Citrus Sinensis ID: 030216

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-
MEAESERKVQPSYYSVLGVSVHSSVEEIRRAYRKLAMQWHPDRWTKTPSLLGKAKVKFQEIQEAYSVLSDERKRTLYDAGLYDPEEEEEEGFSDFVQEMLSLMAEARKEEKSYSMEELQTMFMEMAQEFEQSSWFCGYPVADDSCSLESTQWNTNLIDNNRNAQFGAFPGWQFYGASGFCR
ccHHHHHccccccEEEccccccccHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHcccHHHHHHHHcccccccccccccccHHHHHHHHHHHcccccccccccHHHHcHHHEEEEEcccccccccccEEcccccccccccccccccccccccccccccccccccccccc
ccccccccHcccHHHHHcccccccHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHccHHHHHHHHHccccccccccccccccHHHHHHHccccccccccccHHHHHHHHHHHHHHccccHccccccEccccccccccccccEEEccccccccccccccEEEEEEcccc
meaeserkvqpsyYSVLGVSVHSSVEEIRRAYRKLAMqwhpdrwtktpsllgKAKVKFQEIQEAYSVLSDERKrtlydaglydpeeeeeegFSDFVQEMLSLMAEARKEEKSYSMEELQTMFMEMAQEFEQsswfcgypvaddscslestqwntnlidnnrnaqfgafpgwqfygasgfcr
meaeserkvqpsyysvlgvsvhssVEEIRRAYRKLAmqwhpdrwtktpsllGKAKVKFQEIQEAysvlsderkrTLYDAGLYDPEEEEEEGFSDFVQEMLSLMAEARKEEKSYSMEELQTMFMEMAQEFEQSSWFCGYPVADDSCSLESTQWNTNLIDNNRNAQFGAFPGWQFYGASGFCR
MEAESERKVQPSYYSVLGVSVHSSVEEIRRAYRKLAMQWHPDRWTKTPSLLGKAKVKFQEIQEAYSVLSDERKRTLYDAGLYDPeeeeeeGFSDFVQEMLSLMAEARKEEKSYSMEELQTMFMEMAQEFEQSSWFCGYPVADDSCSLESTQWNTNLIDNNRNAQFGAFPGWQFYGASGFCR
************YYSVLGVSVHSSVEEIRRAYRKLAMQWHPDRWTKTPSLLGKAKVKFQEIQEAYSVLS*****TLY************************************************AQEFEQSSWFCGYPVADDSCSLESTQWNTNLIDNNRNAQFGAFPGWQFYGASGF**
*************YSVLGVSVHSSVEEIRRAYRKLAMQWHPDRWTKTP***GKAKVKFQEIQEAYSVLSDERKRTLYDAGLYDPEEEEEEGFSDFVQEM***********************MEMAQEFEQSSWFCGYPVADD**************************GWQFYGASGFC*
**********PSYYSVLGVSVHSSVEEIRRAYRKLAMQWHPDRWTKTPSLLGKAKVKFQEIQEAYSVLSDERKRTLYDAGLYDP********SDFVQEMLSLMAEARKEEKSYSMEELQTMFMEMAQEFEQSSWFCGYPVADDSCSLESTQWNTNLIDNNRNAQFGAFPGWQFYGASGFCR
**********PSYYSVLGVSVHSSVEEIRRAYRKLAMQWHPDRWTKTPSLLGKAKVKFQEIQEAYSVLSDERKRTLYDAGLYDPEEEEEEGFSDFVQEMLSLMAEARKEEKSYSMEELQTMFMEMAQEFEQSSWFCGYPVADDSCSLESTQWNTNLIDNNRNAQFGAFPGWQFYGASGFCR
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEAESERKVQPSYYSVLGVSVHSSVEEIRRAYRKLAMQWHPDRWTKTPSLLGKAKVKFQEIQEAYSVLSDERKRTLYDAGLYDPEEEEEEGFSDFVQEMLSLMAEARKEEKSYSMEELQTMFMEMAQEFEQSSWFCGYPVADDSCSLESTQWNTNLIDNNRNAQFGAFPGWQFYGASGFCR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query181 2.2.26 [Sep-21-2011]
Q72GN6 350 Chaperone protein DnaJ OS yes no 0.795 0.411 0.335 5e-15
Q5SLW9 350 Chaperone protein DnaJ 1 yes no 0.795 0.411 0.335 5e-15
Q0III6242 DnaJ homolog subfamily B yes no 0.348 0.260 0.545 3e-14
O75190 326 DnaJ homolog subfamily B yes no 0.348 0.193 0.545 3e-14
Q5R8H0 326 DnaJ homolog subfamily B yes no 0.348 0.193 0.545 4e-14
Q4R7Y5241 DnaJ homolog subfamily B N/A no 0.348 0.261 0.545 4e-14
A6Q486 373 Chaperone protein DnaJ OS yes no 0.441 0.214 0.489 5e-14
Q5F3Z5 326 DnaJ homolog subfamily B yes no 0.348 0.193 0.530 8e-14
Q6P642242 DnaJ homolog subfamily B yes no 0.348 0.260 0.530 1e-13
P47265 389 Chaperone protein DnaJ OS yes no 0.364 0.169 0.537 1e-13
>sp|Q72GN6|DNAJ_THET2 Chaperone protein DnaJ OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=dnaJ PE=3 SV=1 Back     alignment and function desciption
 Score = 80.5 bits (197), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 56/167 (33%), Positives = 87/167 (52%), Gaps = 23/167 (13%)

Query: 13  YYSVLGVSVHSSVEEIRRAYRKLAMQWHPDRWTKTPSLLGKAKVKFQEIQEAYSVLSDER 72
           YY++LGVS  +S EEI++AYR+LA+++HPDR         +A+ +F+EI EAY+VLSD +
Sbjct: 4   YYAILGVSREASQEEIKKAYRRLALKYHPDRNPGD----KEAEERFKEINEAYAVLSDPK 59

Query: 73  KRTLYDAG-LYDPEEEEEEGFSDFVQEMLSLMAEARKEEKSYSME-----ELQTMFMEMA 126
           KR  YD G L  PE   E+ F  F QE+  +    R+  +   +E     ELQ +     
Sbjct: 60  KRAAYDRGHLEAPEYRPEDLFDLFFQEVFGVRGH-RRPPRGEDLEAEVEVELQDLLHGAE 118

Query: 127 QEFEQSSWFCGYPVADDSCSLES-------TQWNTNLIDNNRNAQFG 166
           +E   +       V  ++C  E        T     ++++ R + FG
Sbjct: 119 KEVRYTRL-----VPCEACGGEGGRRTPCPTCRGQGVVESYRQSFFG 160
Participates actively in the response to hyperosmotic and heat shock by preventing the aggregation of stress-denatured proteins and by disaggregating proteins, also in an autonomous, DnaK-independent fashion. Unfolded proteins bind initially to DnaJ; upon interaction with the DnaJ-bound protein, DnaK hydrolyzes its bound ATP, resulting in the formation of a stable complex. GrpE releases ADP from DnaK; ATP binding to DnaK triggers the release of the substrate protein, thus completing the reaction cycle. Several rounds of ATP-dependent interactions between DnaJ, DnaK and GrpE are required for fully efficient folding. Also involved, together with DnaK and GrpE, in the DNA replication of plasmids through activation of initiation proteins.
Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) (taxid: 262724)
>sp|Q5SLW9|DNAJ1_THET8 Chaperone protein DnaJ 1 OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=dnaJ1 PE=3 SV=1 Back     alignment and function description
>sp|Q0III6|DNJB6_BOVIN DnaJ homolog subfamily B member 6 OS=Bos taurus GN=DNAJB6 PE=2 SV=1 Back     alignment and function description
>sp|O75190|DNJB6_HUMAN DnaJ homolog subfamily B member 6 OS=Homo sapiens GN=DNAJB6 PE=1 SV=2 Back     alignment and function description
>sp|Q5R8H0|DNJB6_PONAB DnaJ homolog subfamily B member 6 OS=Pongo abelii GN=DNAJB6 PE=2 SV=1 Back     alignment and function description
>sp|Q4R7Y5|DNJB6_MACFA DnaJ homolog subfamily B member 6 OS=Macaca fascicularis GN=DNAJB6 PE=2 SV=1 Back     alignment and function description
>sp|A6Q486|DNAJ_NITSB Chaperone protein DnaJ OS=Nitratiruptor sp. (strain SB155-2) GN=dnaJ PE=3 SV=1 Back     alignment and function description
>sp|Q5F3Z5|DNJB6_CHICK DnaJ homolog subfamily B member 6 OS=Gallus gallus GN=DNAJB6 PE=2 SV=1 Back     alignment and function description
>sp|Q6P642|DNJB6_XENTR DnaJ homolog subfamily B member 6 OS=Xenopus tropicalis GN=dnajb6 PE=2 SV=1 Back     alignment and function description
>sp|P47265|DNAJ_MYCGE Chaperone protein DnaJ OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=dnaJ PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query181
388494500182 unknown [Lotus japonicus] 0.988 0.983 0.598 9e-55
297737710196 unnamed protein product [Vitis vinifera] 0.828 0.765 0.649 3e-54
225424202168 PREDICTED: chaperone protein DnaJ [Vitis 0.801 0.863 0.668 6e-54
224111516175 predicted protein [Populus trichocarpa] 0.911 0.942 0.602 4e-53
351721249174 uncharacterized protein LOC100306079 [Gl 0.817 0.850 0.657 7e-51
255570100190 heat shock protein binding protein, puta 0.668 0.636 0.727 1e-45
147861979170 hypothetical protein VITISV_039821 [Viti 0.530 0.564 0.737 4e-37
240254348165 chaperone DnaJ-domain containing protein 0.707 0.775 0.607 7e-37
388497224161 unknown [Lotus japonicus] 0.613 0.689 0.601 4e-34
255633060163 unknown [Glycine max] 0.696 0.773 0.546 1e-33
>gi|388494500|gb|AFK35316.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
 Score =  218 bits (555), Expect = 9e-55,   Method: Compositional matrix adjust.
 Identities = 109/182 (59%), Positives = 137/182 (75%), Gaps = 3/182 (1%)

Query: 1   MEAESERKVQPSYYSVLGVSVHSSVEEIRRAYRKLAMQWHPDRWTKTPSLLGKAKVKFQE 60
           M+A  E  +  SYY++LGVS+ SSV+EIRRAYRKLAMQWHPDRWT+TPSLLG+AK KFQ+
Sbjct: 1   MDACKEEGLSSSYYTILGVSLDSSVDEIRRAYRKLAMQWHPDRWTRTPSLLGEAKRKFQQ 60

Query: 61  IQEAYSVLSDERKRTLYDAGLYDPEEEEEEGFSDFVQEMLSLMAEARKEEKSYSMEELQT 120
           IQEAY+VLSD +KRT+YDAGLYDP+EEE+EGFSDFV+EM SLMA+ RKE K Y +EELQ+
Sbjct: 61  IQEAYAVLSDPKKRTMYDAGLYDPQEEEDEGFSDFVEEMASLMAQVRKEGKDYGLEELQS 120

Query: 121 MFMEMAQEFEQSSWF-CGYP-VADDSCSLESTQWNTNLIDNNRNAQFGAFPGWQFYGASG 178
           M MEM +EFE  S + C  P V D+S   +  ++  +    N+ + F   PG  FY   G
Sbjct: 121 MLMEMVEEFESPSMYSCEVPSVIDESQCSKRMRFEFDTTMENKGSHF-QVPGLNFYETRG 179

Query: 179 FC 180
           +C
Sbjct: 180 YC 181

Source: Lotus japonicus

Species: Lotus japonicus

Genus: Lotus

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|297737710|emb|CBI26911.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225424202|ref|XP_002280578.1| PREDICTED: chaperone protein DnaJ [Vitis vinifera] Back     alignment and taxonomy information
>gi|224111516|ref|XP_002315886.1| predicted protein [Populus trichocarpa] gi|222864926|gb|EEF02057.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|351721249|ref|NP_001237203.1| uncharacterized protein LOC100306079 [Glycine max] gi|255627469|gb|ACU14079.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|255570100|ref|XP_002526012.1| heat shock protein binding protein, putative [Ricinus communis] gi|223534659|gb|EEF36352.1| heat shock protein binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|147861979|emb|CAN80913.1| hypothetical protein VITISV_039821 [Vitis vinifera] Back     alignment and taxonomy information
>gi|240254348|ref|NP_177256.4| chaperone DnaJ-domain containing protein [Arabidopsis thaliana] gi|332197028|gb|AEE35149.1| chaperone DnaJ-domain containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|388497224|gb|AFK36678.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|255633060|gb|ACU16885.1| unknown [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query181
TAIR|locus:2013940165 AT1G71000 [Arabidopsis thalian 0.707 0.775 0.592 8e-37
TAIR|locus:2011846156 AT1G56300 [Arabidopsis thalian 0.635 0.737 0.529 2.3e-30
TAIR|locus:2087492230 AT3G14200 "AT3G14200" [Arabido 0.872 0.686 0.374 1.3e-22
TAIR|locus:1009023133201 AT1G72416 [Arabidopsis thalian 0.618 0.557 0.4 6.5e-19
UNIPROTKB|Q0III6242 DNAJB6 "DnaJ homolog subfamily 0.348 0.260 0.545 4.2e-15
UNIPROTKB|C9J2C4228 DNAJB6 "DnaJ homolog subfamily 0.348 0.276 0.545 6.9e-15
UNIPROTKB|Q4R7Y5241 DNAJB6 "DnaJ homolog subfamily 0.348 0.261 0.545 6.9e-15
UNIPROTKB|Q5F3Z5 326 DNAJB6 "DnaJ homolog subfamily 0.348 0.193 0.530 1.4e-14
UNIPROTKB|O75190 326 DNAJB6 "DnaJ homolog subfamily 0.348 0.193 0.545 1.4e-14
UNIPROTKB|Q5R8H0 326 DNAJB6 "DnaJ homolog subfamily 0.348 0.193 0.545 1.4e-14
TAIR|locus:2013940 AT1G71000 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 396 (144.5 bits), Expect = 8.0e-37, P = 8.0e-37
 Identities = 77/130 (59%), Positives = 96/130 (73%)

Query:     6 ERKVQPSYYSVLGVSVHSSVEEIRRAYRKLAMQWHPDRWTKTPSLLGKAKVKFQEIQEAY 65
             E  ++ +YY +LGV+V SS E+IRRAY KLA  WHPDRWTK P   G+AK +FQ+IQEAY
Sbjct:     2 EGGIRQTYYEILGVAVDSSAEQIRRAYHKLAKIWHPDRWTKDPFRSGEAKRRFQQIQEAY 61

Query:    66 SVLSDERKRTLYDAGLYDPXXXXXXGFSDFVQEMLSLMAEARKEEKSYSMEELQTMFMEM 125
             SVLSDERKR+ YD GLYD       G+ DFVQEM+SLM++ ++EEK YS+EELQTM  +M
Sbjct:    62 SVLSDERKRSSYDVGLYD--SGEDEGYFDFVQEMVSLMSQTKREEKQYSLEELQTMVDDM 119

Query:   126 AQEFEQSSWF 135
               EF+    F
Sbjct:   120 VYEFQSEPLF 129
GO:0005737 "cytoplasm" evidence=ISM;IDA
GO:0006457 "protein folding" evidence=ISS;RCA
GO:0031072 "heat shock protein binding" evidence=IEA
GO:0005634 "nucleus" evidence=IDA
GO:0009408 "response to heat" evidence=RCA
GO:0009644 "response to high light intensity" evidence=RCA
GO:0042542 "response to hydrogen peroxide" evidence=RCA
TAIR|locus:2011846 AT1G56300 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2087492 AT3G14200 "AT3G14200" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:1009023133 AT1G72416 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q0III6 DNAJB6 "DnaJ homolog subfamily B member 6" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|C9J2C4 DNAJB6 "DnaJ homolog subfamily B member 6" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q4R7Y5 DNAJB6 "DnaJ homolog subfamily B member 6" [Macaca fascicularis (taxid:9541)] Back     alignment and assigned GO terms
UNIPROTKB|Q5F3Z5 DNAJB6 "DnaJ homolog subfamily B member 6" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|O75190 DNAJB6 "DnaJ homolog subfamily B member 6" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q5R8H0 DNAJB6 "DnaJ homolog subfamily B member 6" [Pongo abelii (taxid:9601)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00030478001
SubName- Full=Chromosome chr1 scaffold_5, whole genome shotgun sequence; (168 aa)
(Vitis vinifera)
Predicted Functional Partners:
GSVIVG00017724001
SubName- Full=Chromosome chr17 scaffold_16, whole genome shotgun sequence; (538 aa)
  •     0.500
GSVIVG00022731001
SubName- Full=Chromosome chr14 scaffold_27, whole genome shotgun sequence; (655 aa)
  •     0.498
GSVIVG00022013001
SubName- Full=Chromosome chr18 scaffold_24, whole genome shotgun sequence; (667 aa)
  •     0.498
GSVIVG00017185001
SubName- Full=Chromosome chr11 scaffold_14, whole genome shotgun sequence; (482 aa)
  •     0.498
GSVIVG00001482001
SubName- Full=Chromosome chr3 scaffold_117, whole genome shotgun sequence; (103 aa)
  •     0.498
GSVIVG00037232001
SubName- Full=Chromosome chr16 scaffold_86, whole genome shotgun sequence; (658 aa)
  •     0.497
GSVIVG00019978001
SubName- Full=Chromosome chr5 scaffold_2, whole genome shotgun sequence; (574 aa)
  •     0.497
GSVIVG00006687001
SubName- Full=Chromosome chr2 scaffold_176, whole genome shotgun sequence; (667 aa)
  •     0.497
GSVIVG00027610001
SubName- Full=Chromosome chr19 scaffold_4, whole genome shotgun sequence; (105 aa)
  •     0.494
GSVIVG00024357001
SubName- Full=Chromosome chr6 scaffold_3, whole genome shotgun sequence; (652 aa)
  •     0.494

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query181
COG0484 371 COG0484, DnaJ, DnaJ-class molecular chaperone with 6e-28
pfam0022663 pfam00226, DnaJ, DnaJ domain 7e-27
TIGR02349 354 TIGR02349, DnaJ_bact, chaperone protein DnaJ 1e-26
smart0027160 smart00271, DnaJ, DnaJ molecular chaperone homolog 2e-23
PRK10767 371 PRK10767, PRK10767, chaperone protein DnaJ; Provis 1e-22
cd0625755 cd06257, DnaJ, DnaJ domain or J-domain 3e-22
PRK14282 369 PRK14282, PRK14282, chaperone protein DnaJ; Provis 8e-21
PRK14298 377 PRK14298, PRK14298, chaperone protein DnaJ; Provis 1e-20
PRK14291 382 PRK14291, PRK14291, chaperone protein DnaJ; Provis 4e-20
PRK14280 376 PRK14280, PRK14280, chaperone protein DnaJ; Provis 2e-18
PRK14295 389 PRK14295, PRK14295, chaperone protein DnaJ; Provis 3e-18
PRK14276 380 PRK14276, PRK14276, chaperone protein DnaJ; Provis 4e-18
PRK14301 373 PRK14301, PRK14301, chaperone protein DnaJ; Provis 6e-18
PRK14284 391 PRK14284, PRK14284, chaperone protein DnaJ; Provis 1e-17
PRK14278 378 PRK14278, PRK14278, chaperone protein DnaJ; Provis 2e-17
COG2214237 COG2214, CbpA, DnaJ-class molecular chaperone [Pos 3e-17
PRK14281 397 PRK14281, PRK14281, chaperone protein DnaJ; Provis 3e-17
PRK14299 291 PRK14299, PRK14299, chaperone protein DnaJ; Provis 4e-17
PRK14294 366 PRK14294, PRK14294, chaperone protein DnaJ; Provis 8e-17
PRK14277 386 PRK14277, PRK14277, chaperone protein DnaJ; Provis 1e-16
PRK14279 392 PRK14279, PRK14279, chaperone protein DnaJ; Provis 2e-16
PRK14297 380 PRK14297, PRK14297, chaperone protein DnaJ; Provis 2e-16
PRK14289 386 PRK14289, PRK14289, chaperone protein DnaJ; Provis 2e-16
PRK14293 374 PRK14293, PRK14293, chaperone protein DnaJ; Provis 4e-16
PRK14290 365 PRK14290, PRK14290, chaperone protein DnaJ; Provis 7e-16
PRK14283 378 PRK14283, PRK14283, chaperone protein DnaJ; Provis 1e-15
PRK14292 371 PRK14292, PRK14292, chaperone protein DnaJ; Provis 1e-15
PRK14288 369 PRK14288, PRK14288, chaperone protein DnaJ; Provis 3e-15
PRK14296 372 PRK14296, PRK14296, chaperone protein DnaJ; Provis 9e-15
PRK14287 371 PRK14287, PRK14287, chaperone protein DnaJ; Provis 2e-14
PTZ00037 421 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Prov 2e-14
PRK14300 372 PRK14300, PRK14300, chaperone protein DnaJ; Provis 3e-13
PRK14286 372 PRK14286, PRK14286, chaperone protein DnaJ; Provis 5e-13
PRK14285 365 PRK14285, PRK14285, chaperone protein DnaJ; Provis 2e-12
PRK10266 306 PRK10266, PRK10266, curved DNA-binding protein Cbp 4e-12
TIGR03835 871 TIGR03835, termin_org_DnaJ, terminal organelle ass 2e-10
COG5407 610 COG5407, SEC63, Preprotein translocase subunit Sec 4e-09
PRK09430267 PRK09430, djlA, Dna-J like membrane chaperone prot 5e-09
PTZ00341 1136 PTZ00341, PTZ00341, Ring-infected erythrocyte surf 1e-06
COG1076174 COG1076, DjlA, DnaJ-domain-containing proteins 1 [ 2e-05
COG5269 379 COG5269, ZUO1, Ribosome-associated chaperone zuoti 0.002
>gnl|CDD|223560 COG0484, DnaJ, DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
 Score =  106 bits (268), Expect = 6e-28
 Identities = 39/84 (46%), Positives = 49/84 (58%), Gaps = 6/84 (7%)

Query: 12 SYYSVLGVSVHSSVEEIRRAYRKLAMQWHPDRWTKTPSLLGKAKVKFQEIQEAYSVLSDE 71
           YY +LGVS  +S EEI++AYRKLA ++HPDR          A+ KF+EI EAY VLSD 
Sbjct: 5  DYYEILGVSKDASEEEIKKAYRKLAKKYHPDRNPGDKE----AEEKFKEINEAYEVLSDP 60

Query: 72 RKRTLYDAGLYDPEEEEEEGFSDF 95
           KR  YD   +     +  GF  F
Sbjct: 61 EKRAAYD--QFGHAGFKAGGFGGF 82

Length = 371
>gnl|CDD|215804 pfam00226, DnaJ, DnaJ domain Back     alignment and domain information
>gnl|CDD|233829 TIGR02349, DnaJ_bact, chaperone protein DnaJ Back     alignment and domain information
>gnl|CDD|197617 smart00271, DnaJ, DnaJ molecular chaperone homology domain Back     alignment and domain information
>gnl|CDD|236757 PRK10767, PRK10767, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|99751 cd06257, DnaJ, DnaJ domain or J-domain Back     alignment and domain information
>gnl|CDD|184603 PRK14282, PRK14282, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184612 PRK14298, PRK14298, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237661 PRK14291, PRK14291, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237656 PRK14280, PRK14280, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237665 PRK14295, PRK14295, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237653 PRK14276, PRK14276, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237668 PRK14301, PRK14301, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237658 PRK14284, PRK14284, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237654 PRK14278, PRK14278, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|225124 COG2214, CbpA, DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|237657 PRK14281, PRK14281, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237667 PRK14299, PRK14299, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237664 PRK14294, PRK14294, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184599 PRK14277, PRK14277, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237655 PRK14279, PRK14279, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184611 PRK14297, PRK14297, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237660 PRK14289, PRK14289, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237663 PRK14293, PRK14293, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172778 PRK14290, PRK14290, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184604 PRK14283, PRK14283, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237662 PRK14292, PRK14292, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172776 PRK14288, PRK14288, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237666 PRK14296, PRK14296, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237659 PRK14287, PRK14287, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|240236 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>gnl|CDD|172788 PRK14300, PRK14300, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172774 PRK14286, PRK14286, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172773 PRK14285, PRK14285, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|182347 PRK10266, PRK10266, curved DNA-binding protein CbpA; Provisional Back     alignment and domain information
>gnl|CDD|234368 TIGR03835, termin_org_DnaJ, terminal organelle assembly protein TopJ Back     alignment and domain information
>gnl|CDD|227694 COG5407, SEC63, Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|236512 PRK09430, djlA, Dna-J like membrane chaperone protein; Provisional Back     alignment and domain information
>gnl|CDD|173534 PTZ00341, PTZ00341, Ring-infected erythrocyte surface antigen; Provisional Back     alignment and domain information
>gnl|CDD|224002 COG1076, DjlA, DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|227594 COG5269, ZUO1, Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 181
COG0484 371 DnaJ DnaJ-class molecular chaperone with C-termina 99.92
KOG0713 336 consensus Molecular chaperone (DnaJ superfamily) [ 99.88
KOG0717 508 consensus Molecular chaperone (DnaJ superfamily) [ 99.83
PRK14288 369 chaperone protein DnaJ; Provisional 99.83
PRK14296 372 chaperone protein DnaJ; Provisional 99.82
PRK14279 392 chaperone protein DnaJ; Provisional 99.81
PRK14287 371 chaperone protein DnaJ; Provisional 99.81
PF0022664 DnaJ: DnaJ domain; InterPro: IPR001623 The prokary 99.8
PRK14286 372 chaperone protein DnaJ; Provisional 99.8
PTZ00037 421 DnaJ_C chaperone protein; Provisional 99.79
KOG0719264 consensus Molecular chaperone (DnaJ superfamily) [ 99.79
KOG0712 337 consensus Molecular chaperone (DnaJ superfamily) [ 99.79
PRK14298 377 chaperone protein DnaJ; Provisional 99.79
PRK14282 369 chaperone protein DnaJ; Provisional 99.78
PRK14285 365 chaperone protein DnaJ; Provisional 99.78
PRK14295 389 chaperone protein DnaJ; Provisional 99.78
PRK10767 371 chaperone protein DnaJ; Provisional 99.78
PRK14277 386 chaperone protein DnaJ; Provisional 99.77
PRK14276 380 chaperone protein DnaJ; Provisional 99.77
PRK14283 378 chaperone protein DnaJ; Provisional 99.77
PRK14299 291 chaperone protein DnaJ; Provisional 99.77
PRK14297 380 chaperone protein DnaJ; Provisional 99.77
PRK14301 373 chaperone protein DnaJ; Provisional 99.77
PRK14291 382 chaperone protein DnaJ; Provisional 99.77
PRK14278 378 chaperone protein DnaJ; Provisional 99.77
PRK14294 366 chaperone protein DnaJ; Provisional 99.77
PRK14284 391 chaperone protein DnaJ; Provisional 99.76
PRK14280 376 chaperone protein DnaJ; Provisional 99.76
PRK01356166 hscB co-chaperone HscB; Provisional 99.76
PRK14281 397 chaperone protein DnaJ; Provisional 99.75
PRK03578176 hscB co-chaperone HscB; Provisional 99.75
KOG0716279 consensus Molecular chaperone (DnaJ superfamily) [ 99.75
KOG0691 296 consensus Molecular chaperone (DnaJ superfamily) [ 99.75
PRK05014171 hscB co-chaperone HscB; Provisional 99.75
KOG0718 546 consensus Molecular chaperone (DnaJ superfamily) [ 99.74
PRK00294173 hscB co-chaperone HscB; Provisional 99.74
KOG0715288 consensus Molecular chaperone (DnaJ superfamily) [ 99.74
PRK14290 365 chaperone protein DnaJ; Provisional 99.73
PRK14289 386 chaperone protein DnaJ; Provisional 99.73
PRK14300 372 chaperone protein DnaJ; Provisional 99.72
TIGR02349 354 DnaJ_bact chaperone protein DnaJ. This model repre 99.72
PRK10266 306 curved DNA-binding protein CbpA; Provisional 99.72
smart0027160 DnaJ DnaJ molecular chaperone homology domain. 99.72
PRK14292 371 chaperone protein DnaJ; Provisional 99.72
PRK14293 374 chaperone protein DnaJ; Provisional 99.71
PTZ00341 1136 Ring-infected erythrocyte surface antigen; Provisi 99.7
cd0625755 DnaJ DnaJ domain or J-domain. DnaJ/Hsp40 (heat sho 99.7
COG5269 379 ZUO1 Ribosome-associated chaperone zuotin [Transla 99.7
PHA03102153 Small T antigen; Reviewed 99.64
COG2214237 CbpA DnaJ-class molecular chaperone [Posttranslati 99.63
TIGR03835 871 termin_org_DnaJ terminal organelle assembly protei 99.63
PRK01773173 hscB co-chaperone HscB; Provisional 99.62
KOG0721230 consensus Molecular chaperone (DnaJ superfamily) [ 99.59
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.56
KOG0720490 consensus Molecular chaperone (DnaJ superfamily) [ 99.54
TIGR00714157 hscB Fe-S protein assembly co-chaperone HscB. This 99.51
PRK09430267 djlA Dna-J like membrane chaperone protein; Provis 99.45
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 99.44
PHA02624 647 large T antigen; Provisional 99.43
PTZ00100116 DnaJ chaperone protein; Provisional 99.4
KOG0722 329 consensus Molecular chaperone (DnaJ superfamily) [ 99.39
KOG0714 306 consensus Molecular chaperone (DnaJ superfamily) [ 99.36
COG5407 610 SEC63 Preprotein translocase subunit Sec63 [Intrac 99.28
KOG1150250 consensus Predicted molecular chaperone (DnaJ supe 99.07
KOG3192168 consensus Mitochondrial J-type chaperone [Posttran 98.68
KOG1789 2235 consensus Endocytosis protein RME-8, contains DnaJ 98.52
KOG0568 342 consensus Molecular chaperone (DnaJ superfamily) [ 98.47
KOG0723112 consensus Molecular chaperone (DnaJ superfamily) [ 98.3
COG1076174 DjlA DnaJ-domain-containing proteins 1 [Posttransl 97.43
COG1076174 DjlA DnaJ-domain-containing proteins 1 [Posttransl 97.43
KOG0431453 consensus Auxilin-like protein and related protein 97.32
PF03656127 Pam16: Pam16; InterPro: IPR005341 The Pam16 protei 95.32
PF14687112 DUF4460: Domain of unknown function (DUF4460) 93.87
PF1344662 RPT: A repeated domain in UCH-protein 89.39
KOG0724 335 consensus Zuotin and related molecular chaperones 88.0
>COG0484 DnaJ DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=99.92  E-value=1.9e-25  Score=193.14  Aligned_cols=89  Identities=43%  Similarity=0.634  Sum_probs=73.8

Q ss_pred             cccCcccccccCCCCCHHHHHHHHHHHHHHhCCCCCCCCcchhhHHHHHHHHHHHHHhhcCCchHHHHhhccCCCCCh-h
Q 030216            9 VQPSYYSVLGVSVHSSVEEIRRAYRKLAMQWHPDRWTKTPSLLGKAKVKFQEIQEAYSVLSDERKRTLYDAGLYDPEE-E   87 (181)
Q Consensus         9 ~~~d~Y~iLgv~~~as~~eIk~aYr~l~~~~HPDk~~~~~~~~~~a~~~f~~I~~AY~vLsdp~~R~~YD~~l~~~~~-~   87 (181)
                      ...|||+||||+++||.+|||+|||+||++||||+++.++    +|+++|++|++||+|||||++|++||+....... .
T Consensus         2 ~~~dyYeiLGV~k~As~~EIKkAYRkLA~kyHPD~n~g~~----~AeeKFKEI~eAYEVLsD~eKRa~YD~fG~~~~~~g   77 (371)
T COG0484           2 AKRDYYEILGVSKDASEEEIKKAYRKLAKKYHPDRNPGDK----EAEEKFKEINEAYEVLSDPEKRAAYDQFGHAGFKAG   77 (371)
T ss_pred             CccchhhhcCCCCCCCHHHHHHHHHHHHHHhCCCCCCCCH----HHHHHHHHHHHHHHHhCCHHHHHHhhccCccccccC
Confidence            4689999999999999999999999999999999998644    7999999999999999999999999985533322 0


Q ss_pred             h--------hh-hhHHHHHHHHH
Q 030216           88 E--------EE-GFSDFVQEMLS  101 (181)
Q Consensus        88 ~--------~~-~f~~~~~~~~~  101 (181)
                      .        .. +|.++|..+|.
T Consensus        78 g~gg~g~~~fgg~~~DIF~~~Fg  100 (371)
T COG0484          78 GFGGFGFGGFGGDFGDIFEDFFG  100 (371)
T ss_pred             CcCCCCcCCCCCCHHHHHHHhhc
Confidence            0        01 35677777774

>KOG0713 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0717 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14288 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14296 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14279 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14287 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PF00226 DnaJ: DnaJ domain; InterPro: IPR001623 The prokaryotic heat shock protein DnaJ interacts with the chaperone hsp70-like DnaK protein [] Back     alignment and domain information
>PRK14286 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PTZ00037 DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>KOG0719 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0712 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14298 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14282 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14285 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14295 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK10767 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14277 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14276 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14283 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14299 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14297 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14301 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14291 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14278 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14294 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14284 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14280 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK01356 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PRK14281 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK03578 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>KOG0716 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0691 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK05014 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>KOG0718 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK00294 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>KOG0715 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14290 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14289 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14300 chaperone protein DnaJ; Provisional Back     alignment and domain information
>TIGR02349 DnaJ_bact chaperone protein DnaJ Back     alignment and domain information
>PRK10266 curved DNA-binding protein CbpA; Provisional Back     alignment and domain information
>smart00271 DnaJ DnaJ molecular chaperone homology domain Back     alignment and domain information
>PRK14292 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14293 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PTZ00341 Ring-infected erythrocyte surface antigen; Provisional Back     alignment and domain information
>cd06257 DnaJ DnaJ domain or J-domain Back     alignment and domain information
>COG5269 ZUO1 Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA03102 Small T antigen; Reviewed Back     alignment and domain information
>COG2214 CbpA DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03835 termin_org_DnaJ terminal organelle assembly protein TopJ Back     alignment and domain information
>PRK01773 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>KOG0721 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG0720 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00714 hscB Fe-S protein assembly co-chaperone HscB Back     alignment and domain information
>PRK09430 djlA Dna-J like membrane chaperone protein; Provisional Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02624 large T antigen; Provisional Back     alignment and domain information
>PTZ00100 DnaJ chaperone protein; Provisional Back     alignment and domain information
>KOG0722 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0714 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5407 SEC63 Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1150 consensus Predicted molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3192 consensus Mitochondrial J-type chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1789 consensus Endocytosis protein RME-8, contains DnaJ domain [Intracellular trafficking, secretion, and vesicular transport; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0568 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0723 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0431 consensus Auxilin-like protein and related proteins containing DnaJ domain [General function prediction only] Back     alignment and domain information
>PF03656 Pam16: Pam16; InterPro: IPR005341 The Pam16 protein is the fifth essential subunit of the pre-sequence translocase-associated protein import motor (PAM) [] Back     alignment and domain information
>PF14687 DUF4460: Domain of unknown function (DUF4460) Back     alignment and domain information
>PF13446 RPT: A repeated domain in UCH-protein Back     alignment and domain information
>KOG0724 consensus Zuotin and related molecular chaperones (DnaJ superfamily), contains DNA-binding domains [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query181
2dmx_A92 Solution Structure Of The J Domain Of Dnaj Homolog 2e-14
2lo1_A71 Nmr Structure Of The Protein Bc008182, A Dnaj-Like 7e-13
1xbl_A107 Nmr Structure Of The J-Domain (Residues 2-76) In Th 8e-13
1bq0_A103 J-Domain (Residues 1-77) Of The Escherichia Coli N- 9e-13
1bqz_A77 J-Domain (Residues 1-77) Of The Escherichia Coli N- 1e-12
2ej7_A82 Solution Structure Of The Dnaj Domain Of The Human 2e-12
2lgw_A99 Solution Structure Of The J Domain Of Hsj1a Length 2e-12
1hdj_A77 Human Hsp40 (Hdj-1), Nmr Length = 77 3e-12
2och_A73 J-domain Of Dnj-12 From Caenorhabditis Elegans Leng 7e-12
2dn9_A79 Solution Structure Of J-Domain From The Dnaj Homolo 8e-12
2ctw_A109 Solution Structure Of J-Domain From Mouse Dnaj Subf 2e-11
2ctr_A88 Solution Structure Of J-Domain From Human Dnaj Subf 8e-11
2cug_A88 Solution Structure Of The J Domain Of The Pseudo Dn 2e-10
3apq_A210 Crystal Structure Of J-Trx1 Fragment Of Erdj5 Lengt 2e-09
2ctp_A78 Solution Structure Of J-Domain From Human Dnaj Subf 2e-09
2o37_A92 J-Domain Of Sis1 Protein, Hsp40 Co-Chaperone From S 3e-09
3apo_A 780 Crystal Structure Of Full-Length Erdj5 Length = 780 3e-09
2kqx_A73 Nmr Structure Of The J-Domain (Residues 2-72) In Th 1e-08
2y4u_A450 Crystal Structure Of Human P58(Ipk) In Space Group 2e-08
2y4t_A450 Crystal Structure Of The Human Co-Chaperone P58(Ipk 3e-08
3lz8_A 329 Structure Of A Putative Chaperone Dnaj From Klebsie 4e-08
2ctq_A112 Solution Structure Of J-Domain From Human Dnaj Subf 1e-06
2l6l_A155 Solution Structure Of Human J-Protein Co-Chaperone, 2e-05
1wjz_A94 Soluiotn Structure Of J-Domain Of Mouse Dnaj Like P 3e-05
2yua_A99 Solution Structure Of The Dnaj Domain From Human Wi 4e-04
>pdb|2DMX|A Chain A, Solution Structure Of The J Domain Of Dnaj Homolog Subfamily B Member 8 Length = 92 Back     alignment and structure 
Iteration: 1

 Score = 75.1 bits (183), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 36/67 (53%), Positives = 49/67 (73%), Gaps = 3/67 (4%)
Query: 12 SYYSVLGVSVHSSVEEIRRAYRKLAMQWHPDRWTKTPSLLGKAKVKFQEIQEAYSVLSDE 71
          +YY VLGV   +S E+I++AYRKLA++WHPD   K P    +A+ KF+ + EAY VLSD 
Sbjct: 10 NYYEVLGVQASASPEDIKKAYRKLALRWHPD---KNPDNKEEAEKKFKLVSEAYEVLSDS 66
Query: 72 RKRTLYD 78
          +KR+LYD
Sbjct: 67 KKRSLYD 73
>pdb|2LO1|A Chain A, Nmr Structure Of The Protein Bc008182, A Dnaj-Like Domain From Homo Sapiens Length = 71 Back     alignment and structure
>pdb|1XBL|A Chain A, Nmr Structure Of The J-Domain (Residues 2-76) In The Escherichia Coli N-Terminal Fragment (Residues 2-108) Of The Molecular Chaperone Dnaj, 20 Structures Length = 107 Back     alignment and structure
>pdb|1BQ0|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-104) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 103 Back     alignment and structure
>pdb|1BQZ|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-78) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 77 Back     alignment and structure
>pdb|2EJ7|A Chain A, Solution Structure Of The Dnaj Domain Of The Human Protein Hcg3, A Hypothetical Protein Tmp_locus_21 Length = 82 Back     alignment and structure
>pdb|2LGW|A Chain A, Solution Structure Of The J Domain Of Hsj1a Length = 99 Back     alignment and structure
>pdb|1HDJ|A Chain A, Human Hsp40 (Hdj-1), Nmr Length = 77 Back     alignment and structure
>pdb|2OCH|A Chain A, J-domain Of Dnj-12 From Caenorhabditis Elegans Length = 73 Back     alignment and structure
>pdb|2DN9|A Chain A, Solution Structure Of J-Domain From The Dnaj Homolog, Human Tid1 Protein Length = 79 Back     alignment and structure
>pdb|2CTW|A Chain A, Solution Structure Of J-Domain From Mouse Dnaj Subfamily C Menber 5 Length = 109 Back     alignment and structure
>pdb|2CTR|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 9 Length = 88 Back     alignment and structure
>pdb|2CUG|A Chain A, Solution Structure Of The J Domain Of The Pseudo Dnaj Protein, Mouse Hypothetical Mkiaa0962 Length = 88 Back     alignment and structure
>pdb|3APQ|A Chain A, Crystal Structure Of J-Trx1 Fragment Of Erdj5 Length = 210 Back     alignment and structure
>pdb|2CTP|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 12 Length = 78 Back     alignment and structure
>pdb|2O37|A Chain A, J-Domain Of Sis1 Protein, Hsp40 Co-Chaperone From Saccharomyces Cerevisiae Length = 92 Back     alignment and structure
>pdb|3APO|A Chain A, Crystal Structure Of Full-Length Erdj5 Length = 780 Back     alignment and structure
>pdb|2KQX|A Chain A, Nmr Structure Of The J-Domain (Residues 2-72) In The Escherichia Coli Cbpa Length = 73 Back     alignment and structure
>pdb|2Y4U|A Chain A, Crystal Structure Of Human P58(Ipk) In Space Group P312 Length = 450 Back     alignment and structure
>pdb|2Y4T|A Chain A, Crystal Structure Of The Human Co-Chaperone P58(Ipk) Length = 450 Back     alignment and structure
>pdb|3LZ8|A Chain A, Structure Of A Putative Chaperone Dnaj From Klebsiella Pneumoniae Subsp. Pneumoniae Mgh 78578 At 2.9 A Resolution. Length = 329 Back     alignment and structure
>pdb|2CTQ|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily C Menber 12 Length = 112 Back     alignment and structure
>pdb|2L6L|A Chain A, Solution Structure Of Human J-Protein Co-Chaperone, Dph4 Length = 155 Back     alignment and structure
>pdb|1WJZ|A Chain A, Soluiotn Structure Of J-Domain Of Mouse Dnaj Like Protein Length = 94 Back     alignment and structure
>pdb|2YUA|A Chain A, Solution Structure Of The Dnaj Domain From Human Williams- Beuren Syndrome Chromosome Region 18 Protein Length = 99 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query181
2ctw_A109 DNAJ homolog subfamily C member 5; J-domain, chape 6e-27
3lz8_A 329 Putative chaperone DNAJ; structure genomics, struc 2e-26
2l6l_A155 DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, 3e-26
2ej7_A82 HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati 3e-26
2dmx_A92 DNAJ homolog subfamily B member 8; DNAJ J domain, 5e-26
2lgw_A99 DNAJ homolog subfamily B member 2; J domain, HSJ1A 6e-26
1hdj_A77 Human HSP40, HDJ-1; molecular chaperone; NMR {Homo 2e-25
2qsa_A109 DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s 7e-25
2ctq_A112 DNAJ homolog subfamily C member 12; J-domain, chap 8e-25
2yua_A99 Williams-beuren syndrome chromosome region 18 prot 1e-24
2cug_A88 Mkiaa0962 protein; DNAJ-like domain, structural ge 3e-24
3apq_A210 DNAJ homolog subfamily C member 10; thioredoxin fo 3e-24
1wjz_A94 1700030A21RIK protein; J-domain, DNAJ like protein 3e-24
2dn9_A79 DNAJ homolog subfamily A member 3; J-domain, TID1, 1e-23
2ctp_A78 DNAJ homolog subfamily B member 12; J-domain, chap 1e-23
2och_A73 Hypothetical protein DNJ-12; HSP40, J-domain, chap 1e-23
2o37_A92 Protein SIS1; HSP40, J-domain, cochaperone, APC900 2e-23
2ctr_A88 DNAJ homolog subfamily B member 9; J-domain, chape 3e-23
1bq0_A103 DNAJ, HSP40; chaperone, heat shock, protein foldin 3e-23
2ys8_A90 RAB-related GTP-binding protein RABJ; DNAJ domain, 5e-21
2pf4_E174 Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, 8e-21
1iur_A88 KIAA0730 protein; DNAJ like domain, riken structur 5e-20
1gh6_A114 Large T antigen; tumor suppressor, oncoprotein, an 1e-19
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 1e-19
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 2e-19
3hho_A174 CO-chaperone protein HSCB homolog; structural geno 7e-17
1fpo_A171 HSC20, chaperone protein HSCB; molecular chaperone 2e-16
1faf_A79 Large T antigen; J domain, HPD motif, anti-paralle 2e-14
3uo3_A181 J-type CO-chaperone JAC1, mitochondrial; structura 3e-14
3bvo_A207 CO-chaperone protein HSCB, mitochondrial precurso; 4e-13
1n4c_A182 Auxilin; four helix bundle, protein binding; NMR { 2e-12
2guz_A71 Mitochondrial import inner membrane translocase su 1e-09
2qwo_B92 Putative tyrosine-protein phosphatase auxilin; cha 2e-08
3ag7_A106 Putative uncharacterized protein F9E10.5; J-domain 2e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-04
>2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Length = 109 Back     alignment and structure
 Score = 97.5 bits (243), Expect = 6e-27
 Identities = 33/88 (37%), Positives = 56/88 (63%), Gaps = 8/88 (9%)

Query: 12  SYYSVLGVSVHSSVEEIRRAYRKLAMQWHPDRWTKTPSLLGKAKVKFQEIQEAYSVLSDE 71
           S Y VLG+  +++ ++I+++YRKLA+++HPD+    P    +A  KF+EI  A+++L+D 
Sbjct: 18  SLYHVLGLDKNATSDDIKKSYRKLALKYHPDKNPDNP----EAADKFKEINNAHAILTDA 73

Query: 72  RKRTLYD----AGLYDPEEEEEEGFSDF 95
            KR +YD     GLY  E+  EE  + +
Sbjct: 74  TKRNIYDKYGSLGLYVAEQFGEENVNTY 101
>3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Length = 329 Back     alignment and structure
>2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 82 Back     alignment and structure
>2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 77 Back     alignment and structure
>2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Length = 109 Back     alignment and structure
>2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 112 Back     alignment and structure
>2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Length = 88 Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Length = 210 Back     alignment and structure
>1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Length = 94 Back     alignment and structure
>2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Length = 73 Back     alignment and structure
>2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Length = 92 Back     alignment and structure
>2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Length = 103 Back     alignment and structure
>2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Length = 174 Back     alignment and structure
>1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 88 Back     alignment and structure
>1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Length = 114 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Length = 780 Back     alignment and structure
>1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Length = 171 Back     alignment and structure
>1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Length = 79 Back     alignment and structure
>3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A Length = 181 Back     alignment and structure
>3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} Length = 207 Back     alignment and structure
>1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Length = 182 Back     alignment and structure
>2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Length = 71 Back     alignment and structure
>2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Length = 92 Back     alignment and structure
>3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} Length = 106 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query181
2dn9_A79 DNAJ homolog subfamily A member 3; J-domain, TID1, 99.86
2yua_A99 Williams-beuren syndrome chromosome region 18 prot 99.86
1wjz_A94 1700030A21RIK protein; J-domain, DNAJ like protein 99.86
2ej7_A82 HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati 99.85
2ctp_A78 DNAJ homolog subfamily B member 12; J-domain, chap 99.85
1hdj_A77 Human HSP40, HDJ-1; molecular chaperone; NMR {Homo 99.85
1bq0_A103 DNAJ, HSP40; chaperone, heat shock, protein foldin 99.85
2cug_A88 Mkiaa0962 protein; DNAJ-like domain, structural ge 99.84
2ctr_A88 DNAJ homolog subfamily B member 9; J-domain, chape 99.84
3hho_A174 CO-chaperone protein HSCB homolog; structural geno 99.84
2qsa_A109 DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s 99.84
2och_A73 Hypothetical protein DNJ-12; HSP40, J-domain, chap 99.84
2ctq_A112 DNAJ homolog subfamily C member 12; J-domain, chap 99.83
3bvo_A207 CO-chaperone protein HSCB, mitochondrial precurso; 99.83
2dmx_A92 DNAJ homolog subfamily B member 8; DNAJ J domain, 99.83
2ctw_A109 DNAJ homolog subfamily C member 5; J-domain, chape 99.83
1fpo_A171 HSC20, chaperone protein HSCB; molecular chaperone 99.83
2lgw_A99 DNAJ homolog subfamily B member 2; J domain, HSJ1A 99.82
2o37_A92 Protein SIS1; HSP40, J-domain, cochaperone, APC900 99.82
2l6l_A155 DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, 99.81
2ys8_A90 RAB-related GTP-binding protein RABJ; DNAJ domain, 99.79
3uo3_A181 J-type CO-chaperone JAC1, mitochondrial; structura 99.78
3apq_A210 DNAJ homolog subfamily C member 10; thioredoxin fo 99.77
1faf_A79 Large T antigen; J domain, HPD motif, anti-paralle 99.75
1iur_A88 KIAA0730 protein; DNAJ like domain, riken structur 99.72
2pf4_E174 Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, 99.72
1n4c_A182 Auxilin; four helix bundle, protein binding; NMR { 99.72
1gh6_A114 Large T antigen; tumor suppressor, oncoprotein, an 99.71
3lz8_A 329 Putative chaperone DNAJ; structure genomics, struc 99.71
3ag7_A106 Putative uncharacterized protein F9E10.5; J-domain 99.71
2qwo_B92 Putative tyrosine-protein phosphatase auxilin; cha 99.68
2guz_A71 Mitochondrial import inner membrane translocase su 99.65
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 99.58
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.2
2guz_B65 Mitochondrial import inner membrane translocase su 98.96
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 90.97
>2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
Probab=99.86  E-value=4e-22  Score=136.98  Aligned_cols=72  Identities=47%  Similarity=0.699  Sum_probs=65.5

Q ss_pred             cCcccCcccccccCCCCCHHHHHHHHHHHHHHhCCCCCCCCcchhhHHHHHHHHHHHHHhhcCCchHHHHhhccCC
Q 030216            7 RKVQPSYYSVLGVSVHSSVEEIRRAYRKLAMQWHPDRWTKTPSLLGKAKVKFQEIQEAYSVLSDERKRTLYDAGLY   82 (181)
Q Consensus         7 ~~~~~d~Y~iLgv~~~as~~eIk~aYr~l~~~~HPDk~~~~~~~~~~a~~~f~~I~~AY~vLsdp~~R~~YD~~l~   82 (181)
                      .....|||+||||+++++.++||++||+|++++|||+++..+    .+.+.|++|++||++|+||.+|..||..+.
T Consensus         3 ~~~~~~~y~iLgv~~~a~~~~Ik~ayr~l~~~~HPD~~~~~~----~a~~~f~~i~~Ay~~L~d~~~R~~YD~~g~   74 (79)
T 2dn9_A            3 SGSSGDYYQILGVPRNASQKEIKKAYYQLAKKYHPDTNKDDP----KAKEKFSQLAEAYEVLSDEVKRKQYDAYGS   74 (79)
T ss_dssp             SSCCSCHHHHHTCCTTCCHHHHHHHHHHHHHHTCTTTCSSCT----THHHHHHHHHHHHHHHHSHHHHHHHHHSCC
T ss_pred             CCCCCCHHHHcCCCCCCCHHHHHHHHHHHHHHHCcCCCCCCH----HHHHHHHHHHHHHHHHCCHHHHHHHHhccC
Confidence            356789999999999999999999999999999999997543    578999999999999999999999998653
>2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Back     alignment and structure
>2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Back     alignment and structure
>1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Back     alignment and structure
>2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Back     alignment and structure
>2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Back     alignment and structure
>2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} Back     alignment and structure
>2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Back     alignment and structure
>2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Back     alignment and structure
>2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Back     alignment and structure
>1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Back     alignment and structure
>1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Back     alignment and structure
>2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Back     alignment and structure
>1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Back     alignment and structure
>1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Back     alignment and structure
>3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Back     alignment and structure
>3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Back     alignment and structure
>2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2guz_B Mitochondrial import inner membrane translocase subunit TIM16; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 181
d1wjza_94 a.2.3.1 (A:) CSL-type zinc finger-containing prote 2e-16
d1fafa_79 a.2.3.1 (A:) Large T antigen, the N-terminal J dom 2e-15
d1nz6a_98 a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [T 2e-14
d1xbla_75 a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain 4e-14
d1fpoa176 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) doma 3e-13
d1iura_88 a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human 3e-12
d1hdja_77 a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9 4e-12
d1gh6a_114 a.2.3.1 (A:) Large T antigen, the N-terminal J dom 2e-08
>d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure

class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Chaperone J-domain
family: Chaperone J-domain
domain: CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK)
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 68.9 bits (168), Expect = 2e-16
 Identities = 21/83 (25%), Positives = 45/83 (54%), Gaps = 2/83 (2%)

Query: 4  ESERKVQPSYYSVLGVSVHSSVEEIRRAYRKLAMQWHPDRWT--KTPSLLGKAKVKFQEI 61
            E+ ++  +YS+LG    +++ ++++ Y+KL + +HPD+ +       + +   KF EI
Sbjct: 9  ALEQTLKKDWYSILGADPSANMSDLKQKYQKLILLYHPDKQSADVPAGTMEECMQKFIEI 68

Query: 62 QEAYSVLSDERKRTLYDAGLYDP 84
           +A+ +L +E  +  YD     P
Sbjct: 69 DQAWKILGNEETKKKYDLQRSGP 91
>d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Length = 79 Back     information, alignment and structure
>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Length = 98 Back     information, alignment and structure
>d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 75 Back     information, alignment and structure
>d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 76 Back     information, alignment and structure
>d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Length = 77 Back     information, alignment and structure
>d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Length = 114 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query181
d1xbla_75 DnaJ chaperone, N-terminal (J) domain {Escherichia 99.89
d1wjza_94 CSL-type zinc finger-containing protein 3 (J-domai 99.87
d1hdja_77 HSP40 {Human (Homo sapiens) [TaxId: 9606]} 99.85
d1fpoa176 HSC20 (HSCB), N-terminal (J) domain {Escherichia c 99.82
d1gh6a_114 Large T antigen, the N-terminal J domain {Simian v 99.8
d1fafa_79 Large T antigen, the N-terminal J domain {Murine p 99.79
d1nz6a_98 Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} 99.71
d1iura_88 Hypothetical protein KIAA0730 {Human (Homo sapiens 99.69
>d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Chaperone J-domain
family: Chaperone J-domain
domain: DnaJ chaperone, N-terminal (J) domain
species: Escherichia coli [TaxId: 562]

Probab=99.89  E-value=8.9e-24  Score=142.93  Aligned_cols=68  Identities=49%  Similarity=0.811  Sum_probs=63.0

Q ss_pred             ccCcccccccCCCCCHHHHHHHHHHHHHHhCCCCCCCCcchhhHHHHHHHHHHHHHhhcCCchHHHHhhccC
Q 030216           10 QPSYYSVLGVSVHSSVEEIRRAYRKLAMQWHPDRWTKTPSLLGKAKVKFQEIQEAYSVLSDERKRTLYDAGL   81 (181)
Q Consensus        10 ~~d~Y~iLgv~~~as~~eIk~aYr~l~~~~HPDk~~~~~~~~~~a~~~f~~I~~AY~vLsdp~~R~~YD~~l   81 (181)
                      .+|||+||||+++||.++||+|||++++++|||+++.++    .+.+.|+.|++||+||+||.+|..||...
T Consensus         2 k~dyY~vLgv~~~As~~eIk~aYr~l~~~~HPDk~~~~~----~~~~~f~~i~~Ay~vL~d~~~R~~YD~~g   69 (75)
T d1xbla_           2 KQDYYEILGVSKTAEEREIRKAYKRLAMKYHPDRNQGDK----EAEAKFKEIKEAYEVLTDSQKRAAYDQYG   69 (75)
T ss_dssp             CCCTTTTTCCSSSCCHHHHHHHHHHHHHHTCCTTCTTTC----HHHHHHHHHHHHHHHTTSSHHHHHHHHHT
T ss_pred             CCCHHHHcCCCCCcCHHHHHHHHHHHHhhhhhhccCCCh----HHHHHHHHHHHHHHhcCCHHHHHHHHHhC
Confidence            579999999999999999999999999999999987654    57788999999999999999999999854
>d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Back     information, alignment and structure
>d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Back     information, alignment and structure
>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure