical protein; Provisio 0.004
>gnl|CDD|238846 cd01713, PAPS_reductase, This domain is found in phosphoadenosine phosphosulphate (PAPS) reductase enzymes or PAPS sulphotransferase Back     alignment and domain information 
 Score = 83.2 bits (206), Expect = 1e-20
 Identities = 39/160 (24%), Positives = 55/160 (34%), Gaps = 40/160 (25%)

Query: 37  EVAFSFNGGKDSTVLLHLLRAGYFLHKGEQSCSNGSLTFPIRTIYFESNSAFPEINSFTY 96
            V  SF+GGKDSTVLLHL        K            P+  I+ ++   FPE   F  
Sbjct: 1   NVVVSFSGGKDSTVLLHLALKALPELK------------PVPVIFLDTGYEFPETYEFVD 48

Query: 97  DTASKYVLQLDIIRSDFKS----------------------------GLEALLNAKPIRA 128
             A +Y L L ++R                                  L   L    + A
Sbjct: 49  RVAERYGLPLVVVRPPDSPAEGLALGLKGFPLPSPDRRWCCRILKVEPLRRALKELGVVA 108

Query: 129 IFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPILDWSYR 168
              G+R  +           +  G    ++VNP+LDW+Y 
Sbjct: 109 WITGIRRDESARRALLPVVWTDDGKGGILKVNPLLDWTYE 148

PAPS reductase is part of the adenine nucleotide alpha hydrolases superfamily also including N type ATP PPases and ATP sulphurylases. A highly modified version of the P loop, the fingerprint peptide of mononucleotide-binding proteins, is present in the active site of the protein, which appears to be a positively charged cleft containing a number of conserved arginine and lysine residues. Although PAPS reductase has no ATPase activity, it shows a striking similarity to the structure of the ATP pyrophosphatase (ATP PPase) domain of GMP synthetase, indicating that both enzyme families have evolved from a common ancestral nucleotide-binding fold. The enzyme uses thioredoxin as an electron donor for the reduction of PAPS to phospho-adenosine-phosphate (PAP) . It is also found in NodP nodulation protein P from Rhizobium meliloti which has ATP sulphurylase activity (sulphate adenylate transferase) . Length = 173
>gnl|CDD|201832 pfam01507, PAPS_reduct, Phosphoadenosine phosphosulfate reductase family Back     alignment and domain information
>gnl|CDD|223253 COG0175, CysH, 3'-phosphoadenosine 5'-phosphosulfate sulfotransferase (PAPS reductase)/FAD synthetase and related enzymes [Amino acid transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|131094 TIGR02039, CysD, sulfate adenylyltransferase, small subunit Back     alignment and domain information
>gnl|CDD|237510 PRK13795, PRK13795, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|181465 PRK08557, PRK08557, hypothetical protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 181
PRK12563312 sulfate adenylyltransferase subunit 2; Provisional 100.0
TIGR02057226 PAPS_reductase phosphoadenosine phosphosulfate red 100.0
TIGR00434212 cysH phosophoadenylyl-sulfate reductase (thioredox 100.0
TIGR02039294 CysD sulfate adenylyltransferase, small subunit. I 100.0
PRK05253301 sulfate adenylyltransferase subunit 2; Provisional 100.0
COG0175261 CysH 3'-phosphoadenosine 5'-phosphosulfate sulfotr 100.0
PRK08557417 hypothetical protein; Provisional 100.0
PRK13794479 hypothetical protein; Provisional 100.0
PRK02090241 phosphoadenosine phosphosulfate reductase; Provisi 99.97
PF01507174 PAPS_reduct: Phosphoadenosine phosphosulfate reduc 99.97
PRK13795 636 hypothetical protein; Provisional 99.97
PLN02309 457 5'-adenylylsulfate reductase 99.96
TIGR00424 463 APS_reduc 5'-adenylylsulfate reductase, thioredoxi 99.96
cd01713173 PAPS_reductase This domain is found in phosphoaden 99.95
PRK08576438 hypothetical protein; Provisional 99.94
TIGR02055191 APS_reductase thioredoxin-dependent adenylylsulfat 99.94
PRK06850 507 hypothetical protein; Provisional 99.92
TIGR03183 447 DNA_S_dndC putative sulfurtransferase DndC. Member 99.92
KOG0189261 consensus Phosphoadenosine phosphosulfate reductas 99.89
COG3969 407 Predicted phosphoadenosine phosphosulfate sulfotra 99.8
KOG2644282 consensus 3'-phosphoadenosine 5'-phosphosulfate su 99.77
cd01992185 PP-ATPase N-terminal domain of predicted ATPase of 99.77
TIGR02432189 lysidine_TilS_N tRNA(Ile)-lysidine synthetase, N-t 99.76
cd01993185 Alpha_ANH_like_II This is a subfamily of Adenine n 99.74
PRK10696258 tRNA 2-thiocytidine biosynthesis protein TtcA; Pro 99.7
PF01171182 ATP_bind_3: PP-loop family; InterPro: IPR011063 Th 99.67
COG0037 298 MesJ tRNA(Ile)-lysidine synthase MesJ [Cell cycle 99.62
cd01990202 Alpha_ANH_like_I This is a subfamily of Adenine nu 99.55
PRK00919 307 GMP synthase subunit B; Validated 99.5
PRK00074 511 guaA GMP synthase; Reviewed 99.5
TIGR00268252 conserved hypothetical protein TIGR00268. The N-te 99.49
PRK10660 436 tilS tRNA(Ile)-lysidine synthetase; Provisional 99.48
cd01995169 ExsB ExsB is a transcription regulator related pro 99.47
TIGR00884 311 guaA_Cterm GMP synthase (glutamine-hydrolyzing), C 99.45
cd01712177 ThiI ThiI is required for thiazole synthesis in th 99.4
PRK14561194 hypothetical protein; Provisional 99.38
cd01997 295 GMP_synthase_C The C-terminal domain of GMP synthe 99.37
PRK00143 346 mnmA tRNA-specific 2-thiouridylase MnmA; Reviewed 99.32
PRK08349198 hypothetical protein; Validated 99.31
TIGR00420 352 trmU tRNA (5-methylaminomethyl-2-thiouridylate)-me 99.28
COG1606269 ATP-utilizing enzymes of the PP-loop superfamily [ 99.26
cd01998 349 tRNA_Me_trans tRNA methyl transferase. This family 99.23
cd01996154 Alpha_ANH_like_III This is a subfamily of Adenine 99.23
TIGR00552250 nadE NAD+ synthetase. NAD+ synthetase is a nearly 99.23
cd00553248 NAD_synthase NAD+ synthase is a homodimer, which c 99.21
PRK13980265 NAD synthetase; Provisional 99.19
PLN02347 536 GMP synthetase 99.19
TIGR00364201 exsB protein. This protein family is represented b 99.17
PRK14665 360 mnmA tRNA-specific 2-thiouridylase MnmA; Provision 99.15
PRK08384381 thiamine biosynthesis protein ThiI; Provisional 99.13
cd01999 385 Argininosuccinate_Synthase Argininosuccinate synth 99.12
TIGR00342371 thiazole biosynthesis/tRNA modification protein Th 99.1
cd01986103 Alpha_ANH_like Adenine nucleotide alpha hydrolases 99.09
PRK00509 399 argininosuccinate synthase; Provisional 99.08
PRK13820 394 argininosuccinate synthase; Provisional 99.07
TIGR03573 343 WbuX N-acetyl sugar amidotransferase. This enzyme 99.07
TIGR00032 394 argG argininosuccinate synthase. argG in bacteria, 99.05
cd01994194 Alpha_ANH_like_IV This is a subfamily of Adenine n 99.05
PLN00200 404 argininosuccinate synthase; Provisional 99.02
PRK14664 362 tRNA-specific 2-thiouridylase MnmA; Provisional 98.98
PRK11106231 queuosine biosynthesis protein QueC; Provisional 98.94
PRK01565394 thiamine biosynthesis protein ThiI; Provisional 98.93
PTZ00323294 NAD+ synthase; Provisional 98.9
PRK04527 400 argininosuccinate synthase; Provisional 98.84
PRK01269 482 tRNA s(4)U8 sulfurtransferase; Provisional 98.82
PF02540242 NAD_synthase: NAD synthase; InterPro: IPR022310 NA 98.82
PF06508209 QueC: Queuosine biosynthesis protein QueC; InterPr 98.82
TIGR03679218 arCOG00187 arCOG00187 universal archaeal metal-bin 98.76
COG0519 315 GuaA GMP synthase, PP-ATPase domain/subunit [Nucle 98.6
PRK00768268 nadE NAD synthetase; Reviewed 98.6
PF03054 356 tRNA_Me_trans: tRNA methyl transferase; InterPro: 98.58
PRK00876 326 nadE NAD synthetase; Reviewed 98.55
cd01991269 Asn_Synthase_B_C The C-terminal domain of Asparagi 98.52
COG2117198 Predicted subunit of tRNA(5-methylaminomethyl-2-th 98.47
PF02568197 ThiI: Thiamine biosynthesis protein (ThiI); InterP 98.45
COG0603222 Predicted PP-loop superfamily ATPase [General func 98.32
COG0482 356 TrmU Predicted tRNA(5-methylaminomethyl-2-thiourid 98.3
TIGR00289222 conserved hypothetical protein TIGR00289. Homologo 98.23
TIGR00290223 MJ0570_dom MJ0570-related uncharacterized domain. 98.22
TIGR01536467 asn_synth_AEB asparagine synthase (glutamine-hydro 98.22
PRK13981 540 NAD synthetase; Provisional 98.22
PF00733255 Asn_synthase: Asparagine synthase; InterPro: IPR00 98.22
PRK02628 679 nadE NAD synthetase; Reviewed 98.18
cd0198486 AANH_like Adenine nucleotide alpha hydrolases supe 98.06
KOG2805 377 consensus tRNA (5-methylaminomethyl-2-thiouridylat 98.05
PRK05370 447 argininosuccinate synthase; Validated 97.97
KOG1622 552 consensus GMP synthase [Nucleotide transport and m 97.95
PF00764 388 Arginosuc_synth: Arginosuccinate synthase; InterPr 97.83
COG0301383 ThiI Thiamine biosynthesis ATP pyrophosphatase [Co 97.74
PF01902218 ATP_bind_4: ATP-binding region; InterPro: IPR00276 97.66
COG0137 403 ArgG Argininosuccinate synthase [Amino acid transp 97.4
PRK09431 554 asnB asparagine synthetase B; Provisional 97.31
PLN02549 578 asparagine synthase (glutamine-hydrolyzing) 97.31
COG0171268 NadE NAD synthase [Coenzyme metabolism] 97.29
PTZ00077 586 asparagine synthetase-like protein; Provisional 97.27
TIGR03108 628 eps_aminotran_1 exosortase 1 system-associated ami 97.23
COG0367 542 AsnB Asparagine synthase (glutamine-hydrolyzing) [ 97.21
TIGR03104 589 trio_amidotrans asparagine synthase family amidotr 97.19
COG2102223 Predicted ATPases of PP-loop superfamily [General 97.03
COG1365255 Predicted ATPase (PP-loop superfamily) [General fu 97.02
KOG2840 347 consensus Uncharacterized conserved protein with s 96.92
PLN02339 700 NAD+ synthase (glutamine-hydrolysing) 96.15
cd01987124 USP_OKCHK USP domain is located between the N-term 95.78
KOG2594 396 consensus Uncharacterized conserved protein [Funct 95.39
cd00293130 USP_Like Usp: Universal stress protein family. The 95.29
cd01988132 Na_H_Antiporter_C The C-terminal domain of a subfa 94.67
KOG0573 520 consensus Asparagine synthase [Amino acid transpor 93.71
KOG0571 543 consensus Asparagine synthase (glutamine-hydrolyzi 92.97
PRK10490 895 sensor protein KdpD; Provisional 92.78
PRK09982142 universal stress protein UspD; Provisional 90.59
cd01989146 STK_N The N-terminal domain of Eukaryotic Serine T 90.09
COG2205 890 KdpD Osmosensitive K+ channel histidine kinase [Si 89.2
PRK15118144 universal stress global response regulator UspA; P 89.19
PRK10116142 universal stress protein UspC; Provisional 88.26
PF00582140 Usp: Universal stress protein family; InterPro: IP 85.4
>PRK12563 sulfate adenylyltransferase subunit 2; Provisional Back     alignment and domain information 
Probab=100.00  E-value=2.5e-35  Score=243.56  Aligned_cols=155  Identities=23%  Similarity=0.302  Sum_probs=130.0

Q ss_pred             hHHHHHHHHHHHHHHHHHHhcCCCceEEEecCchhHHHHHHHHHHHhhhhcCCCCCCCCCCCCCceEEEecCCCCchHHH
Q 030189           13 RRLKTKYNNAINVIQRTLALYSIEEVAFSFNGGKDSTVLLHLLRAGYFLHKGEQSCSNGSLTFPIRTIYFESNSAFPEIN   92 (181)
Q Consensus        13 ~~l~~~~~~a~~~i~~~~~~~~~~~i~va~SGGKDS~vll~L~~~~~~~~~~~~~~~~~~~~~~~~~v~idtg~~fpe~~   92 (181)
                      ..|+.++++|+++|+++++.+  ++++++|||||||+|+|||+++++.  +         ...+++++|+|||.+||||+
T Consensus        17 ~~L~~le~esi~ilrea~~~f--~~~~v~~SgGKDS~VlLhLa~kaf~--~---------~~~~~pvl~VDTG~~FpEt~   83 (312)
T PRK12563         17 GHLDRLEAESIHILREVVAEC--SKPVMLYSIGKDSVVMLHLAMKAFR--P---------TRPPFPLLHVDTTWKFREMI   83 (312)
T ss_pred             hHHHHHHHHHHHHHHHHHHhc--CCcEEEecCChHHHHHHHHHHHhhc--c---------cCCCeeEEEeCCCCCCHHHH
Confidence            569999999999999999998  4679999999999999999999863  1         11478999999999999999


Q ss_pred             HHHHHHhhhcCceEEEEccc--------------------HH-HHHHHHHHhCCCcEEEEeeeCCCcc-ccCCcccCCCC
Q 030189           93 SFTYDTASKYVLQLDIIRSD--------------------FK-SGLEALLNAKPIRAIFLGVRIGDPT-AVGQEQFSPSS  150 (181)
Q Consensus        93 ~f~~~~~~~~~l~~~~~~~~--------------------~k-~~l~~~~~~~~~~~~i~G~R~~es~-~~~~~~~~~~~  150 (181)
                      +|+++++++||++++++.+.                    +| +||++++++.+.++||+|+|++|+. |..+..++..+
T Consensus        84 efrD~~a~~~gl~Liv~~~~~~~~~G~~~~~~~~~~~c~~~Kv~pL~raL~~~g~da~itG~RRdE~~sRak~~ifs~r~  163 (312)
T PRK12563         84 DFRDRRAKELGLDLVVHHNPDGIARGIVPFRHGSALHTDVAKTQGLKQALDHHGFDAAIGGARRDEEKSRAKERIFSFRS  163 (312)
T ss_pred             HHHHHHHHHhCCcEEEecChHHHHhCCCcccCCHHHHhhHHhHHHHHHHHHhcCCCEEEEecCHHHhhhhccCceecccc
Confidence            99999999999999886542                    22 5899999888999999999999965 54555555322


Q ss_pred             --CCC------C-------------CeeEEecccCCchHHHHHHHhccccC
Q 030189          151 --PGW------P-------------PFMRVNPILDWSYRLLINNKLFGFIG  180 (181)
Q Consensus       151 --~~~------~-------------~~~~i~Pi~~Wt~~dVw~yi~~~~~~  180 (181)
                        .+|      |             +.+|++||++||+.|||.||..|+|-
T Consensus       164 ~~~~wD~~~qrPelw~~~n~~~~~g~~~RV~PL~~WTe~DVW~YI~~~~IP  214 (312)
T PRK12563        164 AFHRWDPKAQRPELWSLYNARLRRGESLRVFPLSNWTELDVWQYIAREKIP  214 (312)
T ss_pred             cccccCccccChhhhhhccccccCCceEEEecchhCCHHHHHHHHHHcCCC
Confidence              112      1             37899999999999999999999874

>TIGR02057 PAPS_reductase phosphoadenosine phosphosulfate reductase, thioredoxin dependent Back     alignment and domain information
>TIGR00434 cysH phosophoadenylyl-sulfate reductase (thioredoxin) Back     alignment and domain information
>TIGR02039 CysD sulfate adenylyltransferase, small subunit Back     alignment and domain information
>PRK05253 sulfate adenylyltransferase subunit 2; Provisional Back     alignment and domain information
>COG0175 CysH 3'-phosphoadenosine 5'-phosphosulfate sulfotransferase (PAPS reductase)/FAD synthetase and related enzymes [Amino acid transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>PRK08557 hypothetical protein; Provisional Back     alignment and domain information
>PRK13794 hypothetical protein; Provisional Back     alignment and domain information
>PRK02090 phosphoadenosine phosphosulfate reductase; Provisional Back     alignment and domain information
>PF01507 PAPS_reduct: Phosphoadenosine phosphosulfate reductase family; InterPro: IPR002500 This domain is found in phosphoadenosine phosphosulphate (PAPS) reductase enzymes or PAPS sulphotransferase Back     alignment and domain information
>PRK13795 hypothetical protein; Provisional Back     alignment and domain information
>PLN02309 5'-adenylylsulfate reductase Back     alignment and domain information
>TIGR00424 APS_reduc 5'-adenylylsulfate reductase, thioredoxin-independent Back     alignment and domain information
>cd01713 PAPS_reductase This domain is found in phosphoadenosine phosphosulphate (PAPS) reductase enzymes or PAPS sulphotransferase Back     alignment and domain information
>PRK08576 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02055 APS_reductase thioredoxin-dependent adenylylsulfate APS reductase Back     alignment and domain information
>PRK06850 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03183 DNA_S_dndC putative sulfurtransferase DndC Back     alignment and domain information
>KOG0189 consensus Phosphoadenosine phosphosulfate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>COG3969 Predicted phosphoadenosine phosphosulfate sulfotransferase [General function prediction only] Back     alignment and domain information
>KOG2644 consensus 3'-phosphoadenosine 5'-phosphosulfate sulfotransferase (PAPS reductase)/FAD synthetase and related enzymes [Amino acid transport and metabolism; Coenzyme transport and metabolism] Back     alignment and domain information
>cd01992 PP-ATPase N-terminal domain of predicted ATPase of the PP-loop faimly implicated in cell cycle control [Cell division and chromosome partitioning] Back     alignment and domain information
>TIGR02432 lysidine_TilS_N tRNA(Ile)-lysidine synthetase, N-terminal domain Back     alignment and domain information
>cd01993 Alpha_ANH_like_II This is a subfamily of Adenine nucleotide alpha hydrolases superfamily Back     alignment and domain information
>PRK10696 tRNA 2-thiocytidine biosynthesis protein TtcA; Provisional Back     alignment and domain information
>PF01171 ATP_bind_3: PP-loop family; InterPro: IPR011063 This entry represents the PP-loop motif superfamily [,] Back     alignment and domain information
>COG0037 MesJ tRNA(Ile)-lysidine synthase MesJ [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd01990 Alpha_ANH_like_I This is a subfamily of Adenine nucleotide alpha hydrolases superfamily Back     alignment and domain information
>PRK00919 GMP synthase subunit B; Validated Back     alignment and domain information
>PRK00074 guaA GMP synthase; Reviewed Back     alignment and domain information
>TIGR00268 conserved hypothetical protein TIGR00268 Back     alignment and domain information
>PRK10660 tilS tRNA(Ile)-lysidine synthetase; Provisional Back     alignment and domain information
>cd01995 ExsB ExsB is a transcription regulator related protein Back     alignment and domain information
>TIGR00884 guaA_Cterm GMP synthase (glutamine-hydrolyzing), C-terminal domain or B subunit Back     alignment and domain information
>cd01712 ThiI ThiI is required for thiazole synthesis in the thiamine biosynthesis pathway Back     alignment and domain information
>PRK14561 hypothetical protein; Provisional Back     alignment and domain information
>cd01997 GMP_synthase_C The C-terminal domain of GMP synthetase Back     alignment and domain information
>PRK00143 mnmA tRNA-specific 2-thiouridylase MnmA; Reviewed Back     alignment and domain information
>PRK08349 hypothetical protein; Validated Back     alignment and domain information
>TIGR00420 trmU tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase Back     alignment and domain information
>COG1606 ATP-utilizing enzymes of the PP-loop superfamily [General function prediction only] Back     alignment and domain information
>cd01998 tRNA_Me_trans tRNA methyl transferase Back     alignment and domain information
>cd01996 Alpha_ANH_like_III This is a subfamily of Adenine nucleotide alpha hydrolases superfamily Back     alignment and domain information
>TIGR00552 nadE NAD+ synthetase Back     alignment and domain information
>cd00553 NAD_synthase NAD+ synthase is a homodimer, which catalyzes the final step in de novo nicotinamide adenine dinucleotide (NAD+) biosynthesis, an amide transfer from either ammonia or glutamine to nicotinic acid adenine dinucleotide (NaAD) Back     alignment and domain information
>PRK13980 NAD synthetase; Provisional Back     alignment and domain information
>PLN02347 GMP synthetase Back     alignment and domain information
>TIGR00364 exsB protein Back     alignment and domain information
>PRK14665 mnmA tRNA-specific 2-thiouridylase MnmA; Provisional Back     alignment and domain information
>PRK08384 thiamine biosynthesis protein ThiI; Provisional Back     alignment and domain information
>cd01999 Argininosuccinate_Synthase Argininosuccinate synthase Back     alignment and domain information
>TIGR00342 thiazole biosynthesis/tRNA modification protein ThiI Back     alignment and domain information
>cd01986 Alpha_ANH_like Adenine nucleotide alpha hydrolases superfamily including N type ATP PPases and ATP sulphurylases Back     alignment and domain information
>PRK00509 argininosuccinate synthase; Provisional Back     alignment and domain information
>PRK13820 argininosuccinate synthase; Provisional Back     alignment and domain information
>TIGR03573 WbuX N-acetyl sugar amidotransferase Back     alignment and domain information
>TIGR00032 argG argininosuccinate synthase Back     alignment and domain information
>cd01994 Alpha_ANH_like_IV This is a subfamily of Adenine nucleotide alpha hydrolases superfamily Back     alignment and domain information
>PLN00200 argininosuccinate synthase; Provisional Back     alignment and domain information
>PRK14664 tRNA-specific 2-thiouridylase MnmA; Provisional Back     alignment and domain information
>PRK11106 queuosine biosynthesis protein QueC; Provisional Back     alignment and domain information
>PRK01565 thiamine biosynthesis protein ThiI; Provisional Back     alignment and domain information
>PTZ00323 NAD+ synthase; Provisional Back     alignment and domain information
>PRK04527 argininosuccinate synthase; Provisional Back     alignment and domain information
>PRK01269 tRNA s(4)U8 sulfurtransferase; Provisional Back     alignment and domain information
>PF02540 NAD_synthase: NAD synthase; InterPro: IPR022310 NAD+ synthase (6 Back     alignment and domain information
>PF06508 QueC: Queuosine biosynthesis protein QueC; InterPro: IPR018317 This protein family is represented by a single member in nearly every completed large (> 1000 genes) prokaryotic genome Back     alignment and domain information
>TIGR03679 arCOG00187 arCOG00187 universal archaeal metal-binding-domain/4Fe-4S-binding-domain containing ABC transporter, ATP-binding protein Back     alignment and domain information
>COG0519 GuaA GMP synthase, PP-ATPase domain/subunit [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK00768 nadE NAD synthetase; Reviewed Back     alignment and domain information
>PF03054 tRNA_Me_trans: tRNA methyl transferase; InterPro: IPR004506 tRNA-specific 2-thiouridylase catalyzes the 2-thiolation of uridine at the wobble position (U34) of tRNA, leading to the formation of s(2)U34 Back     alignment and domain information
>PRK00876 nadE NAD synthetase; Reviewed Back     alignment and domain information
>cd01991 Asn_Synthase_B_C The C-terminal domain of Asparagine Synthase B Back     alignment and domain information
>COG2117 Predicted subunit of tRNA(5-methylaminomethyl-2-thiouridylate) methyltransferase, contains the PP-loop ATPase domain [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF02568 ThiI: Thiamine biosynthesis protein (ThiI); InterPro: IPR020536 Thiamine pyrophosphate (TPP) is synthesized de novo in many bacteria and is a required cofactor for many enzymes in the cell Back     alignment and domain information
>COG0603 Predicted PP-loop superfamily ATPase [General function prediction only] Back     alignment and domain information
>COG0482 TrmU Predicted tRNA(5-methylaminomethyl-2-thiouridylate) methyltransferase, contains the PP-loop ATPase domain [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00289 conserved hypothetical protein TIGR00289 Back     alignment and domain information
>TIGR00290 MJ0570_dom MJ0570-related uncharacterized domain Back     alignment and domain information
>TIGR01536 asn_synth_AEB asparagine synthase (glutamine-hydrolyzing) Back     alignment and domain information
>PRK13981 NAD synthetase; Provisional Back     alignment and domain information
>PF00733 Asn_synthase: Asparagine synthase; InterPro: IPR001962 This domain is always found associated with (IPR000583 from INTERPRO) Back     alignment and domain information
>PRK02628 nadE NAD synthetase; Reviewed Back     alignment and domain information
>cd01984 AANH_like Adenine nucleotide alpha hydrolases superfamily including N type ATP PPases, ATP sulphurylases Universal Stress Response protein and electron transfer flavoprotein (ETF) Back     alignment and domain information
>KOG2805 consensus tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK05370 argininosuccinate synthase; Validated Back     alignment and domain information
>KOG1622 consensus GMP synthase [Nucleotide transport and metabolism] Back     alignment and domain information
>PF00764 Arginosuc_synth: Arginosuccinate synthase; InterPro: IPR001518 Argininosuccinate synthase (6 Back     alignment and domain information
>COG0301 ThiI Thiamine biosynthesis ATP pyrophosphatase [Coenzyme metabolism] Back     alignment and domain information
>PF01902 ATP_bind_4: ATP-binding region; InterPro: IPR002761 This domain is about 200 amino acids long with a strongly conserved motif SGGKD at the N-terminal Back     alignment and domain information
>COG0137 ArgG Argininosuccinate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK09431 asnB asparagine synthetase B; Provisional Back     alignment and domain information
>PLN02549 asparagine synthase (glutamine-hydrolyzing) Back     alignment and domain information
>COG0171 NadE NAD synthase [Coenzyme metabolism] Back     alignment and domain information
>PTZ00077 asparagine synthetase-like protein; Provisional Back     alignment and domain information
>TIGR03108 eps_aminotran_1 exosortase 1 system-associated amidotransferase 1 Back     alignment and domain information
>COG0367 AsnB Asparagine synthase (glutamine-hydrolyzing) [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03104 trio_amidotrans asparagine synthase family amidotransferase Back     alignment and domain information
>COG2102 Predicted ATPases of PP-loop superfamily [General function prediction only] Back     alignment and domain information
>COG1365 Predicted ATPase (PP-loop superfamily) [General function prediction only] Back     alignment and domain information
>KOG2840 consensus Uncharacterized conserved protein with similarity to predicted ATPase of the PP-loop superfamily [General function prediction only] Back     alignment and domain information
>PLN02339 NAD+ synthase (glutamine-hydrolysing) Back     alignment and domain information
>cd01987 USP_OKCHK USP domain is located between the N-terminal sensor domain and C-terminal catalytic domain of this Osmosensitive K+ channel histidine kinase family Back     alignment and domain information
>KOG2594 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd00293 USP_Like Usp: Universal stress protein family Back     alignment and domain information
>cd01988 Na_H_Antiporter_C The C-terminal domain of a subfamily of Na+ /H+ antiporter existed in bacteria and archea Back     alignment and domain information
>KOG0573 consensus Asparagine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0571 consensus Asparagine synthase (glutamine-hydrolyzing) [Amino acid transport and metabolism] Back     alignment and domain information
>PRK10490 sensor protein KdpD; Provisional Back     alignment and domain information
>PRK09982 universal stress protein UspD; Provisional Back     alignment and domain information
>cd01989 STK_N The N-terminal domain of Eukaryotic Serine Threonine kinases Back     alignment and domain information
>COG2205 KdpD Osmosensitive K+ channel histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>PRK15118 universal stress global response regulator UspA; Provisional Back     alignment and domain information
>PRK10116 universal stress protein UspC; Provisional Back     alignment and domain information
>PF00582 Usp: Universal stress protein family; InterPro: IPR006016 The universal stress protein UspA P28242 from SWISSPROT [] is a small cytoplasmic bacterial protein whose expression is enhanced when the cell is exposed to stress agents Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query181
2wsi_A306 Crystal Structure Of Yeast Fad Synthetase (Fad1) In 4e-10
3fwk_A308 Crystal Structure Of Candida Glabrata Fmn Adenylylt 2e-09
>pdb|2WSI|A Chain A, Crystal Structure Of Yeast Fad Synthetase (Fad1) In Complex With Fad Length = 306 Back     alignment and structure 
Iteration: 1

 Score = 60.8 bits (146), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 49/166 (29%), Positives = 76/166 (45%), Gaps = 24/166 (14%)
Query: 37  EVAFSFNGGKDSTVLLHLLRAG---YFLHKGEQSCSNGSL-TFPIR---TIYFESNSAFP 89
           E++FS+NGGKD  VLL L  +    YF  K + S  +    +FP++   T++ +    FP
Sbjct: 55  EISFSYNGGKDCQVLLLLYLSCLWEYFFIKAQNSQFDFEFQSFPMQRLPTVFIDQEETFP 114
Query: 90  EINSFTYDTASKYVLQLDIIRSDFKSG--------LEALLNAKP-IRAIFLGVRIGDPTA 140
            + +F  +T+ +Y L L    S  +SG            +   P   AI +G+R  DP  
Sbjct: 115 TLENFVLETSERYCLSL--YESQRQSGASVNMADAFRDFIKIYPETEAIVIGIRHTDPFG 172
Query: 141 VGQEQFSPSSPGWPPFMRVNPILD------WSYRLLINNKLFGFIG 180
              +    +   WP FMR+ P+L       WS+ L  N  + G  G
Sbjct: 173 EALKPIQRTDSNWPDFMRLQPLLHWDLTNIWSFLLYSNEPICGLYG 218
>pdb|3FWK|A Chain A, Crystal Structure Of Candida Glabrata Fmn Adenylyltransferase Length = 308 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query181
3fwk_A308 FMN adenylyltransferase; FAD biosynthesis, alpha/b 3e-32
2wsi_A306 FAD synthetase; transferase, nucleotidyltransferas 9e-31
1zun_A 325 Sulfate adenylyltransferase subunit 2; beta barrel 1e-06
>3fwk_A FMN adenylyltransferase; FAD biosynthesis, alpha/beta protein, rossmann- like fold, APO-form, extended loop region; HET: BGC; 1.20A {Candida glabrata} PDB: 3g59_A* 3g5a_A* 3g6k_A* Length = 308 Back     alignment and structure
 Score =  116 bits (291), Expect = 3e-32
 Identities = 42/179 (23%), Positives = 74/179 (41%), Gaps = 19/179 (10%)

Query: 9   ESDDRRLKTKYNNAIN-----VIQRTLALYS--IEEVAFSFNGGKDSTVLLHLLRAGYFL 61
            ++   +  +   AIN     +I  T   +S    E++FS+NGGKD  VLL L  +  + 
Sbjct: 25  AAESDSIIAQTQRAINTTKSILINETFPKWSPLNGEISFSYNGGKDCQVLLLLYLSCLWE 84

Query: 62  HKGEQSCSNGSLTF-------PIRTIYFESNSAFPEINSFTYDTASKYVLQLDIIRSD-- 112
           +   +   +             + T++ + +  F  + +F  +T+ +Y L L     D  
Sbjct: 85  YYIVKLSQSQFDGKFHRFPLTKLPTVFIDHDDTFKTLENFIEETSLRYSLSLYESDRDKC 144

Query: 113 --FKSGLEALLNAKP-IRAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPILDWSYR 168
                  E  L   P  +AI +G+R  DP     +    +   WP F R+ P+L W+  
Sbjct: 145 ETMAEAFETFLQVFPETKAIVIGIRHTDPFGEHLKPIQKTDANWPDFYRLQPLLHWNLA 203
>2wsi_A FAD synthetase; transferase, nucleotidyltransferase, nucleotide-binding; HET: FAD; 1.90A {Saccharomyces cerevisiae} Length = 306 Back     alignment and structure
>1zun_A Sulfate adenylyltransferase subunit 2; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae} SCOP: c.26.2.2 Length = 325 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query181
3fwk_A308 FMN adenylyltransferase; FAD biosynthesis, alpha/b 100.0
2wsi_A306 FAD synthetase; transferase, nucleotidyltransferas 100.0
1zun_A 325 Sulfate adenylyltransferase subunit 2; beta barrel 99.97
2oq2_A261 Phosphoadenosine phosphosulfate reductase; sulfate 99.97
2o8v_A252 Phosphoadenosine phosphosulfate reductase; disulfi 99.96
1sur_A215 PAPS reductase; assimilatory sulfate reduction, 3- 99.96
2goy_A275 Adenosine phosphosulfate reductase; iron sulfur cl 99.95
1wy5_A 317 TILS, hypothetical UPF0072 protein AQ_1887; N-type 99.68
2dpl_A 308 GMP synthetase, GMP synthase [glutamine-hydrolyzin 99.68
3a2k_A 464 TRNA(Ile)-lysidine synthase; ligase, pseudo-knot, 99.63
2ywb_A 503 GMP synthase [glutamine-hydrolyzing]; GMP syntheta 99.6
3bl5_A219 Queuosine biosynthesis protein QUEC; PREQ1 biosynt 99.55
1kor_A 400 Argininosuccinate synthetase; ligase, riken struct 99.52
1ni5_A 433 Putative cell cycle protein MESJ; structural genom 99.5
3k32_A203 Uncharacterized protein MJ0690; predicted subunit 99.49
2pg3_A232 Queuosine biosynthesis protein QUEC; YP_049261.1, 99.47
3tqi_A 527 GMP synthase [glutamine-hydrolyzing]; ligase; 2.84 99.46
1xng_A268 NH(3)-dependent NAD(+) synthetase; amidotransferas 99.46
2e18_A257 NH(3)-dependent NAD(+) synthetase; ligase, structu 99.42
3p52_A249 NH(3)-dependent NAD(+) synthetase; structural geno 99.35
1gpm_A 525 GMP synthetase, XMP aminase; class I glutamine ami 99.35
2hma_A 376 Probable tRNA (5-methylaminomethyl-2-thiouridylat 99.33
2c5s_A413 THII, probable thiamine biosynthesis protein THII; 99.27
3fiu_A249 NH(3)-dependent NAD(+) synthetase; rossman fold, a 99.26
2der_A 380 TRNA-specific 2-thiouridylase MNMA; protein-RNA co 99.26
3uow_A 556 GMP synthetase; structural genomics consortium, SG 99.17
2nz2_A 413 Argininosuccinate synthase; amino-acid biosynthesi 99.07
1k92_A 455 Argininosuccinate synthase, argininosuccinate SY; 99.03
2vxo_A 697 GMP synthase [glutamine-hydrolyzing]; proto-oncoge 99.03
3n05_A 590 NH(3)-dependent NAD(+) synthetase; ligase, structu 98.84
1kqp_A271 NAD+ synthase, NH(3)-dependent NAD(+) synthetase, 98.66
1vl2_A 421 Argininosuccinate synthase; TM1780, structural gen 98.64
1wxi_A275 NH(3)-dependent NAD(+) synthetase; NADE, E.coli, l 98.62
1vbk_A307 Hypothetical protein PH1313; structural genomics, 98.58
3rjz_A237 N-type ATP pyrophosphatase superfamily; structural 98.55
3dpi_A285 NAD+ synthetase; ssgcid, decode, structural genomi 98.34
3q4g_A279 NH(3)-dependent NAD(+) synthetase; structural geno 98.28
3sdb_A 680 Glutamine-dependent NAD(+) synthetase; glutamine-a 98.09
1jgt_A 513 Beta-lactam synthetase; asparagine synthetase, cla 97.71
1ct9_A 553 Asparagine synthetase B; amidotransferase, substra 97.64
3ilv_A 634 Glutamine-dependent NAD(+) synthetase; protein str 97.56
1q15_A 503 CARA; CMPR, (2S,5S)-5-carboxymethylproline, B-LS, 97.38
4f4h_A 565 Glutamine dependent NAD+ synthetase; structural ge 97.28
3tnj_A150 Universal stress protein (USP); structural genomic 95.89
3fdx_A143 Putative filament protein / universal stress PROT; 94.93
1jmv_A141 USPA, universal stress protein A; chaperone; 1.85A 94.86
2z08_A137 Universal stress protein family; uncharacterized c 94.6
3loq_A294 Universal stress protein; structural genomics, PSI 94.47
1tq8_A163 Hypothetical protein RV1636; MTCY01B2.28, structur 92.61
3mt0_A290 Uncharacterized protein PA1789; structural genomic 92.46
3fg9_A156 Protein of universal stress protein USPA family; A 92.41
3s3t_A146 Nucleotide-binding protein, universal stress PROT 92.23
3olq_A319 Universal stress protein E; structural genomics, P 90.65
3dlo_A155 Universal stress protein; unknown function, struct 90.53
3idf_A138 USP-like protein; universal, stress, PSI, MCSG, st 90.31
3hgm_A147 Universal stress protein TEAD; rossman fold, signa 89.93
1mjh_A162 Protein (ATP-binding domain of protein MJ0577); hy 89.13
3mt0_A 290 Uncharacterized protein PA1789; structural genomic 88.34
2dum_A170 Hypothetical protein PH0823; conserved hypothetica 87.33
3cis_A309 Uncharacterized protein; alpha/beta hydrolase, ATP 84.15
>3fwk_A FMN adenylyltransferase; FAD biosynthesis, alpha/beta protein, rossmann- like fold, APO-form, extended loop region; HET: BGC; 1.20A {Candida glabrata} PDB: 3g59_A* 3g5a_A* 3g6k_A* Back     alignment and structure
Probab=100.00  E-value=2.1e-38  Score=260.61  Aligned_cols=167  Identities=25%  Similarity=0.430  Sum_probs=138.2

Q ss_pred             HHHHHHHHHHH-HHHHHHHhcCC--CceEEEecCchhHHHHHHHHHHHhhhhc---CCCCCCC----CCCCCCceEEEec
Q 030189           14 RLKTKYNNAIN-VIQRTLALYSI--EEVAFSFNGGKDSTVLLHLLRAGYFLHK---GEQSCSN----GSLTFPIRTIYFE   83 (181)
Q Consensus        14 ~l~~~~~~a~~-~i~~~~~~~~~--~~i~va~SGGKDS~vll~L~~~~~~~~~---~~~~~~~----~~~~~~~~~v~id   83 (181)
                      .++.+++.|++ +|++++++|++  +++++||||||||+|||||+++++..+.   ......+    +.+..++++||+|
T Consensus        34 ~~q~qir~S~~~iLrea~~~f~~~~~~ialSfSGGKDStVLLhL~~kal~~~~~~~~~~~~~~~~~~~~p~~~ipvifiD  113 (308)
T 3fwk_A           34 QTQRAINTTKSILINETFPKWSPLNGEISFSYNGGKDCQVLLLLYLSCLWEYYIVKLSQSQFDGKFHRFPLTKLPTVFID  113 (308)
T ss_dssp             HHHHHHHHHHHHHHHHTTTTSCSSSSSEEEECCSSHHHHHHHHHHHHHHHHHHTCCE-----------------EEEECC
T ss_pred             HHHHHHHHHHHHHHHHHHHHcccccCCEEEEecCChhHHHHHHHHHHHhhhhcccccccccccccccccCCCCccEEEEe
Confidence            37888889995 99999999986  7899999999999999999999853110   0000000    0011469999999


Q ss_pred             CCCCchHHHHHHHHHhhhcCceEEEEccc----HHHHHHHHHHhC-CCcEEEEeeeCCCccccCCcccCCCCCCCCCeeE
Q 030189           84 SNSAFPEINSFTYDTASKYVLQLDIIRSD----FKSGLEALLNAK-PIRAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMR  158 (181)
Q Consensus        84 tg~~fpe~~~f~~~~~~~~~l~~~~~~~~----~k~~l~~~~~~~-~~~~~i~G~R~~es~~~~~~~~~~~~~~~~~~~~  158 (181)
                      ||.+||||++|+++++++||++++++.|+    +++++.++++.. +.++||+|.|++|+.|+++..++.++++|++++|
T Consensus       114 TG~~FpET~ef~d~~~~~ygL~L~v~~p~~~~~~~~~cc~~~K~~P~~~AwitG~RR~e~~Ra~l~~~e~~d~~w~~~iK  193 (308)
T 3fwk_A          114 HDDTFKTLENFIEETSLRYSLSLYESDRDKCETMAEAFETFLQVFPETKAIVIGIRHTDPFGEHLKPIQKTDANWPDFYR  193 (308)
T ss_dssp             CTTCCHHHHHHHHHHHHHTTEEEEECCTTSCCCHHHHHHHHHHHCTTCCEEECCCCTTSTTCTTCCSEEECCTTSCSCEE
T ss_pred             CCCCCHHHHHHHHHHHHHhCCcEEEeCCCCCHHHHHHHHHHHHhCCCCCEEEEEeecCCcccCCCCeeeccCCCCCCeEE
Confidence            99999999999999999999999998875    888999999876 5899999999999888889899888878999999


Q ss_pred             EecccCCchHHHHHHHhccccC
Q 030189          159 VNPILDWSYRLLINNKLFGFIG  180 (181)
Q Consensus       159 i~Pi~~Wt~~dVw~yi~~~~~~  180 (181)
                      ++||++||+.|||.||..|++-
T Consensus       194 VnPL~dWT~~DVW~YI~~~~LP  215 (308)
T 3fwk_A          194 LQPLLHWNLANIWSFLLYSNEP  215 (308)
T ss_dssp             ECTTTTCCHHHHHHHHHHHTCC
T ss_pred             EechhhCCHHHHHHHHHHcCCC
Confidence            9999999999999999998763
>2wsi_A FAD synthetase; transferase, nucleotidyltransferase, nucleotide-binding; HET: FAD; 1.90A {Saccharomyces cerevisiae} Back     alignment and structure
>1zun_A Sulfate adenylyltransferase subunit 2; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae} SCOP: c.26.2.2 Back     alignment and structure
>2oq2_A Phosphoadenosine phosphosulfate reductase; sulfate reduction, PAPS reductase, oxidoreductase; HET: A3P; 2.10A {Saccharomyces cerevisiae} Back     alignment and structure
>2o8v_A Phosphoadenosine phosphosulfate reductase; disulfide crosslinked complex, oxidoreductase; 3.00A {Escherichia coli} Back     alignment and structure
>1sur_A PAPS reductase; assimilatory sulfate reduction, 3-phospho-adenylyl-sulfate reductase, oxidoreductase; 2.00A {Escherichia coli} SCOP: c.26.2.2 Back     alignment and structure
>2goy_A Adenosine phosphosulfate reductase; iron sulfur cluster, nucleotide binding, thiosulfonate intermediate, oxidoreductase; HET: ADX; 2.70A {Pseudomonas aeruginosa} Back     alignment and structure
>1wy5_A TILS, hypothetical UPF0072 protein AQ_1887; N-type ATP-ppase, structural genomics, translation, NPPSFA; 2.42A {Aquifex aeolicus} SCOP: c.26.2.5 d.229.1.1 PDB: 2e21_A* 2e89_A* Back     alignment and structure
>2dpl_A GMP synthetase, GMP synthase [glutamine-hydrolyzing] subunit B; pyrococcus horikoshii OT3, structural genomics, NPPSFA; 1.43A {Pyrococcus horikoshii} PDB: 2z0c_A 3a4i_A Back     alignment and structure
>3a2k_A TRNA(Ile)-lysidine synthase; ligase, pseudo-knot, ligase/RNA complex; 3.65A {Geobacillus kaustophilus} Back     alignment and structure
>2ywb_A GMP synthase [glutamine-hydrolyzing]; GMP synthetase, XMP binding, ATP binding, purine nucleotide biosynthetic pathway, structural genomics; 2.10A {Thermus thermophilus} PDB: 2ywc_A* Back     alignment and structure
>3bl5_A Queuosine biosynthesis protein QUEC; PREQ1 biosynthesis, RNA modification, tRNA, hydrolase; 2.95A {Bacillus subtilis} Back     alignment and structure
>1kor_A Argininosuccinate synthetase; ligase, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: ANP ARG; 1.95A {Thermus thermophilus} SCOP: c.26.2.1 d.210.1.1 PDB: 1j1z_A* 1j21_A* 1kh1_A 1kh2_A* 1kh3_A* 1j20_A* Back     alignment and structure
>1ni5_A Putative cell cycle protein MESJ; structural genomics, ATPase, PP-type, putative cell cycle PR PSI, protein structure initiative; 2.65A {Escherichia coli} SCOP: b.153.1.2 c.26.2.5 d.229.1.1 Back     alignment and structure
>3k32_A Uncharacterized protein MJ0690; predicted subunit of tRNA methyltransferase, methanocaldococcus jannaschii DSM , PSI- 2; 2.50A {Methanocaldococcus jannaschii} Back     alignment and structure
>2pg3_A Queuosine biosynthesis protein QUEC; YP_049261.1, hypothetical protein, structural genomics, JOIN for structural genomics; 2.40A {Pectobacterium atrosepticum SCRI1043} SCOP: c.26.2.1 Back     alignment and structure
>3tqi_A GMP synthase [glutamine-hydrolyzing]; ligase; 2.84A {Coxiella burnetii} Back     alignment and structure
>1xng_A NH(3)-dependent NAD(+) synthetase; amidotransferase, ligase; HET: DND ATP; 1.70A {Helicobacter pylori} SCOP: c.26.2.1 PDB: 1xnh_A Back     alignment and structure
>2e18_A NH(3)-dependent NAD(+) synthetase; ligase, structural genomics, NPPSFA, national project on Pro structural and functional analyses; 2.10A {Pyrococcus horikoshii} Back     alignment and structure
>3p52_A NH(3)-dependent NAD(+) synthetase; structural genomics, center for structural genomics of infec diseases, NADE, CSGI; 2.74A {Campylobacter jejuni} SCOP: c.26.2.0 Back     alignment and structure
>1gpm_A GMP synthetase, XMP aminase; class I glutamine amidotransferase, N-type ATP pyrophosphata transferase (glutamine amidotransferase); HET: AMP CIT; 2.20A {Escherichia coli} SCOP: c.23.16.1 c.26.2.1 d.52.2.1 Back     alignment and structure
>2hma_A Probable tRNA (5-methylaminomethyl-2-thiouridylat methyltransferase; alpha-beta, beta barrel, structural genomics, PSI-2; HET: MSE SAM; 2.41A {Streptococcus pneumoniae} Back     alignment and structure
>2c5s_A THII, probable thiamine biosynthesis protein THII; RNA-binding protein, RNA binding protein, tRNA modification, 4-thiouridine synthase; HET: AMP; 2.5A {Bacillus anthracis} SCOP: c.26.2.6 d.308.1.1 Back     alignment and structure
>3fiu_A NH(3)-dependent NAD(+) synthetase; rossman fold, adenine nucleotide alpha hydrolase-like, ATP- binding, ligase, nucleotide-binding; HET: AMP; 1.85A {Francisella tularensis subsp} Back     alignment and structure
>2der_A TRNA-specific 2-thiouridylase MNMA; protein-RNA complex, transferase/RNA complex; 3.10A {Escherichia coli} PDB: 2det_A 2deu_A* Back     alignment and structure
>3uow_A GMP synthetase; structural genomics consortium, SGC, purine nucleotide biosy process, ligase; HET: XMP; 2.72A {Plasmodium falciparum} Back     alignment and structure
>2nz2_A Argininosuccinate synthase; amino-acid biosynthesis, aspartate, citrulline, ST genomics, structural genomics consortium, SGC, ligase; HET: CIR; 2.40A {Homo sapiens} Back     alignment and structure
>1k92_A Argininosuccinate synthase, argininosuccinate SY; N-type ATP pyrophosphatase, ligase; 1.60A {Escherichia coli} SCOP: c.26.2.1 d.210.1.1 PDB: 1k97_A* 1kp2_A* 1kp3_A* Back     alignment and structure
>2vxo_A GMP synthase [glutamine-hydrolyzing]; proto-oncogene, phosphoprotein, GMP synthetase, guanine monophosphate synthetase, chromosomal rearrangement; HET: XMP; 2.5A {Homo sapiens} Back     alignment and structure
>3n05_A NH(3)-dependent NAD(+) synthetase; ligase, structural genomics, protein structure initiative, P nysgrc; 2.35A {Streptomyces avermitilis} Back     alignment and structure
>1kqp_A NAD+ synthase, NH(3)-dependent NAD(+) synthetase, SPOR; ligase, amidotransferase, ATP pyrophosphatase, NAD-adenylate; HET: ADJ; 1.03A {Bacillus subtilis} SCOP: c.26.2.1 PDB: 1fyd_A* 1ifx_A* 1ee1_A* 1ih8_A* 1nsy_A* 2nsy_A* 2pzb_A 2pza_A* 2pz8_A Back     alignment and structure
>1vl2_A Argininosuccinate synthase; TM1780, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics, ligase; 1.65A {Thermotoga maritima} SCOP: c.26.2.1 d.210.1.1 Back     alignment and structure
>1wxi_A NH(3)-dependent NAD(+) synthetase; NADE, E.coli, ligase; HET: AMP; 1.70A {Escherichia coli} SCOP: c.26.2.1 PDB: 1wxf_A 1wxg_A* 1wxh_A* 1wxe_A* 3hmq_A* Back     alignment and structure
>1vbk_A Hypothetical protein PH1313; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 1.90A {Pyrococcus horikoshii} SCOP: c.26.2.6 d.308.1.1 Back     alignment and structure
>3rjz_A N-type ATP pyrophosphatase superfamily; structural genomics, PSI-biology, northeast structural genom consortium, NESG, alpha-beta protein; 2.30A {Pyrococcus furiosus} SCOP: c.26.2.1 PDB: 3h7e_A 3rk0_A* 3rk1_A* 1ru8_A 2d13_A Back     alignment and structure
>3dpi_A NAD+ synthetase; ssgcid, decode, structural genomics, PSI, protein structure initiative; 2.20A {Burkholderia pseudomallei} SCOP: c.26.2.0 Back     alignment and structure
>3q4g_A NH(3)-dependent NAD(+) synthetase; structural genomics, csgid, center for structural genomics O infectious diseases, alpha beta; 2.40A {Vibrio cholerae} SCOP: c.26.2.0 Back     alignment and structure
>3sdb_A Glutamine-dependent NAD(+) synthetase; glutamine-amidotransferase, glutaminase, glutamine-dependent synthetase, ligase; 2.00A {Mycobacterium tuberculosis} PDB: 3seq_A* 3sez_A* 3szg_A* 3dla_A* 3syt_A* Back     alignment and structure
>1jgt_A Beta-lactam synthetase; asparagine synthetase, clavulanic AC AMPCPP, CEA, carboxyethylarginine, hydrolase; HET: APC CMA; 1.95A {Streptomyces clavuligerus} SCOP: c.26.2.1 d.153.1.1 PDB: 1m1z_A 1mb9_A* 1mbz_A* 1mc1_A* Back     alignment and structure
>1ct9_A Asparagine synthetase B; amidotransferase, substrate channeling, asparagine biosynthesis, ligase; HET: AMP GLN; 2.00A {Escherichia coli} SCOP: c.26.2.1 d.153.1.1 Back     alignment and structure
>3ilv_A Glutamine-dependent NAD(+) synthetase; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 1.79A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>1q15_A CARA; CMPR, (2S,5S)-5-carboxymethylproline, B-LS, B-lactam synthetase, AS-B, class B asparagine synthetase, AMP-CPP; 2.30A {Pectobacterium carotovorum} SCOP: c.26.2.1 d.153.1.1 PDB: 1q19_A* Back     alignment and structure
>4f4h_A Glutamine dependent NAD+ synthetase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ligase; 1.75A {Burkholderia thailandensis} Back     alignment and structure
>3tnj_A Universal stress protein (USP); structural genomics, PSI-biology, midwest center for structu genomics, MCSG, chaperone; HET: AMP; 2.00A {Nitrosomonas europaea} PDB: 2pfs_A* Back     alignment and structure
>3fdx_A Putative filament protein / universal stress PROT; structural genomics, APC60640.1, universal protein F, PSI-2; HET: MSE ATP; 1.58A {Klebsiella pneumoniae subsp} PDB: 3fh0_A* Back     alignment and structure
>1jmv_A USPA, universal stress protein A; chaperone; 1.85A {Haemophilus influenzae} SCOP: c.26.2.4 Back     alignment and structure
>2z08_A Universal stress protein family; uncharacterized conserved protein, structural genomics, unknown function, NPPSFA; HET: ATP; 1.55A {Thermus thermophilus} SCOP: c.26.2.4 PDB: 1wjg_A* 2z09_A* 2z3v_A Back     alignment and structure
>3loq_A Universal stress protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: AMP; 2.32A {Archaeoglobus fulgidus} Back     alignment and structure
>1tq8_A Hypothetical protein RV1636; MTCY01B2.28, structural target, NYSGXRC, PSI, protein structure initiative; 2.40A {Mycobacterium tuberculosis} SCOP: c.26.2.4 Back     alignment and structure
>3mt0_A Uncharacterized protein PA1789; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 1.58A {Pseudomonas aeruginosa} Back     alignment and structure
>3fg9_A Protein of universal stress protein USPA family; APC60691, nucleotide- binding, lactobacillus plantarum WCFS1, structural genomics PSI-2; 1.47A {Lactobacillus plantarum} Back     alignment and structure
>3s3t_A Nucleotide-binding protein, universal stress PROT family; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: ATP; 1.90A {Lactobacillus plantarum} SCOP: c.26.2.0 Back     alignment and structure
>3olq_A Universal stress protein E; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: UNL; 1.82A {Proteus mirabilis} Back     alignment and structure
>3dlo_A Universal stress protein; unknown function, structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics; HET: MSE; 1.97A {Archaeoglobus fulgidus} PDB: 3qtb_A* Back     alignment and structure
>3idf_A USP-like protein; universal, stress, PSI, MCSG, structural genomics, midwest center for structural genomics structure initiative; 2.00A {Wolinella succinogenes} Back     alignment and structure
>3hgm_A Universal stress protein TEAD; rossman fold, signaling protein; HET: ATP; 1.90A {Halomonas elongata} SCOP: c.26.2.0 Back     alignment and structure
>1mjh_A Protein (ATP-binding domain of protein MJ0577); hypothetical protein, structural genomics, functional assignment; HET: ATP; 1.70A {Methanocaldococcus jannaschii} SCOP: c.26.2.4 Back     alignment and structure
>3mt0_A Uncharacterized protein PA1789; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 1.58A {Pseudomonas aeruginosa} Back     alignment and structure
>2dum_A Hypothetical protein PH0823; conserved hypothetical protein, putative universal protein A structural genomics, NPPSFA; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>3cis_A Uncharacterized protein; alpha/beta hydrolase, ATP, universal stress protein, unknown function; HET: ATP; 2.90A {Mycobacterium tuberculosis} PDB: 2jax_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 181
d1zuna1211 c.26.2.2 (A:1-211) Sulfate adenylyltransferase sub 6e-10
d1sura_215 c.26.2.2 (A:) Phosphoadenylyl sulphate (PAPS) redu 6e-05
d1j20a1165 c.26.2.1 (A:1-165) Argininosuccinate synthetase, N 0.001
d1ni5a1227 c.26.2.5 (A:0-226) tRNA-Ile-lysidine synthetase, T 0.003
>d1zuna1 c.26.2.2 (A:1-211) Sulfate adenylyltransferase subunit 2, CysD {Pseudomonas syringae pv. tomato [TaxId: 323]} Length = 211 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Adenine nucleotide alpha hydrolase-like
superfamily: Adenine nucleotide alpha hydrolases-like
family: PAPS reductase-like
domain: Sulfate adenylyltransferase subunit 2, CysD
species: Pseudomonas syringae pv. tomato [TaxId: 323]

 Score = 53.9 bits (128), Expect = 6e-10
 Identities = 31/197 (15%), Positives = 59/197 (29%), Gaps = 56/197 (28%)

Query: 15  LKTKYNNAINVIQRTLALYSIEEVAFSFNGGKDSTVLLHLLRAGYFLHKGEQSCSNGSLT 74
           LK     +I++I+   A +  +     ++ GKDS V+LHL R  +F  K           
Sbjct: 8   LKQLEAESIHIIREVAAEF--DNPVMLYSIGKDSAVMLHLARKAFFPGK----------- 54

Query: 75  FPIRTIYFESNSAFPEINSFTYDTASKYVLQLDIIRSD---------------------- 112
            P   ++ ++   F E+  F      +  L L    +                       
Sbjct: 55  LPFPVMHVDTRWKFQEMYRFRDQMVEEMGLDLITHINPDGVAQGINPFTHGSAKHTDIMK 114

Query: 113 FKSGLEALLNAKPIRAIFLGVRIGDPTAVGQEQFSP---------------------SSP 151
            +   +AL       A     R  + +   +  +S                       + 
Sbjct: 115 TEGLKQALDKHGFDAAFGGARRDEEKSRAKERVYSFRDSKHRWDPKNQRPELWNVYNGNV 174

Query: 152 GWPPFMRVNPILDWSYR 168
                +RV P+ +W+  
Sbjct: 175 NKGESIRVFPLSNWTEL 191
>d1sura_ c.26.2.2 (A:) Phosphoadenylyl sulphate (PAPS) reductase {Escherichia coli [TaxId: 562]} Length = 215 Back     information, alignment and structure
>d1j20a1 c.26.2.1 (A:1-165) Argininosuccinate synthetase, N-terminal domain {Thermus thermophilus [TaxId: 274]} Length = 165 Back     information, alignment and structure
>d1ni5a1 c.26.2.5 (A:0-226) tRNA-Ile-lysidine synthetase, TilS, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 227 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query181
d1sura_215 Phosphoadenylyl sulphate (PAPS) reductase {Escheri 100.0
d1zuna1211 Sulfate adenylyltransferase subunit 2, CysD {Pseud 99.96
d1wy5a1216 TilS-like protein Aq_1887 {Aquifex aeolicus [TaxId 99.71
d1ni5a1227 tRNA-Ile-lysidine synthetase, TilS, N-terminal dom 99.61
d2c5sa1218 Thiamine biosynthesis protein ThiI, C-terminal dom 99.51
d1k92a1188 Argininosuccinate synthetase, N-terminal domain {E 99.12
d1j20a1165 Argininosuccinate synthetase, N-terminal domain {T 99.05
d1xnga1255 NH3-dependent NAD+-synthetase {Helicobacter pylori 99.02
d1vl2a1168 Argininosuccinate synthetase, N-terminal domain {T 99.01
d1gpma1197 GMP synthetase, central domain {Escherichia coli [ 98.96
d2pg3a1230 Queuosine biosynthesis protein QueC {Erwinia carot 98.65
d2d13a1226 Hypothetical protein PH1257 {Archaeon Pyrococcus h 98.19
d1wxia1274 NH3-dependent NAD+-synthetase {Escherichia coli [T 98.06
d1kqpa_271 NH3-dependent NAD+-synthetase {Bacillus subtilis [ 98.04
d1jgta1 299 beta-Lactam synthetase {Streptomyces clavuligerus 97.66
d1q15a1 296 beta-Lactam synthetase {Pectobacterium carotovorum 97.65
d1vbka1132 Hypothetical protein PH1313, C-terminal domain {Ar 97.65
d1ct9a1 324 Asparagine synthetase B, C-terminal domain {Escher 97.4
d1jmva_140 Universal stress protein A, UspA {Haemophilus infl 93.8
d2z3va1135 Hypothetical protein TTHA0895 {Thermus thermophilu 90.66
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 85.26
d1q77a_138 Hypothetical protein Aq_178 {Aquifex aeolicus [Tax 85.02
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 80.41
>d1sura_ c.26.2.2 (A:) Phosphoadenylyl sulphate (PAPS) reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Adenine nucleotide alpha hydrolase-like
superfamily: Adenine nucleotide alpha hydrolases-like
family: PAPS reductase-like
domain: Phosphoadenylyl sulphate (PAPS) reductase
species: Escherichia coli [TaxId: 562]

Probab=100.00  E-value=1.9e-34  Score=225.82  Aligned_cols=139  Identities=21%  Similarity=0.243  Sum_probs=120.8

Q ss_pred             HHHHHHHHHHHhcCCCceEEEecCchhHHHHHHHHHHHhhhhcCCCCCCCCCCCCCceEEEecCCCCchHHHHHHHHHhh
Q 030189           21 NAINVIQRTLALYSIEEVAFSFNGGKDSTVLLHLLRAGYFLHKGEQSCSNGSLTFPIRTIYFESNSAFPEINSFTYDTAS  100 (181)
Q Consensus        21 ~a~~~i~~~~~~~~~~~i~va~SGGKDS~vll~L~~~~~~~~~~~~~~~~~~~~~~~~~v~idtg~~fpe~~~f~~~~~~  100 (181)
                      ++.++|+++++.|+ ++++|++||||||+|+|||++++.               .++++||+|||.+||||++|++++++
T Consensus        31 ~~~~~i~~~~~~~~-~~v~vs~SgGkDS~vllhl~~~~~---------------~~~~vvf~DTg~~fpeT~e~~~~~~~   94 (215)
T d1sura_          31 DAEGRVAWALDNLP-GEYVLSSSFGIQAAVSLHLVNQIR---------------PDIPVILTDTGYLFPETYRFIDELTD   94 (215)
T ss_dssp             CHHHHHHHHHHHCC-SEEEEECCCCTTHHHHHHHHHHHS---------------TTCEEEEEECSCBCHHHHHHHHHHHH
T ss_pred             CHHHHHHHHHHHCC-CCEEEEecCChHHHHHHHHHHhcC---------------CCccEEEEECCcCcHHHHHHHHHHHH
Confidence            68889999999996 789999999999999999999884               47999999999999999999999999


Q ss_pred             hcCceEEEEcccH----------------------------HHHHHHHHHhCCCcEEEEeeeCCCcccc-CCcccCCCCC
Q 030189          101 KYVLQLDIIRSDF----------------------------KSGLEALLNAKPIRAIFLGVRIGDPTAV-GQEQFSPSSP  151 (181)
Q Consensus       101 ~~~l~~~~~~~~~----------------------------k~~l~~~~~~~~~~~~i~G~R~~es~~~-~~~~~~~~~~  151 (181)
                      +||++++++.|+.                            .+|+++++++.+.++|++|+|++||..| .+..++..  
T Consensus        95 ~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~c~~~K~~P~~~~l~~~~~~~~i~G~Rr~Es~~Ra~~~~~~~~--  172 (215)
T d1sura_          95 KLKLNLKVYRATESAAWQEARYGKLWEQGVEGIEKYNDINKVEPMNRALKELNAQTWFAGLRREQSGSRANLPVLAIQ--  172 (215)
T ss_dssp             HTTCEEEEEECSSCHHHHHHHHCCGGGSHHHHHHHHHHHHTHHHHHHHHHHTTEEEEECCCCTTSSSTTTTCCSEEEE--
T ss_pred             hcCceeeEEeccchHHHHHhhcCCcccCCcchhhhhhcchhccchhhhhhccCceehHHHHhhcchHhHhcCCceeec--
Confidence            9999999987630                            0378888888888899999999997654 44444432  


Q ss_pred             CCCCeeEEecccCCchHHHHHHHhcccc
Q 030189          152 GWPPFMRVNPILDWSYRLLINNKLFGFI  179 (181)
Q Consensus       152 ~~~~~~~i~Pi~~Wt~~dVw~yi~~~~~  179 (181)
                        .+.++++||++||+.|||+||..|++
T Consensus       173 --~~~~kv~Pi~~Wt~~dVw~Yi~~~~l  198 (215)
T d1sura_         173 --RGVFKVLPIIDWDNRTIYQYLQKHGL  198 (215)
T ss_dssp             --TTEEEECTTTTCCHHHHHHHHHHHTC
T ss_pred             --CCEEEEechHhCCHHHHHHHHHHcCC
Confidence              26889999999999999999999987
>d1zuna1 c.26.2.2 (A:1-211) Sulfate adenylyltransferase subunit 2, CysD {Pseudomonas syringae pv. tomato [TaxId: 323]} Back     information, alignment and structure
>d1wy5a1 c.26.2.5 (A:1-216) TilS-like protein Aq_1887 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1ni5a1 c.26.2.5 (A:0-226) tRNA-Ile-lysidine synthetase, TilS, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2c5sa1 c.26.2.6 (A:174-391) Thiamine biosynthesis protein ThiI, C-terminal domain {Bacillus anthracis [TaxId: 1392]} Back     information, alignment and structure
>d1k92a1 c.26.2.1 (A:1-188) Argininosuccinate synthetase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j20a1 c.26.2.1 (A:1-165) Argininosuccinate synthetase, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xnga1 c.26.2.1 (A:3-257) NH3-dependent NAD+-synthetase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1vl2a1 c.26.2.1 (A:2-169) Argininosuccinate synthetase, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1gpma1 c.26.2.1 (A:208-404) GMP synthetase, central domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pg3a1 c.26.2.1 (A:1-230) Queuosine biosynthesis protein QueC {Erwinia carotovora [TaxId: 554]} Back     information, alignment and structure
>d2d13a1 c.26.2.1 (A:2-227) Hypothetical protein PH1257 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1wxia1 c.26.2.1 (A:2-275) NH3-dependent NAD+-synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kqpa_ c.26.2.1 (A:) NH3-dependent NAD+-synthetase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1jgta1 c.26.2.1 (A:210-508) beta-Lactam synthetase {Streptomyces clavuligerus [TaxId: 1901]} Back     information, alignment and structure
>d1q15a1 c.26.2.1 (A:206-501) beta-Lactam synthetase {Pectobacterium carotovorum [TaxId: 554]} Back     information, alignment and structure
>d1vbka1 c.26.2.6 (A:176-307) Hypothetical protein PH1313, C-terminal domain {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1ct9a1 c.26.2.1 (A:193-516) Asparagine synthetase B, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jmva_ c.26.2.4 (A:) Universal stress protein A, UspA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2z3va1 c.26.2.4 (A:2-136) Hypothetical protein TTHA0895 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1q77a_ c.26.2.4 (A:) Hypothetical protein Aq_178 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure