Citrus Sinensis ID: 030299


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------18
MGKASRDKRDIYYRKAKEEGWRARSAFKLLQIDEEFNIFEGVKRVVDLCAAPGSWSQVLSRKLYLPAKLSPDSREGDLPLIVAIDLQPMAPIEGVIQVQGDITNARTAEVVIRHFDGCKADLVVCDGAPDVTGLHDMDEFVQSQLILAVSIQFFIYELVFCLRQLLQYVILDGSYFCNK
ccccccccccHHHHHHHHHccHHHHHHHHHHHHHHccccccccEEEEEcccccHHHHHHHHHHccccccccccccccccEEEEEEccccccccccEEEEcccccHHHHHHHHHHcccccccEEEcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccEEEEEEEcccEEEEc
cccccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHcHccccEEEEEcccccccHHHHHHHHcccccccccccccccccEEEEEEcccccccccEEEEEcccccHHHHHHHHHHHcccccEEEEEccccccccccHHHHHHHHHHHHHHHHHHHccccEEEEEEEEccccccHHHHHcc
MGKASRDKRDIYYRKAKEEGWRARSAFKLLQIDEEFNIFEGVKRVVDlcaapgswsQVLSRklylpaklspdsregdlplivaidlqpmapiegVIQVQGDITNARTAEVVIRHFdgckadlvvcdgapdvtglhdmdEFVQSQLILAVSIQFFIYELVFCLRQLLQYVILdgsyfcnk
mgkasrdkrdiyyrkakeegwrarSAFKLLQIDEEFNIFEGVKRVVDLCAAPGSWSQVLSRKLYLPAKLSPDSREGDLPLIVAIDLQPMAPIEGVIQVQGDITNARTAEVVIRHFDGCKADLVVCDGAPDVTGLHDMDEFVQSQLILAVSIQFFIYELVFCLRQLLQYVILdgsyfcnk
MGKASRDKRDIYYRKAKEEGWRARSAFKLLQIDEEFNIFEGVKRVVDLCAAPGSWSQVLSRKLYLPAKLSPDSREGDLPLIVAIDLQPMAPIEGVIQVQGDITNARTAEVVIRHFDGCKADLVVCDGAPDVTGLHDMDEFVQSQLILAVSIQFFIYELVFCLRQLLQYVILDGSYFCNK
**********IYYRKAKEEGWRARSAFKLLQIDEEFNIFEGVKRVVDLCAAPGSWSQVLSRKLYLPAKL*****EGDLPLIVAIDLQPMAPIEGVIQVQGDITNARTAEVVIRHFDGCKADLVVCDGAPDVTGLHDMDEFVQSQLILAVSIQFFIYELVFCLRQLLQYVILDGSYFC**
****SRDKRDIYYRKAKEEGWRARSAFKLLQIDEEFNIFEGVKRVVDLCAAPGSWSQVLSRKLYL*********EGDLPLIVAIDLQPMAPIEGVIQVQGDITNARTAEVVIRHFDGCKADLVVCDGAPDVTGLHDMDEFVQSQLILAVSIQFFIYELVFCLRQLLQYVILDGSYFCNK
MGKASRDKRDIYYRKAKEEGWRARSAFKLLQIDEEFNIFEGVKRVVDLCAAPGSWSQVLSRKLYLPAKLSPDSREGDLPLIVAIDLQPMAPIEGVIQVQGDITNARTAEVVIRHFDGCKADLVVCDGAPDVTGLHDMDEFVQSQLILAVSIQFFIYELVFCLRQLLQYVILDGSYFCNK
*****RDKRDIYYRKAKEEGWRARSAFKLLQIDEEFNIFEGVKRVVDLCAAPGSWSQVLSRKLYLP*********GDLPLIVAIDLQPMAPIEGVIQVQGDITNARTAEVVIRHFDGCKADLVVCDGAPDVTGLHDMDEFVQSQLILAVSIQFFIYELVFCLRQLLQYVILDGSYFCNK
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGKASRDKRDIYYRKAKEEGWRARSAFKLLQIDEEFNIFEGVKRVVDLCAAPGSWSQVLSRKLYLPAKLSPDSREGDLPLIVAIDLQPMAPIEGVIQVQGDITNARTAEVVIRHFDGCKADLVVCDGAPDVTGLHDMDEFVQSQLILAVSIQFFIYELVFCLRQLLQYVILDGSYFCNK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query179 2.2.26 [Sep-21-2011]
Q54VA8270 Putative tRNA (cytidine(3 yes no 0.787 0.522 0.695 3e-55
Q22031 337 Putative tRNA (cytidine(3 yes no 0.782 0.415 0.677 8e-54
Q9UET6 329 Putative tRNA (cytidine(3 yes no 0.776 0.422 0.644 2e-51
O36015 285 Putative tRNA (cytidine(3 yes no 0.821 0.515 0.644 2e-51
Q9VEP1 302 Putative tRNA (cytidine(3 yes no 0.815 0.483 0.646 8e-51
Q9VDD9 320 Putative tRNA (cytidine(3 no no 0.854 0.478 0.613 8e-49
P38238 310 tRNA (cytidine(32)/guanos yes no 0.810 0.467 0.596 5e-45
A0B8A1255 Ribosomal RNA large subun yes no 0.670 0.470 0.444 3e-26
Q4FMX1203 Ribosomal RNA large subun yes no 0.865 0.763 0.374 9e-24
Q5BH88 806 AdoMet-dependent rRNA met no no 0.793 0.176 0.388 2e-23
>sp|Q54VA8|TRM7_DICDI Putative tRNA (cytidine(32)/guanosine(34)-2'-O)-methyltransferase OS=Dictyostelium discoideum GN=fsjA PE=3 SV=1 Back     alignment and function desciption
 Score =  214 bits (544), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 103/148 (69%), Positives = 124/148 (83%), Gaps = 7/148 (4%)

Query: 1   MGKASRDKRDIYYRKAKEEGWRARSAFKLLQIDEEFNIFEGVKRVVDLCAAPGSWSQVLS 60
           MGK+S+DKRDIYYRKAKEEGWRARSAFKL+QIDEE+ IFEGVKRVVDLCAAPGSWSQVLS
Sbjct: 1   MGKSSKDKRDIYYRKAKEEGWRARSAFKLIQIDEEYQIFEGVKRVVDLCAAPGSWSQVLS 60

Query: 61  RKLYLPAKLSPDSREGDLPLIVAIDLQPMAPIEGVIQVQGDITNARTAEVVIRHFDGCKA 120
           R++Y   K  PD +      IVA+DLQ MAP++GV+Q++GDIT   T++ +I HFDG  A
Sbjct: 61  RRIYGDGK-DPDVK------IVAVDLQEMAPLKGVVQIKGDITKYETSKQIISHFDGSLA 113

Query: 121 DLVVCDGAPDVTGLHDMDEFVQSQLILA 148
           DL++ DGAPDVTGLHD+D + QSQLIL+
Sbjct: 114 DLIISDGAPDVTGLHDIDFYGQSQLILS 141




Probable methyltransferase.
Dictyostelium discoideum (taxid: 44689)
EC: 2EC: .EC: 1EC: .EC: 1EC: .EC: -
>sp|Q22031|TRM7_CAEEL Putative tRNA (cytidine(32)/guanosine(34)-2'-O)-methyltransferase OS=Caenorhabditis elegans GN=R74.7 PE=3 SV=3 Back     alignment and function description
>sp|Q9UET6|TRM7_HUMAN Putative tRNA (cytidine(32)/guanosine(34)-2'-O)-methyltransferase OS=Homo sapiens GN=FTSJ1 PE=1 SV=2 Back     alignment and function description
>sp|O36015|TRM7_SCHPO Putative tRNA (cytidine(32)/guanosine(34)-2'-O)-methyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4F10.03c PE=3 SV=1 Back     alignment and function description
>sp|Q9VEP1|TRM71_DROME Putative tRNA (cytidine(32)/guanosine(34)-2'-O)-methyltransferase 1 OS=Drosophila melanogaster GN=CG5220 PE=2 SV=1 Back     alignment and function description
>sp|Q9VDD9|TRM72_DROME Putative tRNA (cytidine(32)/guanosine(34)-2'-O)-methyltransferase 2 OS=Drosophila melanogaster GN=CG7009 PE=3 SV=1 Back     alignment and function description
>sp|P38238|TRM7_YEAST tRNA (cytidine(32)/guanosine(34)-2'-O)-methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRM7 PE=1 SV=1 Back     alignment and function description
>sp|A0B8A1|RLME_METTP Ribosomal RNA large subunit methyltransferase E OS=Methanosaeta thermophila (strain DSM 6194 / PT) GN=rlmE PE=3 SV=1 Back     alignment and function description
>sp|Q4FMX1|RLME_PELUB Ribosomal RNA large subunit methyltransferase E OS=Pelagibacter ubique (strain HTCC1062) GN=rlmE PE=3 SV=1 Back     alignment and function description
>sp|Q5BH88|SPB1_EMENI AdoMet-dependent rRNA methyltransferase spb1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=spb1 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query179
225440636 316 PREDICTED: putative ribosomal RNA methyl 0.826 0.468 0.972 1e-78
255581073 316 ribosomal RNA methyltransferase, putativ 0.826 0.468 0.966 1e-77
449439914 316 PREDICTED: putative ribosomal RNA methyl 0.826 0.468 0.959 2e-77
30679168 309 S-adenosyl-L-methionine-dependent methyl 0.826 0.478 0.959 2e-77
357446585 316 rRNA methyltransferase-like protein [Med 0.826 0.468 0.952 2e-77
297806107 309 hypothetical protein ARALYDRAFT_486954 [ 0.826 0.478 0.959 3e-77
6759446 287 cell division-like protein [Arabidopsis 0.826 0.515 0.959 4e-77
242066866 317 hypothetical protein SORBIDRAFT_04g03622 0.832 0.470 0.939 5e-77
115469828 317 Os06g0704900 [Oryza sativa Japonica Grou 0.832 0.470 0.939 5e-77
356549337 313 PREDICTED: putative ribosomal RNA methyl 0.821 0.469 0.952 6e-77
>gi|225440636|ref|XP_002278921.1| PREDICTED: putative ribosomal RNA methyltransferase 1 [Vitis vinifera] gi|297740237|emb|CBI30419.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  297 bits (760), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 144/148 (97%), Positives = 147/148 (99%)

Query: 1   MGKASRDKRDIYYRKAKEEGWRARSAFKLLQIDEEFNIFEGVKRVVDLCAAPGSWSQVLS 60
           MGKASRDKRDIYYRKAKEEGWRARSAFKLLQIDEEFNIFEGVKRVVDLCAAPGSWSQVLS
Sbjct: 1   MGKASRDKRDIYYRKAKEEGWRARSAFKLLQIDEEFNIFEGVKRVVDLCAAPGSWSQVLS 60

Query: 61  RKLYLPAKLSPDSREGDLPLIVAIDLQPMAPIEGVIQVQGDITNARTAEVVIRHFDGCKA 120
           RKL+LPAKLSP SR+GDLPLIVAIDLQPMAPIEGVIQVQGDITNARTAE+VIRHFDGCKA
Sbjct: 61  RKLFLPAKLSPASRDGDLPLIVAIDLQPMAPIEGVIQVQGDITNARTAELVIRHFDGCKA 120

Query: 121 DLVVCDGAPDVTGLHDMDEFVQSQLILA 148
           DLVVCDGAPDVTGLHDMDEFVQSQLILA
Sbjct: 121 DLVVCDGAPDVTGLHDMDEFVQSQLILA 148




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|255581073|ref|XP_002531352.1| ribosomal RNA methyltransferase, putative [Ricinus communis] gi|223529050|gb|EEF31036.1| ribosomal RNA methyltransferase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|449439914|ref|XP_004137730.1| PREDICTED: putative ribosomal RNA methyltransferase 1-like [Cucumis sativus] gi|449483463|ref|XP_004156599.1| PREDICTED: putative ribosomal RNA methyltransferase 1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|30679168|ref|NP_851026.1| S-adenosyl-L-methionine-dependent methyltransferase-like protein [Arabidopsis thaliana] gi|26983822|gb|AAN86163.1| putative cell division protein [Arabidopsis thaliana] gi|332002931|gb|AED90314.1| S-adenosyl-L-methionine-dependent methyltransferase-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|357446585|ref|XP_003593568.1| rRNA methyltransferase-like protein [Medicago truncatula] gi|355482616|gb|AES63819.1| rRNA methyltransferase-like protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|297806107|ref|XP_002870937.1| hypothetical protein ARALYDRAFT_486954 [Arabidopsis lyrata subsp. lyrata] gi|297316774|gb|EFH47196.1| hypothetical protein ARALYDRAFT_486954 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|6759446|emb|CAB69851.1| cell division-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|242066866|ref|XP_002454722.1| hypothetical protein SORBIDRAFT_04g036220 [Sorghum bicolor] gi|241934553|gb|EES07698.1| hypothetical protein SORBIDRAFT_04g036220 [Sorghum bicolor] Back     alignment and taxonomy information
>gi|115469828|ref|NP_001058513.1| Os06g0704900 [Oryza sativa Japonica Group] gi|53792764|dbj|BAD53799.1| putative FtsJ homolog 1 isoform b [Oryza sativa Japonica Group] gi|113596553|dbj|BAF20427.1| Os06g0704900 [Oryza sativa Japonica Group] gi|215736929|dbj|BAG95858.1| unnamed protein product [Oryza sativa Japonica Group] gi|218198852|gb|EEC81279.1| hypothetical protein OsI_24387 [Oryza sativa Indica Group] gi|222636192|gb|EEE66324.1| hypothetical protein OsJ_22564 [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|356549337|ref|XP_003543050.1| PREDICTED: putative ribosomal RNA methyltransferase 1-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query179
TAIR|locus:2150069 309 AT5G01230 [Arabidopsis thalian 0.826 0.478 0.959 1.2e-72
DICTYBASE|DDB_G0280483270 fsjA "rRNA (uridine-2'-O-)-met 0.787 0.522 0.695 4e-51
ZFIN|ZDB-GENE-041114-83 323 ftsj1 "FtsJ homolog 1 (E. coli 0.787 0.436 0.702 1.7e-50
RGD|1561061 326 Ftsj1 "FtsJ RNA methyltransfer 0.770 0.423 0.668 9.5e-50
WB|WBGene00011281 337 R74.7 [Caenorhabditis elegans 0.776 0.412 0.682 4.1e-49
UNIPROTKB|E2REZ9 329 FTSJ1 "Uncharacterized protein 0.770 0.419 0.655 5.2e-49
UNIPROTKB|A0JNB8 307 FTSJ1 "Uncharacterized protein 0.770 0.449 0.655 6.7e-49
UNIPROTKB|Q9UET6 329 FTSJ1 "Putative tRNA (cytidine 0.770 0.419 0.648 2.9e-48
POMBASE|SPAC4F10.03c 285 SPAC4F10.03c "tRNA 2'-O-ribose 0.804 0.505 0.633 3.7e-48
FB|FBgn0038471 302 CG5220 [Drosophila melanogaste 0.860 0.509 0.628 6e-48
TAIR|locus:2150069 AT5G01230 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 734 (263.4 bits), Expect = 1.2e-72, P = 1.2e-72
 Identities = 142/148 (95%), Positives = 146/148 (98%)

Query:     1 MGKASRDKRDIYYRKAKEEGWRARSAFKLLQIDEEFNIFEGVKRVVDLCAAPGSWSQVLS 60
             MGKASRDKRDIYYRKAKEEGWRARSAFKLLQIDEEFNIFEGVKRVVDLCAAPGSWSQVLS
Sbjct:     1 MGKASRDKRDIYYRKAKEEGWRARSAFKLLQIDEEFNIFEGVKRVVDLCAAPGSWSQVLS 60

Query:    61 RKLYLPAKLSPDSREGDLPLIVAIDLQPMAPIEGVIQVQGDITNARTAEVVIRHFDGCKA 120
             R+LYLPAK S +S++GDLPLIVAIDLQPMAPIEGVIQVQGDITNARTAEVVIRHFDGCKA
Sbjct:    61 RQLYLPAKSSAESKDGDLPLIVAIDLQPMAPIEGVIQVQGDITNARTAEVVIRHFDGCKA 120

Query:   121 DLVVCDGAPDVTGLHDMDEFVQSQLILA 148
             DLVVCDGAPDVTGLHDMDEFVQSQLILA
Sbjct:   121 DLVVCDGAPDVTGLHDMDEFVQSQLILA 148




GO:0001510 "RNA methylation" evidence=IEA
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0005737 "cytoplasm" evidence=ISM
GO:0008168 "methyltransferase activity" evidence=IEA;ISS
GO:0032259 "methylation" evidence=IEA
GO:0019243 "methylglyoxal catabolic process to D-lactate" evidence=RCA
DICTYBASE|DDB_G0280483 fsjA "rRNA (uridine-2'-O-)-methyltransferase" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-041114-83 ftsj1 "FtsJ homolog 1 (E. coli)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
RGD|1561061 Ftsj1 "FtsJ RNA methyltransferase homolog 1 (E. coli)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
WB|WBGene00011281 R74.7 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|E2REZ9 FTSJ1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|A0JNB8 FTSJ1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q9UET6 FTSJ1 "Putative tRNA (cytidine(32)/guanosine(34)-2'-O)-methyltransferase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
POMBASE|SPAC4F10.03c SPAC4F10.03c "tRNA 2'-O-ribose methyltransferase (predicted)" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
FB|FBgn0038471 CG5220 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.1.10.766
4th Layer2.1.1.1660.824

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query179
COG0293205 COG0293, FtsJ, 23S rRNA methylase [Translation, ri 1e-56
pfam01728177 pfam01728, FtsJ, FtsJ-like methyltransferase 1e-43
TIGR00438188 TIGR00438, rrmJ, cell division protein FtsJ 3e-32
PRK11188209 PRK11188, rrmJ, 23S rRNA methyltransferase J; Prov 1e-19
COG1189245 COG1189, COG1189, Predicted rRNA methylase [Transl 2e-04
>gnl|CDD|223370 COG0293, FtsJ, 23S rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
 Score =  177 bits (450), Expect = 1e-56
 Identities = 60/145 (41%), Positives = 86/145 (59%), Gaps = 12/145 (8%)

Query: 5   SRDKRDIYYRKAKEEGWRARSAFKLLQIDEEFNIFEGVKRVVDLCAAPGSWSQVLSRKLY 64
           +   RD YY+KAK+EG+R+R+A+KLL+++E+F +F+    VVDL AAPG WSQV ++KL 
Sbjct: 9   AEHLRDPYYKKAKKEGYRSRAAYKLLELNEKFKLFKPGMVVVDLGAAPGGWSQVAAKKL- 67

Query: 65  LPAKLSPDSREGDLPLIVAIDLQPMAPIEGVIQVQGDITNARTAEVVIRHFDGCKADLVV 124
                      G    IVA+D+ PM PI GVI +QGDIT+  T E ++    G   D+V+
Sbjct: 68  -----------GAGGKIVAVDILPMKPIPGVIFLQGDITDEDTLEKLLEALGGAPVDVVL 116

Query: 125 CDGAPDVTGLHDMDEFVQSQLILAV 149
            D AP+ +G   +D      L    
Sbjct: 117 SDMAPNTSGNRSVDHARSMYLCELA 141


Length = 205

>gnl|CDD|216666 pfam01728, FtsJ, FtsJ-like methyltransferase Back     alignment and domain information
>gnl|CDD|232976 TIGR00438, rrmJ, cell division protein FtsJ Back     alignment and domain information
>gnl|CDD|183025 PRK11188, rrmJ, 23S rRNA methyltransferase J; Provisional Back     alignment and domain information
>gnl|CDD|224110 COG1189, COG1189, Predicted rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 179
KOG1099 294 consensus SAM-dependent methyltransferase/cell div 100.0
COG0293205 FtsJ 23S rRNA methylase [Translation, ribosomal st 100.0
KOG4589232 consensus Cell division protein FtsJ [Cell cycle c 100.0
KOG1098 780 consensus Putative SAM-dependent rRNA methyltransf 100.0
PRK11188209 rrmJ 23S rRNA methyltransferase J; Provisional 99.97
PF01728181 FtsJ: FtsJ-like methyltransferase; InterPro: IPR00 99.97
TIGR00438188 rrmJ cell division protein FtsJ. 99.9
KOG3673 845 consensus FtsJ-like RNA methyltransferase [RNA pro 99.89
PRK11760357 putative 23S rRNA C2498 ribose 2'-O-ribose methylt 99.62
COG4106 257 Tam Trans-aconitate methyltransferase [General fun 99.32
COG1189245 Predicted rRNA methylase [Translation, ribosomal s 99.3
TIGR00446264 nop2p NOL1/NOP2/sun family putative RNA methylase. 99.16
TIGR00478228 tly hemolysin TlyA family protein. Hemolysins are 99.11
PTZ00146293 fibrillarin; Provisional 99.1
PRK14903431 16S rRNA methyltransferase B; Provisional 99.08
PRK11933 470 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; 99.05
PF12847112 Methyltransf_18: Methyltransferase domain; PDB: 3G 99.03
COG0144355 Sun tRNA and rRNA cytosine-C5-methylases [Translat 99.01
PRK14901434 16S rRNA methyltransferase B; Provisional 98.98
PRK14904445 16S rRNA methyltransferase B; Provisional 98.95
PRK04266226 fibrillarin; Provisional 98.93
COG2230283 Cfa Cyclopropane fatty acid synthase and related m 98.93
PF13847152 Methyltransf_31: Methyltransferase domain; PDB: 3T 98.93
TIGR02752231 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone me 98.91
COG2226238 UbiE Methylase involved in ubiquinone/menaquinone 98.9
PRK14902444 16S rRNA methyltransferase B; Provisional 98.9
TIGR00563426 rsmB ribosomal RNA small subunit methyltransferase 98.88
PRK14103 255 trans-aconitate 2-methyltransferase; Provisional 98.88
PRK10901427 16S rRNA methyltransferase B; Provisional 98.88
PF01189283 Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR 98.87
PF01209233 Ubie_methyltran: ubiE/COQ5 methyltransferase famil 98.87
PRK01683 258 trans-aconitate 2-methyltransferase; Provisional 98.85
KOG1122460 consensus tRNA and rRNA cytosine-C5-methylase (nuc 98.81
TIGR03587204 Pse_Me-ase pseudaminic acid biosynthesis-associate 98.79
PLN02233261 ubiquinone biosynthesis methyltransferase 98.75
TIGR02072240 BioC biotin biosynthesis protein BioC. This enzyme 98.73
PRK11873272 arsM arsenite S-adenosylmethyltransferase; Reviewe 98.73
COG2933358 Predicted SAM-dependent methyltransferase [General 98.73
PRK00107187 gidB 16S rRNA methyltransferase GidB; Reviewed 98.73
PF02353273 CMAS: Mycolic acid cyclopropane synthetase; InterP 98.71
TIGR02469124 CbiT precorrin-6Y C5,15-methyltransferase (decarbo 98.69
PLN02244340 tocopherol O-methyltransferase 98.69
TIGR00138181 gidB 16S rRNA methyltransferase GidB. GidB (glucos 98.69
PTZ00098263 phosphoethanolamine N-methyltransferase; Provision 98.68
PF07021193 MetW: Methionine biosynthesis protein MetW; InterP 98.67
TIGR00080215 pimt protein-L-isoaspartate(D-aspartate) O-methylt 98.67
PRK13942212 protein-L-isoaspartate O-methyltransferase; Provis 98.64
PRK10258251 biotin biosynthesis protein BioC; Provisional 98.63
PF05175170 MTS: Methyltransferase small domain; InterPro: IPR 98.61
PRK08317241 hypothetical protein; Provisional 98.61
PRK05785226 hypothetical protein; Provisional 98.6
smart00650169 rADc Ribosomal RNA adenine dimethylases. 98.58
PRK15068322 tRNA mo(5)U34 methyltransferase; Provisional 98.56
PRK00121202 trmB tRNA (guanine-N(7)-)-methyltransferase; Revie 98.53
PF13649101 Methyltransf_25: Methyltransferase domain; PDB: 3B 98.52
PRK11207197 tellurite resistance protein TehB; Provisional 98.51
PRK13944205 protein-L-isoaspartate O-methyltransferase; Provis 98.49
PRK11705383 cyclopropane fatty acyl phospholipid synthase; Pro 98.48
TIGR02081194 metW methionine biosynthesis protein MetW. This pr 98.48
PLN02336475 phosphoethanolamine N-methyltransferase 98.47
PRK11036255 putative S-adenosyl-L-methionine-dependent methylt 98.47
PRK11088272 rrmA 23S rRNA methyltransferase A; Provisional 98.46
PF13659117 Methyltransf_26: Methyltransferase domain; PDB: 3G 98.46
PF0824195 Methyltransf_11: Methyltransferase domain; InterPr 98.45
PRK14967223 putative methyltransferase; Provisional 98.43
KOG2198375 consensus tRNA cytosine-5-methylases and related e 98.43
PLN02490 340 MPBQ/MSBQ methyltransferase 98.42
TIGR03534251 RF_mod_PrmC protein-(glutamine-N5) methyltransfera 98.4
PRK08287187 cobalt-precorrin-6Y C(15)-methyltransferase; Valid 98.39
PRK06202232 hypothetical protein; Provisional 98.39
PRK00050 296 16S rRNA m(4)C1402 methyltranserfase; Provisional 98.38
PHA03412241 putative methyltransferase; Provisional 98.36
TIGR03533284 L3_gln_methyl protein-(glutamine-N5) methyltransfe 98.35
PRK00216239 ubiE ubiquinone/menaquinone biosynthesis methyltra 98.35
TIGR00091194 tRNA (guanine-N(7)-)-methyltransferase. In E. coli 98.35
TIGR00477195 tehB tellurite resistance protein TehB. Part of a 98.35
PRK13943 322 protein-L-isoaspartate O-methyltransferase; Provis 98.34
PHA03411279 putative methyltransferase; Provisional 98.33
PRK15001378 SAM-dependent 23S ribosomal RNA mG1835 methyltrans 98.33
TIGR00740239 methyltransferase, putative. A simple BLAST search 98.31
PRK03522315 rumB 23S rRNA methyluridine methyltransferase; Rev 98.31
PLN02396322 hexaprenyldihydroxybenzoate methyltransferase 98.31
PF01135209 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyl 98.31
PF03848192 TehB: Tellurite resistance protein TehB; InterPro: 98.3
PRK00377198 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; 98.3
TIGR00452314 methyltransferase, putative. Known examples to dat 98.29
PF13489161 Methyltransf_23: Methyltransferase domain; PDB: 3J 98.28
PRK15451247 tRNA cmo(5)U34 methyltransferase; Provisional 98.27
COG2263198 Predicted RNA methylase [Translation, ribosomal st 98.27
PRK00312212 pcm protein-L-isoaspartate O-methyltransferase; Re 98.26
TIGR00536284 hemK_fam HemK family putative methylases. The gene 98.26
COG2227243 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4- 98.25
PRK09328275 N5-glutamine S-adenosyl-L-methionine-dependent met 98.24
PRK12335287 tellurite resistance protein TehB; Provisional 98.23
TIGR01177329 conserved hypothetical protein TIGR01177. This fam 98.23
PRK00274 272 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 98.21
PRK06922 677 hypothetical protein; Provisional 98.2
PRK14966423 unknown domain/N5-glutamine S-adenosyl-L-methionin 98.19
PRK11805307 N5-glutamine S-adenosyl-L-methionine-dependent met 98.19
PRK14896 258 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 98.19
TIGR03704251 PrmC_rel_meth putative protein-(glutamine-N5) meth 98.18
TIGR00537179 hemK_rel_arch HemK-related putative methylase. The 98.17
TIGR01934223 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis 98.17
COG4123248 Predicted O-methyltransferase [General function pr 98.16
TIGR02021219 BchM-ChlM magnesium protoporphyrin O-methyltransfe 98.16
PRK13168443 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewe 98.15
PRK07402196 precorrin-6B methylase; Provisional 98.14
PRK15128396 23S rRNA m(5)C1962 methyltransferase; Provisional 98.14
PRK04457262 spermidine synthase; Provisional 98.11
PRK01544 506 bifunctional N5-glutamine S-adenosyl-L-methionine- 98.1
PRK00811283 spermidine synthase; Provisional 98.1
COG2813300 RsmC 16S RNA G1207 methylase RsmC [Translation, ri 98.09
PRK09489342 rsmC 16S ribosomal RNA m2G1207 methyltransferase; 98.09
PTZ00338 294 dimethyladenosine transferase-like protein; Provis 98.08
PRK14968188 putative methyltransferase; Provisional 98.08
PLN02336 475 phosphoethanolamine N-methyltransferase 98.08
smart00828224 PKS_MT Methyltransferase in polyketide synthase (P 98.06
PRK14121 390 tRNA (guanine-N(7)-)-methyltransferase; Provisiona 98.06
PRK10909199 rsmD 16S rRNA m(2)G966-methyltransferase; Provisio 98.04
PLN02585315 magnesium protoporphyrin IX methyltransferase 98.04
PRK07580230 Mg-protoporphyrin IX methyl transferase; Validated 98.04
TIGR03840213 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te d 98.03
COG2890280 HemK Methylase of polypeptide chain release factor 98.02
TIGR03438301 probable methyltransferase. This model represents 98.02
PF0824299 Methyltransf_12: Methyltransferase domain; InterPr 98.01
PF05401201 NodS: Nodulation protein S (NodS); InterPro: IPR00 98.01
TIGR00755253 ksgA dimethyladenosine transferase. Alternate name 97.98
PLN03075296 nicotianamine synthase; Provisional 97.97
PRK11783702 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi 97.97
TIGR00406288 prmA ribosomal protein L11 methyltransferase. Ribo 97.95
cd02440107 AdoMet_MTases S-adenosylmethionine-dependent methy 97.94
TIGR00479431 rumA 23S rRNA (uracil-5-)-methyltransferase RumA. 97.93
COG2242187 CobL Precorrin-6B methylase 2 [Coenzyme metabolism 97.92
KOG1499 346 consensus Protein arginine N-methyltransferase PRM 97.91
PF06325295 PrmA: Ribosomal protein L11 methyltransferase (Prm 97.88
COG2518209 Pcm Protein-L-isoaspartate carboxylmethyltransfera 97.87
COG2264300 PrmA Ribosomal protein L11 methylase [Translation, 97.87
PRK04148134 hypothetical protein; Provisional 97.84
TIGR02085374 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransfer 97.82
KOG1270282 consensus Methyltransferases [Coenzyme transport a 97.82
PLN02781234 Probable caffeoyl-CoA O-methyltransferase 97.79
KOG3420185 consensus Predicted RNA methylase [Translation, ri 97.77
PLN02366308 spermidine synthase 97.76
COG2519256 GCD14 tRNA(1-methyladenosine) methyltransferase an 97.75
KOG1271227 consensus Methyltransferases [General function pre 97.74
smart00138264 MeTrc Methyltransferase, chemotaxis proteins. Meth 97.72
TIGR02716306 C20_methyl_CrtF C-20 methyltransferase BchU. Membe 97.71
PF09445163 Methyltransf_15: RNA cap guanine-N2 methyltransfer 97.7
KOG0820 315 consensus Ribosomal RNA adenine dimethylase [RNA p 97.69
COG0030 259 KsgA Dimethyladenosine transferase (rRNA methylati 97.67
PF01269229 Fibrillarin: Fibrillarin; InterPro: IPR000692 Fibr 97.66
PRK13255218 thiopurine S-methyltransferase; Reviewed 97.65
PF10672286 Methyltrans_SAM: S-adenosylmethionine-dependent me 97.65
TIGR00417270 speE spermidine synthase. the SpeE subunit of sper 97.65
PRK00517250 prmA ribosomal protein L11 methyltransferase; Revi 97.64
PF08704247 GCD14: tRNA methyltransferase complex GCD14 subuni 97.63
TIGR00095189 RNA methyltransferase, RsmD family. This model rep 97.6
PLN02476278 O-methyltransferase 97.59
COG3963194 Phospholipid N-methyltransferase [Lipid metabolism 97.56
PRK05134233 bifunctional 3-demethylubiquinone-9 3-methyltransf 97.56
TIGR01983224 UbiG ubiquinone biosynthesis O-methyltransferase. 97.55
COG1092393 Predicted SAM-dependent methyltransferases [Genera 97.55
PLN02672 1082 methionine S-methyltransferase 97.54
PRK05031362 tRNA (uracil-5-)-methyltransferase; Validated 97.52
PF02390195 Methyltransf_4: Putative methyltransferase ; Inter 97.5
PRK03612521 spermidine synthase; Provisional 97.47
PF08003315 Methyltransf_9: Protein of unknown function (DUF16 97.45
PRK11727321 23S rRNA mA1618 methyltransferase; Provisional 97.43
PF01596205 Methyltransf_3: O-methyltransferase; InterPro: IPR 97.42
TIGR02143353 trmA_only tRNA (uracil-5-)-methyltransferase. This 97.39
PF02475200 Met_10: Met-10+ like-protein; InterPro: IPR003402 97.38
PF05185 448 PRMT5: PRMT5 arginine-N-methyltransferase; InterPr 97.36
KOG3674 696 consensus FtsJ-like RNA methyltransferase [RNA pro 97.34
PF00398 262 RrnaAD: Ribosomal RNA adenine dimethylase; InterPr 97.33
PF01170179 UPF0020: Putative RNA methylase family UPF0020; In 97.3
KOG1500 517 consensus Protein arginine N-methyltransferase CAR 97.29
COG2521287 Predicted archaeal methyltransferase [General func 97.2
KOG3010 261 consensus Methyltransferase [General function pred 97.16
COG1889231 NOP1 Fibrillarin-like rRNA methylase [Translation, 97.16
PF08123205 DOT1: Histone methylation protein DOT1 ; InterPro: 97.16
PRK01581374 speE spermidine synthase; Validated 97.15
KOG1541270 consensus Predicted protein carboxyl methylase [Ge 97.08
KOG1540296 consensus Ubiquinone biosynthesis methyltransferas 97.05
PF03602183 Cons_hypoth95: Conserved hypothetical protein 95; 97.03
PRK04338 382 N(2),N(2)-dimethylguanosine tRNA methyltransferase 96.99
TIGR00006 305 S-adenosyl-methyltransferase MraW. Genetics paper 96.99
KOG2904328 consensus Predicted methyltransferase [General fun 96.95
PRK13256226 thiopurine S-methyltransferase; Reviewed 96.95
KOG3191209 consensus Predicted N6-DNA-methyltransferase [Tran 96.87
COG2265432 TrmA SAM-dependent methyltransferases related to t 96.87
PF05724218 TPMT: Thiopurine S-methyltransferase (TPMT); Inter 96.84
PF04989206 CmcI: Cephalosporin hydroxylase; InterPro: IPR0070 96.82
PF00891241 Methyltransf_2: O-methyltransferase; InterPro: IPR 96.77
PF05958352 tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferas 96.77
COG4076252 Predicted RNA methylase [General function predicti 96.73
TIGR01444143 fkbM_fam methyltransferase, FkbM family. Members o 96.72
PF03291 331 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 96.72
COG0421282 SpeE Spermidine synthase [Amino acid transport and 96.72
COG0742187 N6-adenine-specific methylase [DNA replication, re 96.71
KOG1975 389 consensus mRNA cap methyltransferase [RNA processi 96.58
PF10294173 Methyltransf_16: Putative methyltransferase; Inter 96.55
KOG2360413 consensus Proliferation-associated nucleolar prote 96.52
KOG2730263 consensus Methylase [General function prediction o 96.5
PF02384 311 N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 T 96.39
KOG2187534 consensus tRNA uracil-5-methyltransferase and rela 96.35
KOG1596317 consensus Fibrillarin and related nucleolar RNA-bi 96.3
COG4122219 Predicted O-methyltransferase [General function pr 96.29
COG0220227 Predicted S-adenosylmethionine-dependent methyltra 96.28
PLN02589247 caffeoyl-CoA O-methyltransferase 96.26
KOG2915314 consensus tRNA(1-methyladenosine) methyltransferas 96.22
KOG4300252 consensus Predicted methyltransferase [General fun 96.17
PRK01544506 bifunctional N5-glutamine S-adenosyl-L-methionine- 96.11
PF12147311 Methyltransf_20: Putative methyltransferase; Inter 96.03
COG1041347 Predicted DNA modification methylase [DNA replicat 96.03
PF05148219 Methyltransf_8: Hypothetical methyltransferase; In 95.99
PF13679141 Methyltransf_32: Methyltransferase domain 95.75
PLN02823336 spermine synthase 95.71
KOG1663237 consensus O-methyltransferase [Secondary metabolit 95.7
COG4976287 Predicted methyltransferase (contains TPR repeat) 95.69
TIGR03439 319 methyl_EasF probable methyltransferase domain, Eas 95.65
PF01795 310 Methyltransf_5: MraW methylase family; InterPro: I 95.63
COG2520341 Predicted methyltransferase [General function pred 95.54
PF05219265 DREV: DREV methyltransferase; InterPro: IPR007884 95.48
KOG2361264 consensus Predicted methyltransferase [General fun 95.28
TIGR00308 374 TRM1 tRNA(guanine-26,N2-N2) methyltransferase. Thi 95.19
PF13578106 Methyltransf_24: Methyltransferase domain; PDB: 3S 95.12
PRK10742250 putative methyltransferase; Provisional 95.07
PF02527184 GidB: rRNA small subunit methyltransferase G; Inte 94.98
COG0275 314 Predicted S-adenosylmethionine-dependent methyltra 94.94
PF05206259 TRM13: Methyltransferase TRM13; InterPro: IPR00787 94.91
COG0357215 GidB Predicted S-adenosylmethionine-dependent meth 94.82
PF01564246 Spermine_synth: Spermine/spermidine synthase; Inte 94.8
PF09243 274 Rsm22: Mitochondrial small ribosomal subunit Rsm22 94.63
KOG3045325 consensus Predicted RNA methylase involved in rRNA 94.55
COG3897218 Predicted methyltransferase [General function pred 94.51
PRK11783 702 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi 94.42
KOG2940 325 consensus Predicted methyltransferase [General fun 94.39
cd00315 275 Cyt_C5_DNA_methylase Cytosine-C5 specific DNA meth 94.16
KOG2899 288 consensus Predicted methyltransferase [General fun 93.87
KOG1661237 consensus Protein-L-isoaspartate(D-aspartate) O-me 93.07
COG1255129 Uncharacterized protein conserved in archaea [Func 92.98
PRK06179 270 short chain dehydrogenase; Provisional 92.9
PLN02657 390 3,8-divinyl protochlorophyllide a 8-vinyl reductas 92.69
PF04672267 Methyltransf_19: S-adenosyl methyltransferase; Int 92.56
PRK08177225 short chain dehydrogenase; Provisional 91.89
PF00145 335 DNA_methylase: C-5 cytosine-specific DNA methylase 91.82
KOG2651 476 consensus rRNA adenine N-6-methyltransferase [RNA 91.27
KOG3115249 consensus Methyltransferase-like protein [General 90.7
COG0500257 SmtA SAM-dependent methyltransferases [Secondary m 90.1
PHA01634156 hypothetical protein 89.05
PF03686127 UPF0146: Uncharacterised protein family (UPF0146); 89.02
PLN02662 322 cinnamyl-alcohol dehydrogenase family protein 88.56
COG3510237 CmcI Cephalosporin hydroxylase [Defense mechanisms 88.5
PF03141 506 Methyltransf_29: Putative S-adenosyl-L-methionine- 88.38
PLN02695 370 GDP-D-mannose-3',5'-epimerase 87.85
PRK06398 258 aldose dehydrogenase; Validated 87.77
KOG0024354 consensus Sorbitol dehydrogenase [Secondary metabo 87.72
PRK06196 315 oxidoreductase; Provisional 87.58
PF06460 299 NSP13: Coronavirus NSP13; InterPro: IPR009461 This 86.91
PRK05993 277 short chain dehydrogenase; Provisional 86.57
KOG2671421 consensus Putative RNA methylase [Replication, rec 86.14
TIGR02987 524 met_A_Alw26 type II restriction m6 adenine DNA met 85.97
COG4798238 Predicted methyltransferase [General function pred 85.77
cd08283386 FDH_like_1 Glutathione-dependent formaldehyde dehy 85.66
TIGR00675 315 dcm DNA-methyltransferase (dcm). All proteins in t 85.58
PRK06523 260 short chain dehydrogenase; Provisional 85.51
KOG1209 289 consensus 1-Acyl dihydroxyacetone phosphate reduct 85.18
PRK06953222 short chain dehydrogenase; Provisional 84.38
PF04816205 DUF633: Family of unknown function (DUF633) ; Inte 84.18
COG0116381 Predicted N6-adenine-specific DNA methylase [DNA r 84.17
TIGR02622 349 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase. Member 83.95
PF06080204 DUF938: Protein of unknown function (DUF938); Inte 83.78
PRK07533 258 enoyl-(acyl carrier protein) reductase; Provisiona 83.22
PRK07454241 short chain dehydrogenase; Provisional 83.03
PRK12748 256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 82.8
PRK08264 238 short chain dehydrogenase; Validated 82.52
COG0286 489 HsdM Type I restriction-modification system methyl 82.21
PF11968219 DUF3321: Putative methyltransferase (DUF3321); Int 81.97
PF07091251 FmrO: Ribosomal RNA methyltransferase (FmrO); PDB: 81.74
COG0270 328 Dcm Site-specific DNA methylase [DNA replication, 81.31
PHA03108 300 poly(A) polymerase small subunit; Provisional 81.21
PF01073 280 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/iso 80.92
PLN02989 325 cinnamyl-alcohol dehydrogenase family protein 80.85
PF02254116 TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg 80.85
PRK00536262 speE spermidine synthase; Provisional 80.78
PRK06182 273 short chain dehydrogenase; Validated 80.75
PRK07326237 short chain dehydrogenase; Provisional 80.51
PRK09072 263 short chain dehydrogenase; Provisional 80.02
>KOG1099 consensus SAM-dependent methyltransferase/cell division protein FtsJ [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
Probab=100.00  E-value=4.5e-43  Score=286.18  Aligned_cols=168  Identities=72%  Similarity=1.093  Sum_probs=151.2

Q ss_pred             CCCCcCCCCchHHHHHHhhCCcchhhhcHHhHHHHhCCCCCCCEEEEEccCCChHHHHHHHHhCCCCCCCCCCCCCCCCe
Q 030299            1 MGKASRDKRDIYYRKAKEEGWRARSAFKLLQIDEEFNIFEGVKRVVDLCAAPGSWSQVLSRKLYLPAKLSPDSREGDLPL   80 (179)
Q Consensus         1 ~~~~~~~~~d~y~~~a~~~~~~sRaa~KL~eid~~~~ll~~g~~VlDLgagpGg~s~~l~~~~~~~~~~~~~~~~~~~~~   80 (179)
                      ||++||..||.|||+||++|||.|+||||+++|+.|++++.-.+|+||||+||+|||+|.+++..+...+    ++.+-+
T Consensus         1 MGktskDKRDiYYRlAKe~gwRARSAFKLlqideef~i~~gv~rvVDLCAAPGSWSQvlSrkL~~~~~~~----~~~~~k   76 (294)
T KOG1099|consen    1 MGKTSKDKRDIYYRLAKENGWRARSAFKLLQIDEEFQIFEGVKRVVDLCAAPGSWSQVLSRKLYKPLPSS----GERDKK   76 (294)
T ss_pred             CCCccchhhHHHHHHHHhccchHHhHHHHhhhhhhhhHHhhhhHHhhhhcCCCcHHHHHHHHHhccCCCc----chhhcc
Confidence            9999999999999999999999999999999999999999999999999999999999999875321111    122237


Q ss_pred             EEEEeCCCCCCCCCeeEEeccccchhhHHHHHhhcCCCCccEEeeCCCCCCCCCCcccHHHHHHHHHHHHHHH-------
Q 030299           81 IVAIDLQPMAPIEGVIQVQGDITNARTAEVVIRHFDGCKADLVVCDGAPDVTGLHDMDEFVQSQLILAVSIQF-------  153 (179)
Q Consensus        81 VvavD~~~~~~~~~v~~i~gDi~~~~~~~~l~~~~~~~~~D~VlsD~~~~~~g~~~~d~~~q~~L~~~AL~~~-------  153 (179)
                      |||||++||.|++||..+|+|||...+.+++.++|.+++.|+|+|||+|+++|..+.|+++|.+|+++||+..       
T Consensus        77 IVaVDLQ~MaPI~GV~qlq~DIT~~stae~Ii~hfggekAdlVvcDGAPDvTGlHd~DEy~Q~qLllaAl~i~t~Vlk~G  156 (294)
T KOG1099|consen   77 IVAVDLQPMAPIEGVIQLQGDITSASTAEAIIEHFGGEKADLVVCDGAPDVTGLHDLDEYVQAQLLLAALNIATCVLKPG  156 (294)
T ss_pred             EEEEecccCCccCceEEeecccCCHhHHHHHHHHhCCCCccEEEeCCCCCccccccHHHHHHHHHHHHHHHHHhheecCC
Confidence            9999999999999999999999999999999999999999999999999999999999999999999999965       


Q ss_pred             --HH--------HHHHH-HHHHhhceEEEe
Q 030299          154 --FI--------YELVF-CLRQLLQYVILD  172 (179)
Q Consensus       154 --~~--------~~~~~-~~~~~f~~v~~~  172 (179)
                        |+        .+++| +|+.+|++|.+.
T Consensus       157 g~FVaKifRg~~tslLysql~~ff~kv~~~  186 (294)
T KOG1099|consen  157 GSFVAKIFRGRDTSLLYSQLRKFFKKVTCA  186 (294)
T ss_pred             CeeehhhhccCchHHHHHHHHHHhhceeee
Confidence              21        56775 889999999864



>COG0293 FtsJ 23S rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG4589 consensus Cell division protein FtsJ [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1098 consensus Putative SAM-dependent rRNA methyltransferase SPB1 [RNA processing and modification; General function prediction only] Back     alignment and domain information
>PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional Back     alignment and domain information
>PF01728 FtsJ: FtsJ-like methyltransferase; InterPro: IPR002877 RrmJ (FtsJ) is a well conserved heat shock protein present in prokaryotes, archaea, and eukaryotes Back     alignment and domain information
>TIGR00438 rrmJ cell division protein FtsJ Back     alignment and domain information
>KOG3673 consensus FtsJ-like RNA methyltransferase [RNA processing and modification] Back     alignment and domain information
>PRK11760 putative 23S rRNA C2498 ribose 2'-O-ribose methyltransferase; Provisional Back     alignment and domain information
>COG4106 Tam Trans-aconitate methyltransferase [General function prediction only] Back     alignment and domain information
>COG1189 Predicted rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00446 nop2p NOL1/NOP2/sun family putative RNA methylase Back     alignment and domain information
>TIGR00478 tly hemolysin TlyA family protein Back     alignment and domain information
>PTZ00146 fibrillarin; Provisional Back     alignment and domain information
>PRK14903 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK11933 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; Reviewed Back     alignment and domain information
>PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A Back     alignment and domain information
>COG0144 Sun tRNA and rRNA cytosine-C5-methylases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK14901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK14904 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK04266 fibrillarin; Provisional Back     alignment and domain information
>COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF13847 Methyltransf_31: Methyltransferase domain; PDB: 3T0I_B 3SVZ_B 3SXJ_A 3F4K_A 3GU3_B 2GH1_A 1R8Y_E 1R8X_B 2B3T_A 1T43_A Back     alignment and domain information
>TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase Back     alignment and domain information
>COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PRK14902 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>TIGR00563 rsmB ribosomal RNA small subunit methyltransferase RsmB Back     alignment and domain information
>PRK14103 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>PRK10901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PF01189 Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR001678 This domain is found in archaeal, bacterial and eukaryotic proteins Back     alignment and domain information
>PF01209 Ubie_methyltran: ubiE/COQ5 methyltransferase family; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities [] Back     alignment and domain information
>PRK01683 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>KOG1122 consensus tRNA and rRNA cytosine-C5-methylase (nucleolar protein NOL1/NOP2) [RNA processing and modification] Back     alignment and domain information
>TIGR03587 Pse_Me-ase pseudaminic acid biosynthesis-associated methylase Back     alignment and domain information
>PLN02233 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>TIGR02072 BioC biotin biosynthesis protein BioC Back     alignment and domain information
>PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed Back     alignment and domain information
>COG2933 Predicted SAM-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>PRK00107 gidB 16S rRNA methyltransferase GidB; Reviewed Back     alignment and domain information
>PF02353 CMAS: Mycolic acid cyclopropane synthetase; InterPro: IPR003333 This entry represents mycolic acid cyclopropane synthases and related enzymes, including CmaA1, CmaA2 (cyclopropane mycolic acid synthase A1 and A2) and MmaA1-4 (methoxymycolic acid synthase A1-4) Back     alignment and domain information
>TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit Back     alignment and domain information
>PLN02244 tocopherol O-methyltransferase Back     alignment and domain information
>TIGR00138 gidB 16S rRNA methyltransferase GidB Back     alignment and domain information
>PTZ00098 phosphoethanolamine N-methyltransferase; Provisional Back     alignment and domain information
>PF07021 MetW: Methionine biosynthesis protein MetW; InterPro: IPR010743 This family consists of several bacterial and one archaeal methionine biosynthesis MetW proteins Back     alignment and domain information
>TIGR00080 pimt protein-L-isoaspartate(D-aspartate) O-methyltransferase Back     alignment and domain information
>PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PRK10258 biotin biosynthesis protein BioC; Provisional Back     alignment and domain information
>PF05175 MTS: Methyltransferase small domain; InterPro: IPR007848 This domain is found in ribosomal RNA small subunit methyltransferase C and in other methyltransferases Back     alignment and domain information
>PRK08317 hypothetical protein; Provisional Back     alignment and domain information
>PRK05785 hypothetical protein; Provisional Back     alignment and domain information
>smart00650 rADc Ribosomal RNA adenine dimethylases Back     alignment and domain information
>PRK15068 tRNA mo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed Back     alignment and domain information
>PF13649 Methyltransf_25: Methyltransferase domain; PDB: 3BXO_B 3GGD_A 3PX2_A 3PX3_A 3PFH_D 3PFG_A 1Y8C_A Back     alignment and domain information
>PRK11207 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional Back     alignment and domain information
>TIGR02081 metW methionine biosynthesis protein MetW Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PRK11088 rrmA 23S rRNA methyltransferase A; Provisional Back     alignment and domain information
>PF13659 Methyltransf_26: Methyltransferase domain; PDB: 3GJY_A 3LPM_B 2NP6_D 1AQI_B 2ADM_B 2IH2_A 2JG3_A 2IBS_D 2NP7_A 2IBT_A Back     alignment and domain information
>PF08241 Methyltransf_11: Methyltransferase domain; InterPro: IPR013216 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PRK14967 putative methyltransferase; Provisional Back     alignment and domain information
>KOG2198 consensus tRNA cytosine-5-methylases and related enzymes of the NOL1/NOP2/sun superfamily [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN02490 MPBQ/MSBQ methyltransferase Back     alignment and domain information
>TIGR03534 RF_mod_PrmC protein-(glutamine-N5) methyltransferase, release factor-specific Back     alignment and domain information
>PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated Back     alignment and domain information
>PRK06202 hypothetical protein; Provisional Back     alignment and domain information
>PRK00050 16S rRNA m(4)C1402 methyltranserfase; Provisional Back     alignment and domain information
>PHA03412 putative methyltransferase; Provisional Back     alignment and domain information
>TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific Back     alignment and domain information
>PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed Back     alignment and domain information
>TIGR00091 tRNA (guanine-N(7)-)-methyltransferase Back     alignment and domain information
>TIGR00477 tehB tellurite resistance protein TehB Back     alignment and domain information
>PRK13943 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PHA03411 putative methyltransferase; Provisional Back     alignment and domain information
>PRK15001 SAM-dependent 23S ribosomal RNA mG1835 methyltransferase; Provisional Back     alignment and domain information
>TIGR00740 methyltransferase, putative Back     alignment and domain information
>PRK03522 rumB 23S rRNA methyluridine methyltransferase; Reviewed Back     alignment and domain information
>PLN02396 hexaprenyldihydroxybenzoate methyltransferase Back     alignment and domain information
>PF01135 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT); InterPro: IPR000682 Protein-L-isoaspartate(D-aspartate) O-methyltransferase (2 Back     alignment and domain information
>PF03848 TehB: Tellurite resistance protein TehB; InterPro: IPR015985 Tellurite resistance protein TehB is part of a tellurite-reducing operon tehA and tehB Back     alignment and domain information
>PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional Back     alignment and domain information
>TIGR00452 methyltransferase, putative Back     alignment and domain information
>PF13489 Methyltransf_23: Methyltransferase domain; PDB: 3JWJ_A 3JWH_B 2AOV_B 2AOT_A 1JQD_B 2AOX_A 1JQE_A 2AOU_B 2AOW_A 3DLI_C Back     alignment and domain information
>PRK15451 tRNA cmo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>COG2263 Predicted RNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed Back     alignment and domain information
>TIGR00536 hemK_fam HemK family putative methylases Back     alignment and domain information
>COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] Back     alignment and domain information
>PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PRK12335 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>TIGR01177 conserved hypothetical protein TIGR01177 Back     alignment and domain information
>PRK00274 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Reviewed Back     alignment and domain information
>PRK06922 hypothetical protein; Provisional Back     alignment and domain information
>PRK14966 unknown domain/N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase fusion protein; Provisional Back     alignment and domain information
>PRK11805 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PRK14896 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Provisional Back     alignment and domain information
>TIGR03704 PrmC_rel_meth putative protein-(glutamine-N5) methyltransferase, unknown substrate-specific Back     alignment and domain information
>TIGR00537 hemK_rel_arch HemK-related putative methylase Back     alignment and domain information
>TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases Back     alignment and domain information
>COG4123 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>TIGR02021 BchM-ChlM magnesium protoporphyrin O-methyltransferase Back     alignment and domain information
>PRK13168 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewed Back     alignment and domain information
>PRK07402 precorrin-6B methylase; Provisional Back     alignment and domain information
>PRK15128 23S rRNA m(5)C1962 methyltransferase; Provisional Back     alignment and domain information
>PRK04457 spermidine synthase; Provisional Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>PRK00811 spermidine synthase; Provisional Back     alignment and domain information
>COG2813 RsmC 16S RNA G1207 methylase RsmC [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK09489 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provisional Back     alignment and domain information
>PTZ00338 dimethyladenosine transferase-like protein; Provisional Back     alignment and domain information
>PRK14968 putative methyltransferase; Provisional Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>smart00828 PKS_MT Methyltransferase in polyketide synthase (PKS) enzymes Back     alignment and domain information
>PRK14121 tRNA (guanine-N(7)-)-methyltransferase; Provisional Back     alignment and domain information
>PRK10909 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional Back     alignment and domain information
>PLN02585 magnesium protoporphyrin IX methyltransferase Back     alignment and domain information
>PRK07580 Mg-protoporphyrin IX methyl transferase; Validated Back     alignment and domain information
>TIGR03840 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te detoxification family Back     alignment and domain information
>COG2890 HemK Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR03438 probable methyltransferase Back     alignment and domain information
>PF08242 Methyltransf_12: Methyltransferase domain; InterPro: IPR013217 Methyl transfer from the ubiquitous donor S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PF05401 NodS: Nodulation protein S (NodS); InterPro: IPR008715 This entry consists of nodulation S (NodS) proteins Back     alignment and domain information
>TIGR00755 ksgA dimethyladenosine transferase Back     alignment and domain information
>PLN03075 nicotianamine synthase; Provisional Back     alignment and domain information
>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional Back     alignment and domain information
>TIGR00406 prmA ribosomal protein L11 methyltransferase Back     alignment and domain information
>cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) Back     alignment and domain information
>TIGR00479 rumA 23S rRNA (uracil-5-)-methyltransferase RumA Back     alignment and domain information
>COG2242 CobL Precorrin-6B methylase 2 [Coenzyme metabolism] Back     alignment and domain information
>KOG1499 consensus Protein arginine N-methyltransferase PRMT1 and related enzymes [Posttranslational modification, protein turnover, chaperones; Transcription; Signal transduction mechanisms] Back     alignment and domain information
>PF06325 PrmA: Ribosomal protein L11 methyltransferase (PrmA); InterPro: IPR010456 This family consists of several Ribosomal protein L11 methyltransferase sequences Back     alignment and domain information
>COG2518 Pcm Protein-L-isoaspartate carboxylmethyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2264 PrmA Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02085 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransferase RumB Back     alignment and domain information
>KOG1270 consensus Methyltransferases [Coenzyme transport and metabolism] Back     alignment and domain information
>PLN02781 Probable caffeoyl-CoA O-methyltransferase Back     alignment and domain information
>KOG3420 consensus Predicted RNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN02366 spermidine synthase Back     alignment and domain information
>COG2519 GCD14 tRNA(1-methyladenosine) methyltransferase and related methyltransferases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1271 consensus Methyltransferases [General function prediction only] Back     alignment and domain information
>smart00138 MeTrc Methyltransferase, chemotaxis proteins Back     alignment and domain information
>TIGR02716 C20_methyl_CrtF C-20 methyltransferase BchU Back     alignment and domain information
>PF09445 Methyltransf_15: RNA cap guanine-N2 methyltransferase; InterPro: IPR019012 RNA cap guanine-N2 methyltransferases such as Schizosaccharomyces pombe (Fission yeast) trimethylguanosine synthase (Tgs1) and Giardia lamblia (Giardia intestinalis) Tgs2, catalyse the methylation step(s) for the conversion of the 7-monomethylguanosine (m(7)G) caps of snRNAs and snoRNAs to a 2,2,7-trimethylguanosine (m(2,2,7)G) cap structure [, , ] Back     alignment and domain information
>KOG0820 consensus Ribosomal RNA adenine dimethylase [RNA processing and modification] Back     alignment and domain information
>COG0030 KsgA Dimethyladenosine transferase (rRNA methylation) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF01269 Fibrillarin: Fibrillarin; InterPro: IPR000692 Fibrillarin is a component of a nucleolar small nuclear ribonucleoprotein (SnRNP), functioning in vivo in ribosomal RNA processing [, ] Back     alignment and domain information
>PRK13255 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>PF10672 Methyltrans_SAM: S-adenosylmethionine-dependent methyltransferase; InterPro: IPR019614 Members of this entry are S-adenosylmethionine-dependent methyltransferases from gamma-proteobacterial species Back     alignment and domain information
>TIGR00417 speE spermidine synthase Back     alignment and domain information
>PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed Back     alignment and domain information
>PF08704 GCD14: tRNA methyltransferase complex GCD14 subunit; InterPro: IPR014816 GCD14 is a subunit of the tRNA methyltransferase complex and is required for 1-methyladenosine modification and maturation of initiator methionyl-tRNA [] Back     alignment and domain information
>TIGR00095 RNA methyltransferase, RsmD family Back     alignment and domain information
>PLN02476 O-methyltransferase Back     alignment and domain information
>COG3963 Phospholipid N-methyltransferase [Lipid metabolism] Back     alignment and domain information
>PRK05134 bifunctional 3-demethylubiquinone-9 3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol methylase; Provisional Back     alignment and domain information
>TIGR01983 UbiG ubiquinone biosynthesis O-methyltransferase Back     alignment and domain information
>COG1092 Predicted SAM-dependent methyltransferases [General function prediction only] Back     alignment and domain information
>PLN02672 methionine S-methyltransferase Back     alignment and domain information
>PRK05031 tRNA (uracil-5-)-methyltransferase; Validated Back     alignment and domain information
>PF02390 Methyltransf_4: Putative methyltransferase ; InterPro: IPR003358 This entry represents tRNA (guanine-N-7) methyltransferase (2 Back     alignment and domain information
>PRK03612 spermidine synthase; Provisional Back     alignment and domain information
>PF08003 Methyltransf_9: Protein of unknown function (DUF1698); InterPro: IPR010017 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PRK11727 23S rRNA mA1618 methyltransferase; Provisional Back     alignment and domain information
>PF01596 Methyltransf_3: O-methyltransferase; InterPro: IPR002935 Members of this family are O-methyltransferases Back     alignment and domain information
>TIGR02143 trmA_only tRNA (uracil-5-)-methyltransferase Back     alignment and domain information
>PF02475 Met_10: Met-10+ like-protein; InterPro: IPR003402 This entry represents the Trm5 family Back     alignment and domain information
>PF05185 PRMT5: PRMT5 arginine-N-methyltransferase; InterPro: IPR007857 The human homologue of Saccharomyces cerevisiae Skb1 (Shk1 kinase-binding protein 1) is a protein methyltransferase [] Back     alignment and domain information
>KOG3674 consensus FtsJ-like RNA methyltransferase [RNA processing and modification] Back     alignment and domain information
>PF00398 RrnaAD: Ribosomal RNA adenine dimethylase; InterPro: IPR001737 This family of proteins include rRNA adenine dimethylases (e Back     alignment and domain information
>PF01170 UPF0020: Putative RNA methylase family UPF0020; InterPro: IPR000241 This domain is probably a methylase Back     alignment and domain information
>KOG1500 consensus Protein arginine N-methyltransferase CARM1 [Posttranslational modification, protein turnover, chaperones; Transcription] Back     alignment and domain information
>COG2521 Predicted archaeal methyltransferase [General function prediction only] Back     alignment and domain information
>KOG3010 consensus Methyltransferase [General function prediction only] Back     alignment and domain information
>COG1889 NOP1 Fibrillarin-like rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF08123 DOT1: Histone methylation protein DOT1 ; InterPro: IPR013110 The DOT1 domain regulates gene expression by methylating histone H3 [] Back     alignment and domain information
>PRK01581 speE spermidine synthase; Validated Back     alignment and domain information
>KOG1541 consensus Predicted protein carboxyl methylase [General function prediction only] Back     alignment and domain information
>KOG1540 consensus Ubiquinone biosynthesis methyltransferase COQ5 [Coenzyme transport and metabolism] Back     alignment and domain information
>PF03602 Cons_hypoth95: Conserved hypothetical protein 95; InterPro: IPR004398 This entry contains Ribosomal RNA small subunit methyltransferase D as well as the putative rRNA methyltransferase YlbH Back     alignment and domain information
>PRK04338 N(2),N(2)-dimethylguanosine tRNA methyltransferase; Provisional Back     alignment and domain information
>TIGR00006 S-adenosyl-methyltransferase MraW Back     alignment and domain information
>KOG2904 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PRK13256 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>KOG3191 consensus Predicted N6-DNA-methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG2265 TrmA SAM-dependent methyltransferases related to tRNA (uracil-5-)-methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF05724 TPMT: Thiopurine S-methyltransferase (TPMT); InterPro: IPR008854 This family consists of thiopurine S-methyltransferase proteins from both eukaryotes and prokaryotes Back     alignment and domain information
>PF04989 CmcI: Cephalosporin hydroxylase; InterPro: IPR007072 This entry contains Rhamnosyl O-methyltransferase which catalyses the O-methylation of the hydroxyl group located on C-2 of the first rhamnosyl residue linked to the phenolic group of glycosylated phenolphthiocerol dimycocerosates (PGL) and p-hydroxybenzoic acid derivatives (p-HBAD) [] Back     alignment and domain information
>PF00891 Methyltransf_2: O-methyltransferase; InterPro: IPR001077 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PF05958 tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferase; InterPro: IPR010280 This family consists of (uracil-5-)-methyltransferases 2 Back     alignment and domain information
>COG4076 Predicted RNA methylase [General function prediction only] Back     alignment and domain information
>TIGR01444 fkbM_fam methyltransferase, FkbM family Back     alignment and domain information
>PF03291 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 This is a family of viral mRNA capping enzymes Back     alignment and domain information
>COG0421 SpeE Spermidine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>COG0742 N6-adenine-specific methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG1975 consensus mRNA cap methyltransferase [RNA processing and modification] Back     alignment and domain information
>PF10294 Methyltransf_16: Putative methyltransferase; InterPro: IPR019410 There are a number of unidentified genes that have a high probability of coding for methyltransferases Back     alignment and domain information
>KOG2360 consensus Proliferation-associated nucleolar protein (NOL1) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2730 consensus Methylase [General function prediction only] Back     alignment and domain information
>PF02384 N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 This domain is fpound in N-6 adenine-specific DNA methylase (2 Back     alignment and domain information
>KOG2187 consensus tRNA uracil-5-methyltransferase and related tRNA-modifying enzymes [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1596 consensus Fibrillarin and related nucleolar RNA-binding proteins [RNA processing and modification] Back     alignment and domain information
>COG4122 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>COG0220 Predicted S-adenosylmethionine-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>PLN02589 caffeoyl-CoA O-methyltransferase Back     alignment and domain information
>KOG2915 consensus tRNA(1-methyladenosine) methyltransferase, subunit GCD14 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG4300 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>PF12147 Methyltransf_20: Putative methyltransferase; InterPro: IPR022744 This C-terminal region is found in bacteria and eukaryotes and is approximately 110 amino acids in length Back     alignment and domain information
>COG1041 Predicted DNA modification methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF05148 Methyltransf_8: Hypothetical methyltransferase; InterPro: IPR007823 This family consists of uncharacterised eukaryotic proteins which are related to S-adenosyl-L-methionine-dependent methyltransferases Back     alignment and domain information
>PF13679 Methyltransf_32: Methyltransferase domain Back     alignment and domain information
>PLN02823 spermine synthase Back     alignment and domain information
>KOG1663 consensus O-methyltransferase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>TIGR03439 methyl_EasF probable methyltransferase domain, EasF family Back     alignment and domain information
>PF01795 Methyltransf_5: MraW methylase family; InterPro: IPR002903 This is a family of S-adenosyl-L-methionine-dependent methyltransferases, which are found primarily, though not exclusively, in bacteria Back     alignment and domain information
>COG2520 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PF05219 DREV: DREV methyltransferase; InterPro: IPR007884 This family contains DREV protein homologues from several eukaryotes Back     alignment and domain information
>KOG2361 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>TIGR00308 TRM1 tRNA(guanine-26,N2-N2) methyltransferase Back     alignment and domain information
>PF13578 Methyltransf_24: Methyltransferase domain; PDB: 3SSO_A 3SSN_C 3SSM_D Back     alignment and domain information
>PRK10742 putative methyltransferase; Provisional Back     alignment and domain information
>PF02527 GidB: rRNA small subunit methyltransferase G; InterPro: IPR003682 This entry represents a rRNA small subunit methyltransferase G Back     alignment and domain information
>COG0275 Predicted S-adenosylmethionine-dependent methyltransferase involved in cell envelope biogenesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF05206 TRM13: Methyltransferase TRM13; InterPro: IPR007871 This entry consists of eukaryotic and bacterial proteins that specifically methylates guanosine-4 in various tRNAs with a Gly(CCG), His or Pro signatures [] Back     alignment and domain information
>COG0357 GidB Predicted S-adenosylmethionine-dependent methyltransferase involved in bacterial cell division [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF01564 Spermine_synth: Spermine/spermidine synthase; InterPro: IPR001045 Synonym(s): Spermidine aminopropyltransferase A group of polyamine biosynthetic enzymes involved in the fifth (last) step in the biosynthesis of spermidine from arginine and methionine which includes; spermidine synthase (2 Back     alignment and domain information
>PF09243 Rsm22: Mitochondrial small ribosomal subunit Rsm22; InterPro: IPR015324 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>KOG3045 consensus Predicted RNA methylase involved in rRNA processing [RNA processing and modification] Back     alignment and domain information
>COG3897 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional Back     alignment and domain information
>KOG2940 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>cd00315 Cyt_C5_DNA_methylase Cytosine-C5 specific DNA methylases; Methyl transfer reactions play an important role in many aspects of biology Back     alignment and domain information
>KOG2899 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>KOG1661 consensus Protein-L-isoaspartate(D-aspartate) O-methyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1255 Uncharacterized protein conserved in archaea [Function unknown] Back     alignment and domain information
>PRK06179 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase Back     alignment and domain information
>PF04672 Methyltransf_19: S-adenosyl methyltransferase; InterPro: IPR006764 This is a family of uncharacterised proteins Back     alignment and domain information
>PRK08177 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF00145 DNA_methylase: C-5 cytosine-specific DNA methylase; InterPro: IPR001525 C-5 cytosine-specific DNA methylases (2 Back     alignment and domain information
>KOG2651 consensus rRNA adenine N-6-methyltransferase [RNA processing and modification] Back     alignment and domain information
>KOG3115 consensus Methyltransferase-like protein [General function prediction only] Back     alignment and domain information
>COG0500 SmtA SAM-dependent methyltransferases [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information
>PHA01634 hypothetical protein Back     alignment and domain information
>PF03686 UPF0146: Uncharacterised protein family (UPF0146); InterPro: IPR005353 The function of this family of proteins is unknown Back     alignment and domain information
>PLN02662 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>COG3510 CmcI Cephalosporin hydroxylase [Defense mechanisms] Back     alignment and domain information
>PF03141 Methyltransf_29: Putative S-adenosyl-L-methionine-dependent methyltransferase; InterPro: IPR004159 Members of this family of hypothetical plant proteins are putative methyltransferases Back     alignment and domain information
>PLN02695 GDP-D-mannose-3',5'-epimerase Back     alignment and domain information
>PRK06398 aldose dehydrogenase; Validated Back     alignment and domain information
>KOG0024 consensus Sorbitol dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK06196 oxidoreductase; Provisional Back     alignment and domain information
>PF06460 NSP13: Coronavirus NSP13; InterPro: IPR009461 This domain covers the NSP13 region of the coronavirus polyprotein Back     alignment and domain information
>PRK05993 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG2671 consensus Putative RNA methylase [Replication, recombination and repair] Back     alignment and domain information
>TIGR02987 met_A_Alw26 type II restriction m6 adenine DNA methyltransferase, Alw26I/Eco31I/Esp3I family Back     alignment and domain information
>COG4798 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>cd08283 FDH_like_1 Glutathione-dependent formaldehyde dehydrogenase related proteins, child 1 Back     alignment and domain information
>TIGR00675 dcm DNA-methyltransferase (dcm) Back     alignment and domain information
>PRK06523 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1209 consensus 1-Acyl dihydroxyacetone phosphate reductase and related dehydrogenases [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK06953 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF04816 DUF633: Family of unknown function (DUF633) ; InterPro: IPR006901 This is a family of uncharacterised bacterial proteins Back     alignment and domain information
>COG0116 Predicted N6-adenine-specific DNA methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR02622 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase Back     alignment and domain information
>PF06080 DUF938: Protein of unknown function (DUF938); InterPro: IPR010342 This family consists of several hypothetical proteins from both prokaryotes and eukaryotes Back     alignment and domain information
>PRK07533 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07454 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12748 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08264 short chain dehydrogenase; Validated Back     alignment and domain information
>COG0286 HsdM Type I restriction-modification system methyltransferase subunit [Defense mechanisms] Back     alignment and domain information
>PF11968 DUF3321: Putative methyltransferase (DUF3321); InterPro: IPR021867 This family is conserved in fungi and is annotated as being a nucleolar protein Back     alignment and domain information
>PF07091 FmrO: Ribosomal RNA methyltransferase (FmrO); PDB: 3LCU_A 3LCV_B 3FRH_A 3FRI_A 3B89_A 3FZG_A Back     alignment and domain information
>COG0270 Dcm Site-specific DNA methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>PHA03108 poly(A) polymerase small subunit; Provisional Back     alignment and domain information
>PF01073 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/isomerase family; InterPro: IPR002225 The enzyme 3 beta-hydroxysteroid dehydrogenase/5-ene-4-ene isomerase (3 beta-HSD) catalyses the oxidation and isomerisation of 5-ene-3 beta-hydroxypregnene and 5-ene-hydroxyandrostene steroid precursors into the corresponding 4-ene-ketosteroids necessary for the formation of all classes of steroid hormones Back     alignment and domain information
>PLN02989 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus Back     alignment and domain information
>PRK00536 speE spermidine synthase; Provisional Back     alignment and domain information
>PRK06182 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK07326 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09072 short chain dehydrogenase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query179
2nyu_A196 Crystal Structure Of Human Ftsj Homolog 2 (E.Coli) 2e-16
1eiz_A180 Ftsj Rna Methyltransferase Complexed With S- Adenos 4e-11
2plw_A201 Crystal Structure Of A Ribosomal Rna Methyltransfer 3e-06
3dou_A191 Crystal Structure Of Methyltransferase Involved In 7e-05
>pdb|2NYU|A Chain A, Crystal Structure Of Human Ftsj Homolog 2 (E.Coli) Protein In Complex With S-Adenosylmethionine Length = 196 Back     alignment and structure

Iteration: 1

Score = 81.6 bits (200), Expect = 2e-16, Method: Compositional matrix adjust. Identities = 45/120 (37%), Positives = 72/120 (60%), Gaps = 5/120 (4%) Query: 21 WRARSAFKLLQIDEEFNIFEGVKRVVDLCAAPGSWSQVLSRKLYLPAKLSPDSREGDLPL 80 +R+RSAFKLL+++E I RV+D AAPG+WSQV +K+ A P S G Sbjct: 2 YRSRSAFKLLEVNERHQILRPGLRVLDCGAAPGAWSQVAVQKVNA-AGTDPSSPVG---F 57 Query: 81 IVAIDLQPMAPIEGVIQV-QGDITNARTAEVVIRHFDGCKADLVVCDGAPDVTGLHDMDE 139 ++ +DL + P+EG + D+T+ RT++ ++ G +AD+++ D AP+ TG D+D Sbjct: 58 VLGVDLLHIFPLEGATFLCPADVTDPRTSQRILEVLPGRRADVILSDMAPNATGFRDLDH 117
>pdb|1EIZ|A Chain A, Ftsj Rna Methyltransferase Complexed With S- Adenosylmethionine Length = 180 Back     alignment and structure
>pdb|2PLW|A Chain A, Crystal Structure Of A Ribosomal Rna Methyltransferase, Putative, From Plasmodium Falciparum (Pf13_0052) Length = 201 Back     alignment and structure
>pdb|3DOU|A Chain A, Crystal Structure Of Methyltransferase Involved In Cell Division From Thermoplasma Volcanicum Gss1 Length = 191 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query179
2nyu_A196 Putative ribosomal RNA methyltransferase 2; SAM, s 4e-62
1ej0_A180 FTSJ; methyltransferase, adoMet, adenosyl methioni 9e-62
3dou_A191 Ribosomal RNA large subunit methyltransferase J; c 1e-58
2plw_A201 Ribosomal RNA methyltransferase, putative; malaria 2e-54
3evf_A277 RNA-directed RNA polymerase NS5; NS5 methyltransfe 7e-27
3eld_A300 Methyltransferase; flavivirus, RNA capping, guanyl 6e-18
4auk_A375 Ribosomal RNA large subunit methyltransferase M; Y 2e-10
>2nyu_A Putative ribosomal RNA methyltransferase 2; SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.76A {Homo sapiens} Length = 196 Back     alignment and structure
 Score =  189 bits (483), Expect = 4e-62
 Identities = 43/130 (33%), Positives = 70/130 (53%), Gaps = 5/130 (3%)

Query: 21  WRARSAFKLLQIDEEFNIFEGVKRVVDLCAAPGSWSQVLSRKLYLPAKLSPDSREGDLPL 80
           +R+RSAFKLL+++E   I     RV+D  AAPG+WSQV  +K+                 
Sbjct: 2   YRSRSAFKLLEVNERHQILRPGLRVLDCGAAPGAWSQVAVQKVNAAGTDPSSPV----GF 57

Query: 81  IVAIDLQPMAPIEGVIQ-VQGDITNARTAEVVIRHFDGCKADLVVCDGAPDVTGLHDMDE 139
           ++ +DL  + P+EG       D+T+ RT++ ++    G +AD+++ D AP+ TG  D+D 
Sbjct: 58  VLGVDLLHIFPLEGATFLCPADVTDPRTSQRILEVLPGRRADVILSDMAPNATGFRDLDH 117

Query: 140 FVQSQLILAV 149
                L L +
Sbjct: 118 DRLISLCLTL 127


>1ej0_A FTSJ; methyltransferase, adoMet, adenosyl methionine, heat shock proteins, 23S ribosomal RNA; HET: SAM; 1.50A {Escherichia coli} SCOP: c.66.1.2 PDB: 1eiz_A* Length = 180 Back     alignment and structure
>3dou_A Ribosomal RNA large subunit methyltransferase J; cell division, structural genomics, protein structure initiative, PSI; HET: SAM; 1.45A {Thermoplasma volcanium} Length = 191 Back     alignment and structure
>2plw_A Ribosomal RNA methyltransferase, putative; malaria, SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Plasmodium falciparum} Length = 201 Back     alignment and structure
>3evf_A RNA-directed RNA polymerase NS5; NS5 methyltransferase, RNA CAP binding, binding, capsid protein; HET: GTA SAH; 1.45A {Yellow fever virus} PDB: 3evb_A* 3evc_A* 3evd_A* 3eve_A* 3eva_A* Length = 277 Back     alignment and structure
>3eld_A Methyltransferase; flavivirus, RNA capping, guanylyltransfer viral enzyme structure; HET: SFG; 1.90A {Wesselsbron virus} PDB: 3elu_A* 3elw_A* 3ely_A* 3emb_A* 3emd_A* Length = 300 Back     alignment and structure
>4auk_A Ribosomal RNA large subunit methyltransferase M; YGDE; HET: TLA PGE; 1.90A {Escherichia coli} PDB: 4atn_A* 4b17_A* Length = 375 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query179
3dou_A191 Ribosomal RNA large subunit methyltransferase J; c 99.97
2px2_A269 Genome polyprotein [contains: capsid protein C (co 99.95
3gcz_A282 Polyprotein; flavivirus, RNA capping, methyltransf 99.92
3evf_A277 RNA-directed RNA polymerase NS5; NS5 methyltransfe 99.91
2plw_A201 Ribosomal RNA methyltransferase, putative; malaria 99.9
3eld_A300 Methyltransferase; flavivirus, RNA capping, guanyl 99.9
2nyu_A196 Putative ribosomal RNA methyltransferase 2; SAM, s 99.89
3p8z_A267 Mtase, non-structural protein 5; methyltransferase 99.88
2oxt_A265 Nucleoside-2'-O-methyltransferase; flavivirus, vir 99.81
4auk_A375 Ribosomal RNA large subunit methyltransferase M; Y 99.78
2p41_A305 Type II methyltransferase; vizier, viral enzymes i 99.77
3lkz_A321 Non-structural protein 5; flavivirus, methyltransf 99.77
1ej0_A180 FTSJ; methyltransferase, adoMet, adenosyl methioni 99.77
2wa2_A276 Non-structural protein 5; transferase, S-adenosyl- 99.75
3r24_A344 NSP16, 2'-O-methyl transferase; methyltransferase, 99.53
3id6_C232 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 99.36
2xyq_A290 Putative 2'-O-methyl transferase; transferase-vira 99.29
3hp7_A291 Hemolysin, putative; structural genomics, APC64019 99.27
4df3_A233 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 99.13
1ixk_A315 Methyltransferase; open beta sheet; 1.90A {Pyrococ 99.1
2frx_A 479 Hypothetical protein YEBU; rossmann-type S-adenosy 99.07
3m4x_A 456 NOL1/NOP2/SUN family protein; mtase domain, PUA do 99.05
2b9e_A309 NOL1/NOP2/SUN domain family, member 5 isoform 2; m 99.05
2ipx_A233 RRNA 2'-O-methyltransferase fibrillarin; FBL, stru 99.03
3ajd_A274 Putative methyltransferase MJ0026; tRNA, M5C, ross 99.0
3m6w_A 464 RRNA methylase; rRNA methyltransferase, 5-methylcy 98.99
2yxl_A450 PH0851 protein, 450AA long hypothetical FMU protei 98.95
1nt2_A210 Fibrillarin-like PRE-rRNA processing protein; adeM 98.94
3eey_A197 Putative rRNA methylase; rRNA methylation, S-adeno 98.93
4hg2_A257 Methyltransferase type 11; structural genomics, PS 98.92
3opn_A232 Putative hemolysin; structural genomics, PSI-2, pr 98.9
4fzv_A359 Putative methyltransferase NSUN4; mterf fold, meth 98.89
1sqg_A429 SUN protein, FMU protein; rossmann-fold, mixed bet 98.88
3mgg_A 276 Methyltransferase; NYSGXRC, PSI-II, protein struct 98.87
4gek_A261 TRNA (CMO5U34)-methyltransferase; structural genom 98.85
3ege_A 261 Putative methyltransferase from antibiotic biosyn 98.85
3mti_A185 RRNA methylase; SAM-dependent, PSI, MCSG, structur 98.84
3dh0_A219 SAM dependent methyltransferase; cystal structure, 98.83
3f4k_A257 Putative methyltransferase; structural genomics, P 98.82
3ujc_A266 Phosphoethanolamine N-methyltransferase; parasite; 98.82
1fbn_A230 MJ fibrillarin homologue; MJ proteins, ribosomal R 98.82
3fpf_A298 Mtnas, putative uncharacterized protein; thermonic 98.82
1vl5_A260 Unknown conserved protein BH2331; putative methylt 98.82
1g8a_A227 Fibrillarin-like PRE-rRNA processing protein; rRNA 98.81
2fca_A213 TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bac 98.8
3ou2_A218 SAM-dependent methyltransferase; O-methyltransfera 98.79
3kkz_A267 Uncharacterized protein Q5LES9; putative methyltra 98.79
3hem_A 302 Cyclopropane-fatty-acyl-phospholipid synthase 2; p 98.78
2bm8_A236 Cephalosporin hydroxylase CMCI; cephamycin biosynt 98.77
3lpm_A259 Putative methyltransferase; structural genomics, p 98.77
3p9n_A189 Possible methyltransferase (methylase); RV2966C, a 98.77
3bkx_A275 SAM-dependent methyltransferase; YP_807781.1, cycl 98.76
3dtn_A234 Putative methyltransferase MM_2633; structural gen 98.76
3dli_A240 Methyltransferase; PSI-II, NYSGXRC, structural gen 98.75
1yzh_A214 TRNA (guanine-N(7)-)-methyltransferase; alpha-beta 98.74
3e05_A204 Precorrin-6Y C5,15-methyltransferase (decarboxyla; 98.74
3h2b_A203 SAM-dependent methyltransferase; alpha-beta protei 98.74
1pjz_A203 Thiopurine S-methyltransferase; polymorphism, S-ad 98.73
3evz_A230 Methyltransferase; NYSGXRC, NEW YORK SGX research 98.73
4dzr_A215 Protein-(glutamine-N5) methyltransferase, release 98.73
3q87_B170 N6 adenine specific DNA methylase; SAM-methyltrans 98.73
3mb5_A255 SAM-dependent methyltransferase; RNA methyltransfe 98.73
3hnr_A220 Probable methyltransferase BT9727_4108; structural 98.73
3g5t_A 299 Trans-aconitate 3-methyltransferase; structural ge 98.72
3m33_A226 Uncharacterized protein; structural genomics, PSI- 98.71
3lbf_A210 Protein-L-isoaspartate O-methyltransferase; modifi 98.71
3gdh_A241 Trimethylguanosine synthase homolog; M7G, CAP, dim 98.71
3a27_A272 TYW2, uncharacterized protein MJ1557; wybutosine m 98.7
3gru_A 295 Dimethyladenosine transferase; rossman fold, ribos 98.7
3l8d_A242 Methyltransferase; structural genomics, PSI, nysgr 98.7
4fsd_A 383 Arsenic methyltransferase; rossmann fold; 1.75A {C 98.69
2frn_A278 Hypothetical protein PH0793; structural genomics, 98.69
3g5l_A253 Putative S-adenosylmethionine dependent methyltran 98.69
1nkv_A256 Hypothetical protein YJHP; structural genomics, PS 98.69
1ri5_A 298 MRNA capping enzyme; methyltransferase, M7G, messe 98.69
3vc1_A312 Geranyl diphosphate 2-C-methyltransferase; rossman 98.68
1xdz_A240 Methyltransferase GIDB; MCSG, protein structure in 98.68
1i1n_A226 Protein-L-isoaspartate O-methyltransferase; S-aden 98.68
2esr_A177 Methyltransferase; structural genomics, hypothetic 98.68
3njr_A204 Precorrin-6Y methylase; methyltransferase, decarbo 98.68
2gb4_A252 Thiopurine S-methyltransferase; 18204406, thiopuri 98.68
3bus_A273 REBM, methyltransferase; rebeccamycin synthesis; H 98.67
3dlc_A219 Putative S-adenosyl-L-methionine-dependent methylt 98.67
2yqz_A263 Hypothetical protein TTHA0223; RNA methyltransfera 98.67
3sso_A419 Methyltransferase; macrolide, natural product, ros 98.67
2ozv_A260 Hypothetical protein ATU0636; structural genomics, 98.67
2ift_A201 Putative methylase HI0767; NESG, Y767_haein, struc 98.66
2pxx_A215 Uncharacterized protein MGC2408; structural genomi 98.66
3q7e_A 349 Protein arginine N-methyltransferase 1; HET: SAH; 98.66
1dl5_A 317 Protein-L-isoaspartate O-methyltransferase; isoasp 98.66
2p7i_A250 Hypothetical protein; putative methyltransferase, 98.66
2xvm_A199 Tellurite resistance protein TEHB; antibiotic resi 98.66
2yxd_A183 Probable cobalt-precorrin-6Y C(15)-methyltransfer 98.65
1wy7_A207 Hypothetical protein PH1948; seven-stranded beta s 98.65
3u81_A221 Catechol O-methyltransferase; neurotransmitter deg 98.65
3ofk_A216 Nodulation protein S; NODS, N-methyltransferase, S 98.65
1yb2_A275 Hypothetical protein TA0852; structural genomics, 98.65
3gu3_A 284 Methyltransferase; alpha-beta protein, structural 98.65
1kpg_A287 CFA synthase;, cyclopropane-fatty-acyl-phospholipi 98.65
1jsx_A207 Glucose-inhibited division protein B; methyltransf 98.65
1zx0_A236 Guanidinoacetate N-methyltransferase; structural g 98.64
2fpo_A202 Methylase YHHF; structural genomics, putative meth 98.64
3mq2_A218 16S rRNA methyltransferase; methyltranferase, ribo 98.64
3bkw_A243 MLL3908 protein, S-adenosylmethionine dependent me 98.64
3dxy_A218 TRNA (guanine-N(7)-)-methyltransferase; rossmann f 98.63
3e8s_A227 Putative SAM dependent methyltransferase; NP_74470 98.63
1xxl_A239 YCGJ protein; structural genomics, protein structu 98.63
3jwh_A217 HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena 98.63
1ne2_A200 Hypothetical protein TA1320; structural genomics, 98.63
3ggd_A245 SAM-dependent methyltransferase; YP_325210.1, stru 98.63
1m6y_A 301 S-adenosyl-methyltransferase MRAW; SAM-dependent m 98.63
3hm2_A178 Precorrin-6Y C5,15-methyltransferase; alpha-beta-s 98.63
2o57_A297 Putative sarcosine dimethylglycine methyltransfera 98.62
2b3t_A276 Protein methyltransferase HEMK; translation termin 98.62
3r3h_A242 O-methyltransferase, SAM-dependent; structural gen 98.62
3cgg_A195 SAM-dependent methyltransferase; NP_600671.1, meth 98.61
2p35_A 259 Trans-aconitate 2-methyltransferase; SAM dependent 98.61
3dr5_A221 Putative O-methyltransferase; Q8NRD3, CGL1119, PF0 98.61
3duw_A223 OMT, O-methyltransferase, putative; alternating of 98.61
2b25_A336 Hypothetical protein; structural genomics, methyl 98.61
2fyt_A 340 Protein arginine N-methyltransferase 3; structural 98.6
2pwy_A258 TRNA (adenine-N(1)-)-methyltransferase; mtase, ado 98.6
3jwg_A219 HEN1, methyltransferase type 12; 1.90A {Clostridiu 98.6
3e23_A211 Uncharacterized protein RPA2492; alpha-beta protei 98.6
1dus_A194 MJ0882; hypothetical protein, methanococcus jannas 98.59
3tfw_A248 Putative O-methyltransferase; PSI-biology, nysgrc, 98.59
1ve3_A227 Hypothetical protein PH0226; dimer, riken structur 98.59
3grz_A205 L11 mtase, ribosomal protein L11 methyltransferase 98.58
2vdv_E246 TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl 98.58
1i9g_A280 Hypothetical protein RV2118C; mtase, adoMet, cryst 98.57
1p91_A269 Ribosomal RNA large subunit methyltransferase A; R 98.57
3ntv_A232 MW1564 protein; rossmann fold, putative methyltran 98.56
3g89_A249 Ribosomal RNA small subunit methyltransferase G; 1 98.56
1xtp_A254 LMAJ004091AAA; SGPP, structural genomics, PSI, pro 98.56
3g07_A 292 7SK snRNA methylphosphate capping enzyme; structur 98.56
4htf_A285 S-adenosylmethionine-dependent methyltransferase; 98.56
2h00_A254 Methyltransferase 10 domain containing protein; st 98.55
3r0q_C 376 Probable protein arginine N-methyltransferase 4.2; 98.55
3m70_A286 Tellurite resistance protein TEHB homolog; structu 98.55
2fk8_A 318 Methoxy mycolic acid synthase 4; S-adenosylmethion 98.55
1inl_A296 Spermidine synthase; beta-barrel, rossman fold, st 98.54
3tr6_A225 O-methyltransferase; cellular processes; HET: SAH; 98.54
2fhp_A187 Methylase, putative; alpha-beta-alpha sandwich, st 98.54
3tma_A354 Methyltransferase; thump domain; 2.05A {Thermus th 98.54
3ccf_A 279 Cyclopropane-fatty-acyl-phospholipid synthase; YP_ 98.53
3pfg_A263 N-methyltransferase; N,N-dimethyltransferase, SAM 98.53
2pbf_A227 Protein-L-isoaspartate O-methyltransferase beta-A 98.52
3orh_A236 Guanidinoacetate N-methyltransferase; structura ge 98.52
3p2e_A225 16S rRNA methylase; methyltransferase, transferase 98.51
1o54_A277 SAM-dependent O-methyltransferase; TM0748, structu 98.51
2yxe_A215 Protein-L-isoaspartate O-methyltransferase; rossma 98.51
3k6r_A278 Putative transferase PH0793; structural genomics, 98.5
1g6q_1 328 HnRNP arginine N-methyltransferase; SAM-binding do 98.5
4hc4_A 376 Protein arginine N-methyltransferase 6; HRMT1L6, S 98.5
4dcm_A375 Ribosomal RNA large subunit methyltransferase G; 2 98.49
1wzn_A252 SAM-dependent methyltransferase; structural genomi 98.49
2ih2_A 421 Modification methylase TAQI; DNA, DNA methyltransf 98.48
3ckk_A235 TRNA (guanine-N(7)-)-methyltransferase; mettl1, S- 98.48
3adn_A294 Spermidine synthase; aminopropyltransferase, polya 98.48
3sm3_A235 SAM-dependent methyltransferases; NESG, structural 98.48
2ex4_A241 Adrenal gland protein AD-003; methyltransferase, s 98.48
3bxo_A239 N,N-dimethyltransferase; desosamine, sugar, carboh 98.47
1vbf_A231 231AA long hypothetical protein-L-isoaspartate O- 98.47
1ws6_A171 Methyltransferase; structural genomics, riken stru 98.46
2y1w_A 348 Histone-arginine methyltransferase CARM1; histone 98.46
2h1r_A 299 Dimethyladenosine transferase, putative; SGC toron 98.46
2p8j_A209 S-adenosylmethionine-dependent methyltransferase; 98.45
3gjy_A317 Spermidine synthase; APC62791, structural genomics 98.45
2zfu_A215 Nucleomethylin, cerebral protein 1; nucleolar prot 98.45
4azs_A 569 Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 98.45
2kw5_A202 SLR1183 protein; structural genomics, northeast st 98.45
3dmg_A381 Probable ribosomal RNA small subunit methyltransf; 98.43
1zq9_A 285 Probable dimethyladenosine transferase; SGC, struc 98.43
3i9f_A170 Putative type 11 methyltransferase; structural gen 98.42
3ocj_A305 Putative exported protein; structural genomics, PS 98.42
3uwp_A 438 Histone-lysine N-methyltransferase, H3 lysine-79; 98.42
1nv8_A284 HEMK protein; class I adoMet-dependent methyltrans 98.42
1r18_A227 Protein-L-isoaspartate(D-aspartate)-O-methyltrans; 98.41
3gnl_A244 Uncharacterized protein, DUF633, LMOF2365_1472; st 98.41
3lcc_A235 Putative methyl chloride transferase; halide methy 98.41
3lec_A230 NADB-rossmann superfamily protein; PSI, MCSG, stru 98.41
3tm4_A373 TRNA (guanine N2-)-methyltransferase TRM14; rossma 98.41
4dmg_A393 Putative uncharacterized protein TTHA1493; rRNA, m 98.4
1l3i_A192 Precorrin-6Y methyltransferase/putative decarboxyl 98.39
1fp1_D372 Isoliquiritigenin 2'-O-methyltransferase; protein- 98.39
1qam_A244 ERMC' methyltransferase; rRNA methyltransferase ER 98.39
3kr9_A225 SAM-dependent methyltransferase; class I rossmann- 98.38
3fut_A 271 Dimethyladenosine transferase; methyltransferase, 98.38
2gs9_A211 Hypothetical protein TT1324; methyl transferase, s 98.38
1jg1_A235 PIMT;, protein-L-isoaspartate O-methyltransferase; 98.38
2yvl_A248 TRMI protein, hypothetical protein; tRNA, methyltr 98.38
1yub_A245 Ermam, rRNA methyltransferase; MLS antibiotics; NM 98.38
2gpy_A233 O-methyltransferase; structural genomics, PSI, pro 98.37
2b78_A385 Hypothetical protein SMU.776; structure genomics, 98.37
2nxc_A254 L11 mtase, ribosomal protein L11 methyltransferase 98.37
2avd_A229 Catechol-O-methyltransferase; structural genomics, 98.37
2igt_A332 SAM dependent methyltransferase; alpha-beta sandwi 98.36
3tqs_A255 Ribosomal RNA small subunit methyltransferase A; p 98.36
1uwv_A433 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA m 98.35
3c0k_A396 UPF0064 protein YCCW; PUA domain, adoMet dependent 98.35
3c3y_A237 Pfomt, O-methyltransferase; plant secondary metabo 98.35
3iv6_A261 Putative Zn-dependent alcohol dehydrogenase; alpha 98.35
1sui_A247 Caffeoyl-COA O-methyltransferase; rossmann fold, p 98.34
3v97_A703 Ribosomal RNA large subunit methyltransferase L; Y 98.34
2qe6_A274 Uncharacterized protein TFU_2867; putative methylt 98.33
2vdw_A 302 Vaccinia virus capping enzyme D1 subunit; nucleoti 98.33
2hnk_A239 SAM-dependent O-methyltransferase; modified rossma 98.31
1wxx_A382 TT1595, hypothetical protein TTHA1280; thermus the 98.31
3d2l_A243 SAM-dependent methyltransferase; ZP_00538691.1, st 98.29
3cc8_A230 Putative methyltransferase; structural genomics, j 98.29
2i7c_A283 Spermidine synthase; transferase, structural genom 98.28
1xj5_A334 Spermidine synthase 1; structural genomics, protei 98.28
1y8c_A246 S-adenosylmethionine-dependent methyltransferase; 98.28
2avn_A260 Ubiquinone/menaquinone biosynthesis methyltransfe 98.28
3c3p_A210 Methyltransferase; NP_951602.1, structural genomic 98.27
2pt6_A321 Spermidine synthase; transferase, structural genom 98.27
3bwc_A304 Spermidine synthase; SAM, SGPP, structura genomics 98.27
3thr_A 293 Glycine N-methyltransferase; GNMT, folate, methylt 98.26
3g2m_A299 PCZA361.24; SAM-dependent methyltransferase, glyco 98.26
3htx_A950 HEN1; HEN1, small RNA methyltransferase, protein-R 98.26
2as0_A396 Hypothetical protein PH1915; RNA methyltransferase 98.25
2r6z_A258 UPF0341 protein in RSP 3' region; alpha-beta prote 98.23
3mcz_A352 O-methyltransferase; adomet_mtases, S-adenosylmeth 98.23
3bgv_A 313 MRNA CAP guanine-N7 methyltransferase; alternative 98.22
2r3s_A335 Uncharacterized protein; methyltransferase domain, 98.22
1o9g_A250 RRNA methyltransferase; antibiotic resistance, Se- 98.21
1fp2_A352 Isoflavone O-methyltransferase; protein-product co 98.2
3b3j_A 480 Histone-arginine methyltransferase CARM1; protein 98.2
1qzz_A374 RDMB, aclacinomycin-10-hydroxylase; anthracycline, 98.19
3ll7_A 410 Putative methyltransferase; methytransferase, stru 98.18
2aot_A292 HMT, histamine N-methyltransferase; classic methyl 98.18
1iy9_A275 Spermidine synthase; rossmann fold, structural gen 98.17
1mjf_A281 Spermidine synthase; spermidine synthetase, struct 98.17
2qm3_A373 Predicted methyltransferase; putative methyltransf 98.17
2yx1_A336 Hypothetical protein MJ0883; methyl transferase, t 98.15
1wg8_A 285 Predicted S-adenosylmethionine-dependent methyltra 98.15
2jjq_A425 Uncharacterized RNA methyltransferase pyrab10780; 98.15
1uir_A 314 Polyamine aminopropyltransferase; spermidien synth 98.15
2o07_A304 Spermidine synthase; structural genomics, structur 98.15
3cbg_A232 O-methyltransferase; cyanobacterium; HET: SAH FER 98.15
3reo_A368 (ISO)eugenol O-methyltransferase; directed evoluti 98.12
3bt7_A369 TRNA (uracil-5-)-methyltransferase; methyluridine, 98.12
2i62_A265 Nicotinamide N-methyltransferase; structural genom 98.11
1x19_A359 CRTF-related protein; methyltransferase, bacterioc 98.11
2pjd_A343 Ribosomal RNA small subunit methyltransferase C; g 98.1
2b2c_A314 Spermidine synthase; beta-alpha, transferase; 2.50 98.1
3p9c_A364 Caffeic acid O-methyltransferase; S-adenosylmethio 98.1
3bzb_A281 Uncharacterized protein; RED ALGA, protein structu 98.1
3fzg_A200 16S rRNA methylase; methyltransferase, plasmid, tr 98.08
1qyr_A 252 KSGA, high level kasugamycin resistance protein, S 98.08
3lst_A348 CALO1 methyltransferase; calicheamicin, enediyne, 98.08
1tw3_A360 COMT, carminomycin 4-O-methyltransferase; anthracy 98.07
2f8l_A344 Hypothetical protein LMO1582; structural genomics, 98.04
2a14_A263 Indolethylamine N-methyltransferase; SGC,INMT, str 98.04
2ip2_A334 Probable phenazine-specific methyltransferase; pyo 98.04
1zg3_A358 Isoflavanone 4'-O-methyltransferase; rossman fold, 98.04
2k4m_A153 TR8_protein, UPF0146 protein MTH_1000; alpha+beta, 98.02
2dul_A 378 N(2),N(2)-dimethylguanosine tRNA methyltransferas; 98.02
3gwz_A369 MMCR; methyltransferase, mitomycin, S-adenosyl met 98.02
3ftd_A249 Dimethyladenosine transferase; KSGA, rossmann-like 98.02
3i53_A332 O-methyltransferase; CO-complex, rossmann-like fol 98.01
3axs_A 392 Probable N(2),N(2)-dimethylguanosine tRNA methylt 98.01
3uzu_A279 Ribosomal RNA small subunit methyltransferase A; s 97.99
3dp7_A363 SAM-dependent methyltransferase; structural genomi 97.98
2oyr_A258 UPF0341 protein YHIQ; alpha-beta protein, structur 97.95
2g72_A289 Phenylethanolamine N-methyltransferase; HET: SAM F 97.89
3ldu_A385 Putative methylase; structural genomics, PSI-2, pr 97.85
2hwk_A320 Helicase NSP2; rossman fold, alpha/beta/alpha, mul 97.84
4e2x_A 416 TCAB9; kijanose, tetronitrose, tetradeoxy sugar, s 97.83
3k0b_A393 Predicted N6-adenine-specific DNA methylase; methy 97.82
3tka_A 347 Ribosomal RNA small subunit methyltransferase H; H 97.81
2qfm_A364 Spermine synthase; spermidine aminopropyltransfera 97.79
1vlm_A219 SAM-dependent methyltransferase; possible histamin 97.77
3ldg_A384 Putative uncharacterized protein SMU.472; YPSC, me 97.73
2okc_A 445 Type I restriction enzyme stysji M protein; NP_813 97.71
2cmg_A262 Spermidine synthase; transferase, putrescine amino 97.69
3giw_A277 Protein of unknown function DUF574; rossmann-fold 97.63
1af7_A274 Chemotaxis receptor methyltransferase CHER; chemot 97.6
1u2z_A433 Histone-lysine N-methyltransferase, H3 lysine-79 s 97.57
3frh_A253 16S rRNA methylase; methyltransferase domain, heli 97.56
2ar0_A 541 M.ecoki, type I restriction enzyme ecoki M protein 97.55
4a6d_A353 Hydroxyindole O-methyltransferase; melatonin, circ 97.53
3lcv_B281 Sisomicin-gentamicin resistance methylase SGM; ant 97.42
4gqb_A 637 Protein arginine N-methyltransferase 5; TIM barrel 97.24
3lkd_A 542 Type I restriction-modification system methyltrans 97.17
3ua3_A 745 Protein arginine N-methyltransferase 5; TIM-barrel 97.1
3g7u_A 376 Cytosine-specific methyltransferase; DNA-binding, 96.97
1i4w_A 353 Mitochondrial replication protein MTF1; mitochondr 96.96
3v97_A 703 Ribosomal RNA large subunit methyltransferase L; Y 96.9
3s1s_A 878 Restriction endonuclease bpusi; PD--(D/E)XK cataly 96.59
3cvo_A202 Methyltransferase-like protein of unknown functio; 96.28
2qy6_A257 UPF0209 protein YFCK; structural genomics, unknown 96.22
1g55_A 343 DNA cytosine methyltransferase DNMT2; human DNA me 96.08
3khk_A 544 Type I restriction-modification system methylation 96.07
3ufb_A 530 Type I restriction-modification system methyltran 95.96
3o4f_A294 Spermidine synthase; aminopropyltransferase, polya 95.9
2zig_A297 TTHA0409, putative modification methylase; methylt 95.72
2wk1_A282 NOVP; transferase, O-methyltransferase, novobiocin 95.51
3dqp_A219 Oxidoreductase YLBE; alpha-beta protein., structur 95.46
2qrv_A 295 DNA (cytosine-5)-methyltransferase 3A; DNA methylt 94.95
4h0n_A 333 DNMT2; SAH binding, transferase; HET: SAH; 2.71A { 94.68
2py6_A409 Methyltransferase FKBM; YP_546752.1, structural ge 94.51
4e4y_A 244 Short chain dehydrogenase family protein; structur 94.28
3ubt_Y 331 Modification methylase HAEIII; protein-DNA complex 94.15
2ld4_A176 Anamorsin; methyltransferase-like fold, alpha/beta 93.84
2c7p_A 327 Modification methylase HHAI; DNA methyltransferase 93.81
3qv2_A 327 5-cytosine DNA methyltransferase; DNMT2, ehmeth; H 93.61
3mag_A 307 VP39; methylated adenine, methyltransferase, RNA C 93.21
4id9_A 347 Short-chain dehydrogenase/reductase; putative dehy 92.94
3c6k_A381 Spermine synthase; spermidine aminopropyltransfera 92.75
3me5_A 482 Cytosine-specific methyltransferase; structural ge 92.44
3vtz_A 269 Glucose 1-dehydrogenase; rossmann fold, oxidoreduc 92.4
1g60_A260 Adenine-specific methyltransferase MBOIIA; structu 92.15
1vpt_A 348 VP39; RNA CAP, poly(A) polymerase, methyltransfera 92.1
3b5i_A 374 S-adenosyl-L-methionine:salicylic acid carboxyl me 91.95
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 91.73
2dph_A398 Formaldehyde dismutase; dismutation of aldehydes, 91.63
3sxp_A 362 ADP-L-glycero-D-mannoheptose-6-epimerase; rossman 91.47
1dhr_A 241 Dihydropteridine reductase; oxidoreductase(acting 91.21
3gpi_A 286 NAD-dependent epimerase/dehydratase; structural ge 91.15
2pzm_A 330 Putative nucleotide sugar epimerase/ dehydratase; 90.88
3rft_A 267 Uronate dehydrogenase; apoenzyme, rossmann fold, N 90.75
4b79_A 242 PA4098, probable short-chain dehydrogenase; oxidor 90.5
3enk_A 341 UDP-glucose 4-epimerase; seattle structural genomi 90.36
2efj_A 384 3,7-dimethylxanthine methyltransferase; SAM-depend 90.28
2fwm_X 250 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; e 89.99
2z1m_A 345 GDP-D-mannose dehydratase; short-chain dehydrogena 89.6
1rkx_A 357 CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 89.54
3un1_A 260 Probable oxidoreductase; structural genomics, PSI- 89.52
3rd5_A 291 Mypaa.01249.C; ssgcid, structural genomics, seattl 89.44
2v6g_A 364 Progesterone 5-beta-reductase; tyrosine-dependent 89.41
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 89.4
2pk3_A 321 GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, shor 89.39
3d7l_A202 LIN1944 protein; APC89317, structural genomics, PS 88.99
1ooe_A 236 Dihydropteridine reductase; structural genomics, P 88.88
1db3_A 372 GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lya 88.47
2dtx_A 264 Glucose 1-dehydrogenase related protein; rossmann 88.31
3abi_A 365 Putative uncharacterized protein PH1688; L-lysine 88.15
1rpn_A 335 GDP-mannose 4,6-dehydratase; short-chain dehydroge 88.15
4egb_A 346 DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce 87.89
3dii_A 247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 87.58
3tos_A257 CALS11; methyltransferase, calicheamicin, structur 87.52
3d3w_A 244 L-xylulose reductase; uronate cycle, short-chain d 87.47
2hrz_A 342 AGR_C_4963P, nucleoside-diphosphate-sugar epimeras 87.35
1yo6_A 250 Putative carbonyl reductase sniffer; tyrosine-depe 87.26
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 87.13
1cyd_A 244 Carbonyl reductase; short-chain dehydrogenase, oxi 87.07
2ag5_A 246 DHRS6, dehydrogenase/reductase (SDR family) member 87.06
3m2p_A 311 UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J 86.9
3o38_A 266 Short chain dehydrogenase; tuberculosis, ortholog 86.87
1sb8_A 352 WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN 86.78
1kol_A398 Formaldehyde dehydrogenase; oxidoreductase; HET: N 86.57
1uay_A 242 Type II 3-hydroxyacyl-COA dehydrogenase; beta oxid 86.39
2c07_A 285 3-oxoacyl-(acyl-carrier protein) reductase; oxidor 86.37
2h7i_A 269 Enoyl-[acyl-carrier-protein] reductase [NADH]; oxi 86.23
3ruf_A 351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 86.12
3sc4_A 285 Short chain dehydrogenase (A0QTM2 homolog); ssgcid 86.11
1f8f_A371 Benzyl alcohol dehydrogenase; rossmann fold, oxido 85.97
1m6e_X 359 S-adenosyl-L-methionnine:salicylic acid carboxyl m 85.93
2c5a_A 379 GDP-mannose-3', 5'-epimerase; short chain dehydrat 85.79
3qvo_A236 NMRA family protein; structural genomics, PSI-biol 85.65
3fpc_A352 NADP-dependent alcohol dehydrogenase; oxydoreducta 85.56
3p19_A 266 BFPVVD8, putative blue fluorescent protein; rossma 85.13
2q1w_A 333 Putative nucleotide sugar epimerase/ dehydratase; 85.08
3swr_A 1002 DNA (cytosine-5)-methyltransferase 1; epigenetics, 84.98
2x4g_A 342 Nucleoside-diphosphate-sugar epimerase; isomerase; 84.93
3r1i_A 276 Short-chain type dehydrogenase/reductase; structur 84.87
3h7a_A 252 Short chain dehydrogenase; oxidoreductase, PSI-2, 84.87
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 84.82
2pd4_A 275 Enoyl-[acyl-carrier-protein] reductase [NADH]; ant 84.74
3ek2_A 271 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 84.59
3e03_A 274 Short chain dehydrogenase; structural genomics, PS 84.58
1qsg_A 265 Enoyl-[acyl-carrier-protein] reductase; enoyl redu 84.55
3kvo_A 346 Hydroxysteroid dehydrogenase-like protein 2; HSDL2 84.5
1i24_A 404 Sulfolipid biosynthesis protein SQD1; SDR, short-c 84.34
2bka_A242 CC3, TAT-interacting protein TIP30; NADPH, PEG600, 84.14
2p91_A 285 Enoyl-[acyl-carrier-protein] reductase [NADH]; NAD 83.99
3uko_A378 Alcohol dehydrogenase class-3; alcohol dehydrogena 83.88
3pxx_A 287 Carveol dehydrogenase; structural genomics, seattl 83.87
2nm0_A 253 Probable 3-oxacyl-(acyl-carrier-protein) reductas; 83.87
1sny_A 267 Sniffer CG10964-PA; alpha and beta protein, rossma 83.7
4eez_A348 Alcohol dehydrogenase 1; site-saturation mutagenes 83.68
2rh8_A 338 Anthocyanidin reductase; flavonoids, rossmann fold 83.48
3tpc_A 257 Short chain alcohol dehydrogenase-related dehydro; 83.31
3s55_A 281 Putative short-chain dehydrogenase/reductase; stru 83.24
3gdg_A 267 Probable NADP-dependent mannitol dehydrogenase; ro 83.24
1pqw_A198 Polyketide synthase; rossmann fold, dimer, structu 83.23
3slg_A 372 PBGP3 protein; structural genomics, seattle struct 83.22
3afn_B 258 Carbonyl reductase; alpha/beta/alpha, rossmann-fol 82.73
4h15_A 261 Short chain alcohol dehydrogenase-related dehydro; 82.7
2q1s_A 377 Putative nucleotide sugar epimerase/ dehydratase; 82.56
3tjr_A 301 Short chain dehydrogenase; structural genomics, se 82.53
3lf2_A 265 Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross 82.5
1pl8_A356 Human sorbitol dehydrogenase; NAD, oxidoreductase; 82.21
2o23_A 265 HADH2 protein; HSD17B10, schad, ERAB, type II HADH 82.15
3imf_A 257 Short chain dehydrogenase; structural genomics, in 81.85
2oo3_A283 Protein involved in catabolism of external DNA; st 81.85
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 81.83
3lyl_A 247 3-oxoacyl-(acyl-carrier-protein) reductase; alpha 81.8
3m6i_A363 L-arabinitol 4-dehydrogenase; medium chain dehydro 81.78
1e3j_A352 NADP(H)-dependent ketose reductase; oxidoreductase 81.71
3uog_A363 Alcohol dehydrogenase; structural genomics, protei 81.71
3ioy_A 319 Short-chain dehydrogenase/reductase SDR; structura 81.7
3sju_A 279 Keto reductase; short-chain dehydrogenase, oxidore 81.68
1n7h_A 381 GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, 81.6
1orr_A 347 CDP-tyvelose-2-epimerase; rossmann fold, short-cha 81.58
1h5q_A 265 NADP-dependent mannitol dehydrogenase; oxidoreduct 81.48
3awd_A 260 GOX2181, putative polyol dehydrogenase; oxidoreduc 81.47
2ew8_A 249 (S)-1-phenylethanol dehydrogenase; transferase; 2. 81.4
1t2a_A 375 GDP-mannose 4,6 dehydratase; structural genomics c 81.3
3jv7_A345 ADH-A; dehydrogenase, nucleotide binding, rossmann 81.26
3pk0_A 262 Short-chain dehydrogenase/reductase SDR; ssgcid, s 81.24
1jtv_A 327 17 beta-hydroxysteroid dehydrogenase type 1; stero 81.09
3qiv_A 253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 81.05
1yb1_A 272 17-beta-hydroxysteroid dehydrogenase type XI; shor 81.01
1yxm_A 303 Pecra, peroxisomal trans 2-enoyl COA reductase; pe 80.97
1gy8_A 397 UDP-galactose 4-epimerase; oxidoreductase; HET: NA 80.97
2cfc_A 250 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor 80.96
4imr_A 275 3-oxoacyl-(acyl-carrier-protein) reductase; oxidor 80.93
3gk3_A 269 Acetoacetyl-COA reductase; acetoacetyl-CO reductas 80.93
3l77_A235 Short-chain alcohol dehydrogenase; oxidoreductase; 80.88
3o26_A 311 Salutaridine reductase; short chain dehydrogenase/ 80.88
2c20_A 330 UDP-glucose 4-epimerase; carbohydrate metabolism, 80.58
3ai3_A 263 NADPH-sorbose reductase; rossmann-fold, NADPH-depe 80.54
3ip1_A404 Alcohol dehydrogenase, zinc-containing; structural 80.5
3rih_A 293 Short chain dehydrogenase or reductase; structural 80.4
3gms_A340 Putative NADPH:quinone reductase; structural genom 80.39
3m1a_A 281 Putative dehydrogenase; short, PSI, MCSG, structur 80.39
1fmc_A 255 7 alpha-hydroxysteroid dehydrogenase; short-chain 80.32
1ae1_A 273 Tropinone reductase-I; oxidoreductase, tropane alk 80.32
2wyu_A 261 Enoyl-[acyl carrier protein] reductase; oxidoreduc 80.24
4dqx_A 277 Probable oxidoreductase protein; structural genomi 80.15
4e6p_A 259 Probable sorbitol dehydrogenase (L-iditol 2-dehyd; 80.11
2ae2_A 260 Protein (tropinone reductase-II); oxidoreductase, 80.09
1ek6_A 348 UDP-galactose 4-epimerase; short-chain dehydrogena 80.06
>3dou_A Ribosomal RNA large subunit methyltransferase J; cell division, structural genomics, protein structure initiative, PSI; HET: SAM; 1.45A {Thermoplasma volcanium} SCOP: c.66.1.0 Back     alignment and structure
Probab=99.97  E-value=6.7e-30  Score=202.80  Aligned_cols=141  Identities=26%  Similarity=0.336  Sum_probs=122.9

Q ss_pred             hhCCcchhhhcHHhHHHHhCCCCCCCEEEEEccCCChHHHHHHHHhCCCCCCCCCCCCCCCCeEEEEeCCCCCCCCCeeE
Q 030299           18 EEGWRARSAFKLLQIDEEFNIFEGVKRVVDLCAAPGSWSQVLSRKLYLPAKLSPDSREGDLPLIVAIDLQPMAPIEGVIQ   97 (179)
Q Consensus        18 ~~~~~sRaa~KL~eid~~~~ll~~g~~VlDLgagpGg~s~~l~~~~~~~~~~~~~~~~~~~~~VvavD~~~~~~~~~v~~   97 (179)
                      ++|||+||+|||.||+++|.+++++.+|||||||||+||++++++ .              +.|+|+|++++.+.+++++
T Consensus         2 ~~~yr~Ra~~KL~ei~~~~~~~~~g~~VLDlG~G~G~~s~~la~~-~--------------~~V~gvD~~~~~~~~~v~~   66 (191)
T 3dou_A            2 SLQLRSRAAFKLEFLLDRYRVVRKGDAVIEIGSSPGGWTQVLNSL-A--------------RKIISIDLQEMEEIAGVRF   66 (191)
T ss_dssp             --CTTSHHHHHHHHHHHHHCCSCTTCEEEEESCTTCHHHHHHTTT-C--------------SEEEEEESSCCCCCTTCEE
T ss_pred             CCCCCCcHHHHHHHHHHHcCCCCCCCEEEEEeecCCHHHHHHHHc-C--------------CcEEEEeccccccCCCeEE
Confidence            689999999999999999999999999999999999999999887 3              7999999999998899999


Q ss_pred             EeccccchhhHHHHHhhcC---CCCccEEeeCCCCCCCCCCcccHHHHHHHHHHHHHHHH------------------HH
Q 030299           98 VQGDITNARTAEVVIRHFD---GCKADLVVCDGAPDVTGLHDMDEFVQSQLILAVSIQFF------------------IY  156 (179)
Q Consensus        98 i~gDi~~~~~~~~l~~~~~---~~~~D~VlsD~~~~~~g~~~~d~~~q~~L~~~AL~~~~------------------~~  156 (179)
                      +++|+++.++...+.+.+.   .++||+|+|||+|+++|.+..|+..+..++..+|..+.                  ..
T Consensus        67 ~~~D~~~~~~~~~~~~~~~~~~~~~~D~Vlsd~~~~~~g~~~~d~~~~~~l~~~~l~~a~~~LkpGG~lv~k~~~~~~~~  146 (191)
T 3dou_A           67 IRCDIFKETIFDDIDRALREEGIEKVDDVVSDAMAKVSGIPSRDHAVSYQIGQRVMEIAVRYLRNGGNVLLKQFQGDMTN  146 (191)
T ss_dssp             EECCTTSSSHHHHHHHHHHHHTCSSEEEEEECCCCCCCSCHHHHHHHHHHHHHHHHHHHHHHEEEEEEEEEEEECSTHHH
T ss_pred             EEccccCHHHHHHHHHHhhcccCCcceEEecCCCcCCCCCcccCHHHHHHHHHHHHHHHHHHccCCCEEEEEEcCCCCHH
Confidence            9999999877666665543   13899999999999999999999999999988887542                  24


Q ss_pred             HHHHHHHHhhceEEEee
Q 030299          157 ELVFCLRQLLQYVILDG  173 (179)
Q Consensus       157 ~~~~~~~~~f~~v~~~~  173 (179)
                      .+++.|++.|++|.+..
T Consensus       147 ~~~~~l~~~F~~v~~~k  163 (191)
T 3dou_A          147 DFIAIWRKNFSSYKISK  163 (191)
T ss_dssp             HHHHHHGGGEEEEEEEC
T ss_pred             HHHHHHHHhcCEEEEEC
Confidence            67788999999999854



>2px2_A Genome polyprotein [contains: capsid protein C (core protein); envelope protein M...; methyltransferase, SAH; HET: SAH; 2.00A {Murray valley encephalitis virus} PDB: 2px4_A* 2px5_A* 2pxa_A* 2pxc_A* 2px8_A* 2oy0_A* Back     alignment and structure
>3gcz_A Polyprotein; flavivirus, RNA capping, methyltransferase, viral enzyme STR ATP-binding, nucleotide-binding, RNA replication, structura genomics; HET: SAM; 1.70A {Yokose virus} Back     alignment and structure
>3evf_A RNA-directed RNA polymerase NS5; NS5 methyltransferase, RNA CAP binding, binding, capsid protein; HET: GTA SAH; 1.45A {Yellow fever virus} SCOP: c.66.1.0 PDB: 3evb_A* 3evc_A* 3evd_A* 3eve_A* 3eva_A* Back     alignment and structure
>2plw_A Ribosomal RNA methyltransferase, putative; malaria, SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Plasmodium falciparum} Back     alignment and structure
>3eld_A Methyltransferase; flavivirus, RNA capping, guanylyltransfer viral enzyme structure; HET: SFG; 1.90A {Wesselsbron virus} PDB: 3elu_A* 3elw_A* 3ely_A* 3emb_A* 3emd_A* Back     alignment and structure
>2nyu_A Putative ribosomal RNA methyltransferase 2; SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.76A {Homo sapiens} Back     alignment and structure
>3p8z_A Mtase, non-structural protein 5; methyltransferase, RNA, ER, transferase-transferase inhibito; HET: 36A SAH; 1.70A {Dengue virus 3} SCOP: c.66.1.25 PDB: 3p97_A* 2xbm_A* 3evg_A* Back     alignment and structure
>2oxt_A Nucleoside-2'-O-methyltransferase; flavivirus, viral enzyme, RNA capping, S-adenosyl-L-methionine, viral protein; HET: SAM; 2.90A {Meaban virus} Back     alignment and structure
>4auk_A Ribosomal RNA large subunit methyltransferase M; YGDE; HET: TLA PGE; 1.90A {Escherichia coli} PDB: 4atn_A* 4b17_A* Back     alignment and structure
>2p41_A Type II methyltransferase; vizier, viral enzymes involved in replication, dengue virus methyltransferase, structural genomics; HET: G1G SAH CIT; 1.80A {Dengue virus 2} SCOP: c.66.1.25 PDB: 2p1d_A* 1l9k_A* 2p3o_A* 2p3q_A* 2p40_A* 2p3l_A* 1r6a_A* Back     alignment and structure
>3lkz_A Non-structural protein 5; flavivirus, methyltransferase, inhibitor, P nucleotide-binding, RNA replication, viral protein; HET: SFG; 2.00A {West nile virus} Back     alignment and structure
>1ej0_A FTSJ; methyltransferase, adoMet, adenosyl methionine, heat shock proteins, 23S ribosomal RNA; HET: SAM; 1.50A {Escherichia coli} SCOP: c.66.1.2 PDB: 1eiz_A* Back     alignment and structure
>2wa2_A Non-structural protein 5; transferase, S-adenosyl-L- methionine, virion, membrane, flavivirus, N7-methyltransferase, 2'-O-methyltransferase; HET: SAM; 1.80A {Modoc virus} PDB: 2wa1_A* Back     alignment and structure
>3r24_A NSP16, 2'-O-methyl transferase; methyltransferase, zinc-finger, transferase, viral protein; HET: SAM; 2.00A {Sars coronavirus} Back     alignment and structure
>3id6_C Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; C/D guide RNA, 2'-O-methylation, coiled-coil, methyltransfer binding, rRNA processing; HET: SAM; 2.60A {Sulfolobus solfataricus} SCOP: c.66.1.0 PDB: 3id5_B* 3pla_E* Back     alignment and structure
>2xyq_A Putative 2'-O-methyl transferase; transferase-viral protein complex, rossman fold; HET: SAH; 2.00A {Sars coronavirus} PDB: 2xyv_A* 2xyr_A* Back     alignment and structure
>3hp7_A Hemolysin, putative; structural genomics, APC64019, PSI-2, protein STR initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.53A {Streptococcus thermophilus} Back     alignment and structure
>4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix} Back     alignment and structure
>1ixk_A Methyltransferase; open beta sheet; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.38 Back     alignment and structure
>2frx_A Hypothetical protein YEBU; rossmann-type S-adenosylmethionine-dependent methyltransfera domain; 2.90A {Escherichia coli} Back     alignment and structure
>3m4x_A NOL1/NOP2/SUN family protein; mtase domain, PUA domain, RRM motif, transferase; 2.28A {Enterococcus faecium} Back     alignment and structure
>2b9e_A NOL1/NOP2/SUN domain family, member 5 isoform 2; methytransferase, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.65A {Homo sapiens} SCOP: c.66.1.38 Back     alignment and structure
>2ipx_A RRNA 2'-O-methyltransferase fibrillarin; FBL, structural genomics, structural genomics consortium, SGC; HET: MTA; 1.82A {Homo sapiens} Back     alignment and structure
>3ajd_A Putative methyltransferase MJ0026; tRNA, M5C, rossmann fold, structural genomics, riken structu genomics/proteomics initiative; 1.27A {Methanocaldococcus jannaschii} PDB: 3a4t_A Back     alignment and structure
>3m6w_A RRNA methylase; rRNA methyltransferase, 5-methylcytidine, RSMF, adoMet, MULT specific, methyltransferase, transferase; HET: CXM SAM; 1.30A {Thermus thermophilus} PDB: 3m6v_A* 3m6u_A* 3m6x_A* Back     alignment and structure
>2yxl_A PH0851 protein, 450AA long hypothetical FMU protein; FMU-homolog, methyltransferase, structural genomics, NPPSFA; HET: SFG; 2.55A {Pyrococcus horikoshii} Back     alignment and structure
>1nt2_A Fibrillarin-like PRE-rRNA processing protein; adeMet, binding motif, RNA binding protein; HET: SAM; 2.90A {Archaeoglobus fulgidus} SCOP: c.66.1.3 Back     alignment and structure
>3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} Back     alignment and structure
>4hg2_A Methyltransferase type 11; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MES; 1.60A {Anaeromyxobacter dehalogenans} Back     alignment and structure
>3opn_A Putative hemolysin; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics, nysgxrc; 2.05A {Lactococcus lactis subsp} Back     alignment and structure
>4fzv_A Putative methyltransferase NSUN4; mterf fold, methyltransferase fold, rRNA methyltransferase, mitochondria, transferase; HET: MSE SAM; 2.00A {Homo sapiens} PDB: 4fp9_A* Back     alignment and structure
>1sqg_A SUN protein, FMU protein; rossmann-fold, mixed beta sheet, methyltransferase-fold, RNA-binding domain; 1.65A {Escherichia coli} SCOP: a.79.1.3 c.66.1.38 PDB: 1sqf_A Back     alignment and structure
>3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} Back     alignment and structure
>4gek_A TRNA (CMO5U34)-methyltransferase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, rossmann fold; HET: GEK; 1.50A {Escherichia coli} PDB: 1im8_A* Back     alignment and structure
>3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A* Back     alignment and structure
>3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} Back     alignment and structure
>3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* Back     alignment and structure
>3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* Back     alignment and structure
>1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A Back     alignment and structure
>3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* Back     alignment and structure
>1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41 Back     alignment and structure
>1g8a_A Fibrillarin-like PRE-rRNA processing protein; rRNA binding, RNA binding, structural genomics, BSGC structure funded by NIH; 1.40A {Pyrococcus horikoshii} SCOP: c.66.1.3 PDB: 2nnw_B 3nmu_F* 3nvk_I* 3nvm_B 1pry_A Back     alignment and structure
>2fca_A TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bacillus subtilis} SCOP: c.66.1.53 Back     alignment and structure
>3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* Back     alignment and structure
>3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* Back     alignment and structure
>3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kpi_A* Back     alignment and structure
>2bm8_A Cephalosporin hydroxylase CMCI; cephamycin biosynthesis; 2.5A {Streptomyces clavuligerus} SCOP: c.66.1.50 PDB: 2bm9_A* 2br5_A* 2br4_A* 2br3_A* Back     alignment and structure
>3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes} Back     alignment and structure
>3p9n_A Possible methyltransferase (methylase); RV2966C, adoMet binding, RNA methylase, RSMD, SAM-fold, RNA methyltransferase; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase-L protein, methyltransferase domain; 1.85A {Lactobacillus casei} Back     alignment and structure
>3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} Back     alignment and structure
>3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} Back     alignment and structure
>1yzh_A TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alpha sandwich, S-adenosylmeth dependent, structural genomics, PSI; 2.02A {Streptococcus pneumoniae} SCOP: c.66.1.53 Back     alignment and structure
>3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0 Back     alignment and structure
>3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1pjz_A Thiopurine S-methyltransferase; polymorphism, S-adenosylmethionine, drug metabolism; NMR {Pseudomonas syringae PV} SCOP: c.66.1.36 Back     alignment and structure
>3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research CE structural genomics, protein structure initiative, pyrococc furiosus, PSI-2; 2.20A {Pyrococcus furiosus} Back     alignment and structure
>4dzr_A Protein-(glutamine-N5) methyltransferase, release specific; structural genomics, PSI-biology; 2.55A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>3q87_B N6 adenine specific DNA methylase; SAM-methyltransferase, methyltransferase, methylation, trans activator-transferase complex; HET: SAM; 2.00A {Encephalitozoon cuniculi} Back     alignment and structure
>3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C* Back     alignment and structure
>3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} Back     alignment and structure
>3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae} Back     alignment and structure
>3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} Back     alignment and structure
>3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli} Back     alignment and structure
>3gdh_A Trimethylguanosine synthase homolog; M7G, CAP, dimethyltransferase, usnRNA, snoRNA, telomerase, cytoplasm, methyltransferase, nucleus; HET: MGP SAH; 2.00A {Homo sapiens} PDB: 3egi_A* Back     alignment and structure
>3a27_A TYW2, uncharacterized protein MJ1557; wybutosine modification, transferase; HET: SAM; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>3gru_A Dimethyladenosine transferase; rossman fold, ribosomal assem adenosyl-L-methionine, rRNA, methyltransferase, RNA-binding processing; HET: AMP; 1.60A {Methanocaldococcus jannaschii} PDB: 3grr_A* 3grv_A* 3gry_A* 3fyd_A 3fyc_A* Back     alignment and structure
>3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Bacillus thuringiensis} Back     alignment and structure
>4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A Back     alignment and structure
>2frn_A Hypothetical protein PH0793; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pyrococcus horikoshii OT3} PDB: 3k6r_A 3a25_A* 3a26_A* Back     alignment and structure
>3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} Back     alignment and structure
>1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 Back     alignment and structure
>1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A* Back     alignment and structure
>3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* 4f84_A* 4f85_A 4f86_A* Back     alignment and structure
>1xdz_A Methyltransferase GIDB; MCSG, protein structure initiative, structural genomics, methyltransferase fold, PSI; 1.60A {Bacillus subtilis} SCOP: c.66.1.20 Back     alignment and structure
>1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl homocysteine, protein repair; HET: SAH; 1.50A {Homo sapiens} SCOP: c.66.1.7 PDB: 1kr5_A* Back     alignment and structure
>2esr_A Methyltransferase; structural genomics, hypothetical protein, streptococcus PYO PSI, protein structure initiative; HET: GLC; 1.80A {Streptococcus pyogenes} SCOP: c.66.1.46 Back     alignment and structure
>3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} Back     alignment and structure
>2gb4_A Thiopurine S-methyltransferase; 18204406, thiopurine methyltransferase, structural genomics, PSI, protein structure initiative; HET: SAH; 1.25A {Mus musculus} PDB: 3bgi_A* 3bgd_A* 2bzg_A* 2h11_A* Back     alignment and structure
>3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} Back     alignment and structure
>3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} Back     alignment and structure
>2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A Back     alignment and structure
>3sso_A Methyltransferase; macrolide, natural product, rossman fold; HET: SAH; 1.90A {Micromonospora griseorubida} PDB: 3ssn_A* 3ssm_A* Back     alignment and structure
>2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175; HET: MSE; 1.70A {Agrobacterium tumefaciens str} Back     alignment and structure
>2ift_A Putative methylase HI0767; NESG, Y767_haein, structural genomics, PSI-2, protein structure initiative; 2.30A {Haemophilus influenzae} SCOP: c.66.1.46 Back     alignment and structure
>2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens} Back     alignment and structure
>3q7e_A Protein arginine N-methyltransferase 1; HET: SAH; 2.20A {Rattus norvegicus} PDB: 1orh_A* 1ori_A* 1or8_A* Back     alignment and structure
>1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1 Back     alignment and structure
>2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A Back     alignment and structure
>2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A* Back     alignment and structure
>2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii} Back     alignment and structure
>1wy7_A Hypothetical protein PH1948; seven-stranded beta sheet, methyltransferase fold, structura genomics, transferase; HET: SAH; 2.20A {Pyrococcus horikoshii} SCOP: c.66.1.32 Back     alignment and structure
>3u81_A Catechol O-methyltransferase; neurotransmitter degradation, transferase transferase inhibitor complex; HET: SAH; 1.13A {Rattus norvegicus} SCOP: c.66.1.1 PDB: 3nwe_A* 3oe5_A* 3ozr_A* 3oe4_A* 3ozt_A* 3ozs_A* 3r6t_A* 3hvi_A* 1jr4_A* 1vid_A* 1h1d_A* 2cl5_A* 3hvh_A* 3hvj_A* 3hvk_A* 3nw9_A* 3nwb_A* 3s68_A* 2zlb_A 2zth_A* ... Back     alignment and structure
>3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A* Back     alignment and structure
>1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13 Back     alignment and structure
>3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} SCOP: c.66.1.49 PDB: 2gh1_A Back     alignment and structure
>1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A* Back     alignment and structure
>1jsx_A Glucose-inhibited division protein B; methyltransferase fold, structural genomics, PSI, protein structure initiative; 2.40A {Escherichia coli} SCOP: c.66.1.20 Back     alignment and structure
>1zx0_A Guanidinoacetate N-methyltransferase; structural genomics, structural genomics consortium; HET: SAH; 1.86A {Homo sapiens} PDB: 3orh_A* 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>2fpo_A Methylase YHHF; structural genomics, putative methyltransferase, PSI, protei structure initiative; HET: MSE; 2.05A {Escherichia coli} SCOP: c.66.1.46 Back     alignment and structure
>3mq2_A 16S rRNA methyltransferase; methyltranferase, ribosomal, antibiotic resistance, aminoglycoside, S-adenosyl-L-methionine; HET: SAH; 1.69A {Streptomyces SP} Back     alignment and structure
>3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} Back     alignment and structure
>3dxy_A TRNA (guanine-N(7)-)-methyltransferase; rossmann fold methyltransferase, tRNA modification, S-adenosyl-L-methionine, TR processing; HET: SAM; 1.50A {Escherichia coli} PDB: 3dxx_A* 3dxz_A* Back     alignment and structure
>3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} Back     alignment and structure
>1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* Back     alignment and structure
>3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A Back     alignment and structure
>1ne2_A Hypothetical protein TA1320; structural genomics, conserved hypothetical protein, PSI, protein structure initiative; 1.75A {Thermoplasma acidophilum} SCOP: c.66.1.32 Back     alignment and structure
>3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413} Back     alignment and structure
>1m6y_A S-adenosyl-methyltransferase MRAW; SAM-dependent methyltransferase fold, protein-cofactor product complex, structural genomics, PSI; HET: SAH; 1.90A {Thermotoga maritima} SCOP: a.60.13.1 c.66.1.23 PDB: 1n2x_A* Back     alignment and structure
>3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} Back     alignment and structure
>2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 Back     alignment and structure
>2b3t_A Protein methyltransferase HEMK; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: c.66.1.30 PDB: 1t43_A* Back     alignment and structure
>3r3h_A O-methyltransferase, SAM-dependent; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.65A {Legionella pneumophila subsp} Back     alignment and structure
>3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str} Back     alignment and structure
>3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum} Back     alignment and structure
>3duw_A OMT, O-methyltransferase, putative; alternating of alpha and beta with complex SAH; HET: SAH; 1.20A {Bacillus cereus} PDB: 3dul_A* Back     alignment and structure
>2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural GEN consortium, SGC, transferase; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.13 Back     alignment and structure
>2fyt_A Protein arginine N-methyltransferase 3; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.6 PDB: 3smq_A* 1f3l_A* Back     alignment and structure
>2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus} Back     alignment and structure
>3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A Back     alignment and structure
>3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} Back     alignment and structure
>1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 Back     alignment and structure
>3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp} Back     alignment and structure
>2vdv_E TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl-L-methionine, phosphorylation, M7G, spout MT, tRNA processing; HET: SAM; 2.30A {Saccharomyces cerevisiae} PDB: 2vdu_E Back     alignment and structure
>1i9g_A Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13 Back     alignment and structure
>1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33 Back     alignment and structure
>3ntv_A MW1564 protein; rossmann fold, putative methyltransferase, transferase; HET: MSE; 1.55A {Staphylococcus aureus} Back     alignment and structure
>3g89_A Ribosomal RNA small subunit methyltransferase G; 16S rRNA methyltransferase, translation, cytoplasm, rRNA processing; HET: HIC SAM AMP; 1.50A {Thermus thermophilus} PDB: 3g88_A* 3g8a_A* 3g8b_A* Back     alignment and structure
>1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42 Back     alignment and structure
>3g07_A 7SK snRNA methylphosphate capping enzyme; structural genomics consortium (SGC), methyltransferase, phosphoprotein, S-adenosyl-L-methionine; HET: SAM; 2.65A {Homo sapiens} Back     alignment and structure
>4htf_A S-adenosylmethionine-dependent methyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE SAM; 1.60A {Escherichia coli} Back     alignment and structure
>2h00_A Methyltransferase 10 domain containing protein; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.54 Back     alignment and structure
>3r0q_C Probable protein arginine N-methyltransferase 4.2; arginine methyltransferase, methylation; HET: SAH; 2.61A {Arabidopsis thaliana} Back     alignment and structure
>3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae} Back     alignment and structure
>2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A* Back     alignment and structure
>1inl_A Spermidine synthase; beta-barrel, rossman fold, structural genomics, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: c.66.1.17 PDB: 1jq3_A* Back     alignment and structure
>3tr6_A O-methyltransferase; cellular processes; HET: SAH; 2.70A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>2fhp_A Methylase, putative; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Enterococcus faecalis} SCOP: c.66.1.46 Back     alignment and structure
>3tma_A Methyltransferase; thump domain; 2.05A {Thermus thermophilus} Back     alignment and structure
>3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3pfg_A N-methyltransferase; N,N-dimethyltransferase, SAM binding, DTDP-linked sugar BIND transferase; HET: SAM TLO; 1.35A {Streptomyces fradiae} PDB: 3pfh_A* 3px3_A* 3px2_A* Back     alignment and structure
>2pbf_A Protein-L-isoaspartate O-methyltransferase beta-A methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum} Back     alignment and structure
>3orh_A Guanidinoacetate N-methyltransferase; structura genomics, structural genomics consortium, SGC; HET: SAH; 1.86A {Homo sapiens} PDB: 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>3p2e_A 16S rRNA methylase; methyltransferase, transferase, NPMA; HET: SAH; 1.68A {Escherichia coli} PDB: 3p2i_A 3p2k_A* 3pb3_A* 3mte_A* Back     alignment and structure
>1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 Back     alignment and structure
>2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>3k6r_A Putative transferase PH0793; structural genomics, PSI structure initiative, midwest center for structural genomic unknown function; 2.10A {Pyrococcus horikoshii} PDB: 3a25_A* 3a26_A* Back     alignment and structure
>1g6q_1 HnRNP arginine N-methyltransferase; SAM-binding domain, beta-barrel, mixed alpha-beta, hexamer; 2.90A {Saccharomyces cerevisiae} SCOP: c.66.1.6 Back     alignment and structure
>4hc4_A Protein arginine N-methyltransferase 6; HRMT1L6, S-adenosyl-L-homocysteine, struc genomics, structural genomics consortium, SGC; HET: SAH; 1.97A {Homo sapiens} Back     alignment and structure
>4dcm_A Ribosomal RNA large subunit methyltransferase G; 23S rRNA (guanine1835-N2)-methyltransferase; HET: SAM; 2.30A {Escherichia coli} Back     alignment and structure
>1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>2ih2_A Modification methylase TAQI; DNA, DNA methyltransferase, target base partner, 5-methylpyr 2(1H)-ONE, base flipping; HET: 5PY 6MA NEA; 1.61A {Thermus aquaticus} SCOP: c.66.1.27 d.287.1.1 PDB: 2ibs_A* 2ibt_A* 2ih4_A* 2ih5_A* 2jg3_A* 2np6_A* 2np7_A* 1aqj_A* 1aqi_A* 2adm_A* 1g38_A* Back     alignment and structure
>3ckk_A TRNA (guanine-N(7)-)-methyltransferase; mettl1, S-adenosyl-L-methionine, tRNA Pro structural genomics, structural genomics consortium, SGC; HET: SAM; 1.55A {Homo sapiens} Back     alignment and structure
>3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} Back     alignment and structure
>2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 Back     alignment and structure
>3bxo_A N,N-dimethyltransferase; desosamine, sugar, carbohydrate, antibiotic, SAM, adoMet; HET: SAM UPP; 2.00A {Streptomyces venezuelae} Back     alignment and structure
>1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7 Back     alignment and structure
>1ws6_A Methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Thermus thermophilus} SCOP: c.66.1.46 Back     alignment and structure
>2y1w_A Histone-arginine methyltransferase CARM1; histone modification; HET: SFG 849; 2.10A {Homo sapiens} PDB: 2y1x_A* 3b3f_A* 3b3g_A 2v74_B* 2v7e_A Back     alignment and structure
>2h1r_A Dimethyladenosine transferase, putative; SGC toronto dimethyladenosine transferase, structural genomics, structural genomics consortium; 1.89A {Plasmodium falciparum} Back     alignment and structure
>2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} Back     alignment and structure
>3gjy_A Spermidine synthase; APC62791, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.47A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2zfu_A Nucleomethylin, cerebral protein 1; nucleolar protein, SAM-binding protein, protein structure, N phosphoprotein, nuclear protein; HET: SAH; 2.00A {Homo sapiens} Back     alignment and structure
>4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* Back     alignment and structure
>2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A Back     alignment and structure
>3dmg_A Probable ribosomal RNA small subunit methyltransf; monomethyltranserase, 16S rRNA methyltransferase, N2 G1207 methyltransferase; HET: SAH; 1.55A {Thermus thermophilus} PDB: 3dmf_A* 3dmh_A* 2zul_A* 2zwv_A* Back     alignment and structure
>1zq9_A Probable dimethyladenosine transferase; SGC, structural genomics, structural genomics consortium; HET: SAM; 1.90A {Homo sapiens} SCOP: c.66.1.24 Back     alignment and structure
>3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} Back     alignment and structure
>3uwp_A Histone-lysine N-methyltransferase, H3 lysine-79; epigenetics, tubercidin, structu genomics, structural genomics consortium, SGC; HET: 5ID; 2.05A {Homo sapiens} PDB: 4eqz_A* 3sx0_A* 4er0_A* 4er7_A* 1nw3_A* 4er6_A* 4er5_A* 3qow_A* 3qox_A* 4ek9_A* 4ekg_A* 4eki_A* 4er3_A* 3sr4_A* Back     alignment and structure
>1nv8_A HEMK protein; class I adoMet-dependent methyltransferase; HET: SAM MEQ; 2.20A {Thermotoga maritima} SCOP: c.66.1.30 PDB: 1nv9_A* 1vq1_A* 1sg9_A* Back     alignment and structure
>1r18_A Protein-L-isoaspartate(D-aspartate)-O-methyltrans; methyltransferase, isomerization, protein repair, S-adenosyl homocysteine; HET: SAH; 2.20A {Drosophila melanogaster} SCOP: c.66.1.7 Back     alignment and structure
>3gnl_A Uncharacterized protein, DUF633, LMOF2365_1472; structural genomics, PSI-2, protein structure initiative; 1.50A {Listeria monocytogenes str} Back     alignment and structure
>3lcc_A Putative methyl chloride transferase; halide methyltransferase; HET: SAH; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>3lec_A NADB-rossmann superfamily protein; PSI, MCSG, structural genomics, midwest CENT structural genomics, protein structure initiative; 1.80A {Streptococcus agalactiae} Back     alignment and structure
>3tm4_A TRNA (guanine N2-)-methyltransferase TRM14; rossmann fold, thump domain, tRNA methyltransferase; HET: SAM; 1.95A {Pyrococcus furiosus} PDB: 3tlj_A* 3tm5_A* Back     alignment and structure
>4dmg_A Putative uncharacterized protein TTHA1493; rRNA, methyltransferase, S-adenosyl-methionine, 23S ribosoma transferase; HET: SAM; 1.70A {Thermus thermophilus} Back     alignment and structure
>1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* Back     alignment and structure
>1fp1_D Isoliquiritigenin 2'-O-methyltransferase; protein-substrate, protein-product complex; HET: SAH HCC; 1.82A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpq_A* Back     alignment and structure
>1qam_A ERMC' methyltransferase; rRNA methyltransferase ERMC', cofactor analogs; 2.20A {Bacillus subtilis} SCOP: c.66.1.24 PDB: 1qan_A* 1qao_A* 1qaq_A* 2erc_A Back     alignment and structure
>3kr9_A SAM-dependent methyltransferase; class I rossmann-like methyltransferase fold; 2.00A {Streptococcus pneumoniae} PDB: 3ku1_A* Back     alignment and structure
>3fut_A Dimethyladenosine transferase; methyltransferase, dimethyltransferase, dual-specific methyltransferase, 16S rRNA methyltransferase; 1.52A {Thermus thermophilus} PDB: 3fuu_A* 3fuv_A 3fuw_A* 3fux_A* Back     alignment and structure
>2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA, national PR protein structural and functional analyses; HET: SAH; 2.60A {Thermus thermophilus} Back     alignment and structure
>1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A* Back     alignment and structure
>2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus} Back     alignment and structure
>1yub_A Ermam, rRNA methyltransferase; MLS antibiotics; NMR {Streptococcus pneumoniae} SCOP: c.66.1.24 Back     alignment and structure
>2gpy_A O-methyltransferase; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: MSE; 1.90A {Bacillus halodurans} Back     alignment and structure
>2b78_A Hypothetical protein SMU.776; structure genomics, methyltransferase, caries, structural genomics, unknown function; 2.00A {Streptococcus mutans} SCOP: b.122.1.9 c.66.1.51 PDB: 3ldf_A* Back     alignment and structure
>2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A* Back     alignment and structure
>2avd_A Catechol-O-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Homo sapiens} SCOP: c.66.1.1 Back     alignment and structure
>2igt_A SAM dependent methyltransferase; alpha-beta sandwich, beta-barrel, structural genomics, PSI-2 structure initiative; HET: MSE SAM GOL; 1.89A {Agrobacterium tumefaciens str} SCOP: c.66.1.51 Back     alignment and structure
>3tqs_A Ribosomal RNA small subunit methyltransferase A; protein synthesis; 1.98A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>1uwv_A 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA modification, iron-sulfur cluster, RNA processing; 1.95A {Escherichia coli} SCOP: b.40.4.12 c.66.1.40 PDB: 2bh2_A* Back     alignment and structure
>3c0k_A UPF0064 protein YCCW; PUA domain, adoMet dependent methyltransferase fold; 2.00A {Escherichia coli K12} Back     alignment and structure
>3c3y_A Pfomt, O-methyltransferase; plant secondary metabolism; HET: SAH; 1.37A {Mesembryanthemum crystallinum} Back     alignment and structure
>3iv6_A Putative Zn-dependent alcohol dehydrogenase; alpha/beta fold, rossmann-fold, structural genomics, PSI-2, structure initiative; HET: SAM; 2.70A {Rhodobacter sphaeroides} Back     alignment and structure
>1sui_A Caffeoyl-COA O-methyltransferase; rossmann fold, protein-cofactor-substrate complex; HET: SAH FRE; 2.70A {Medicago sativa} SCOP: c.66.1.1 PDB: 1sus_A* Back     alignment and structure
>3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* Back     alignment and structure
>2qe6_A Uncharacterized protein TFU_2867; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: NEP SAM; 1.95A {Thermobifida fusca} Back     alignment and structure
>2vdw_A Vaccinia virus capping enzyme D1 subunit; nucleotidyltransferase, S-adenosyl-L-methionine, RNA metabolism, mRNA processing, methyltransferase, poxvirus; HET: SAH; 2.70A {Vaccinia virus} Back     alignment and structure
>2hnk_A SAM-dependent O-methyltransferase; modified rossman fold; HET: SAH; 2.30A {Leptospira interrogans} Back     alignment and structure
>1wxx_A TT1595, hypothetical protein TTHA1280; thermus thermophillus, methyltransferase, adoMet, structural genomics; 1.80A {Thermus thermophilus} SCOP: b.122.1.9 c.66.1.51 PDB: 1wxw_A 2cww_A* Back     alignment and structure
>3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15} Back     alignment and structure
>3cc8_A Putative methyltransferase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS transferase; 1.64A {Bacillus cereus} Back     alignment and structure
>2i7c_A Spermidine synthase; transferase, structural genomics consor; HET: AAT 1PG; 1.71A {Plasmodium falciparum} PDB: 2hte_A* 3b7p_A* 3rie_A* 2pwp_A* Back     alignment and structure
>1xj5_A Spermidine synthase 1; structural genomics, protein structure initiative, CESG, AT1G23820, putrescine aminopropyl transferase, SPDS1; 2.70A {Arabidopsis thaliana} SCOP: c.66.1.17 PDB: 2q41_A Back     alignment and structure
>1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43 Back     alignment and structure
>2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>3c3p_A Methyltransferase; NP_951602.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative transferase; 1.90A {Geobacter sulfurreducens pca} Back     alignment and structure
>2pt6_A Spermidine synthase; transferase, structural genomics consor SGC,dcadoMet complex; HET: S4M 1PG; 2.00A {Plasmodium falciparum} PDB: 2pss_A* 2pt9_A* Back     alignment and structure
>3bwc_A Spermidine synthase; SAM, SGPP, structura genomics, PSI, protein structure initiative, structural GEN pathogenic protozoa consortium; HET: MSE SAM; 2.30A {Trypanosoma cruzi} PDB: 3bwb_A* Back     alignment and structure
>3thr_A Glycine N-methyltransferase; GNMT, folate, methyltransferase binding, liver cytosol, transferase-transferase inhibitor C; HET: C2F TAM; 2.00A {Rattus norvegicus} SCOP: c.66.1.5 PDB: 3ths_A* 1xva_A* 1d2c_A 1kia_A* 1nbh_A* 1bhj_A* 2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A 1r74_A* 2azt_A* Back     alignment and structure
>3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A* Back     alignment and structure
>3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana} Back     alignment and structure
>2as0_A Hypothetical protein PH1915; RNA methyltransferase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus horikoshii} SCOP: b.122.1.9 c.66.1.51 Back     alignment and structure
>2r6z_A UPF0341 protein in RSP 3' region; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 1.80A {Neisseria gonorrhoeae} Back     alignment and structure
>3mcz_A O-methyltransferase; adomet_mtases, S-adenosylmethionine-dependent methyltransfer structural genomics, PSI-2; HET: MSE; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>3bgv_A MRNA CAP guanine-N7 methyltransferase; alternative splicing, mRNA capping, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: SAH; 2.30A {Homo sapiens} PDB: 3epp_A* Back     alignment and structure
>2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 2.15A {Nostoc punctiforme} Back     alignment and structure
>1o9g_A RRNA methyltransferase; antibiotic resistance, Se-MAD; 1.5A {Streptomyces viridochromogenes} SCOP: c.66.1.29 PDB: 1o9h_A Back     alignment and structure
>1fp2_A Isoflavone O-methyltransferase; protein-product complex; HET: SAH HMO; 1.40A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpx_A* 2qyo_A* Back     alignment and structure
>3b3j_A Histone-arginine methyltransferase CARM1; protein arginine methyltransferase 4, APO catalytic domain, regulator, mRNA processing; 2.55A {Rattus norvegicus} Back     alignment and structure
>1qzz_A RDMB, aclacinomycin-10-hydroxylase; anthracycline, methyltransferase, polyketide, tailoring enzymes, structural proteomics in E spine; HET: SAM; 2.10A {Streptomyces purpurascens} SCOP: a.4.5.29 c.66.1.12 PDB: 1r00_A* 1xds_A* 1xdu_A* Back     alignment and structure
>3ll7_A Putative methyltransferase; methytransferase, structural genomics, MCSG, PSI-2, protein initiative; HET: MSE; 1.80A {Porphyromonas gingivalis} Back     alignment and structure
>2aot_A HMT, histamine N-methyltransferase; classic methyltransferase fold, protein-drug complex; HET: CSO 2PM SAH; 1.90A {Homo sapiens} SCOP: c.66.1.19 PDB: 1jqd_A* 2aou_A* 2aov_A* 2aox_A* 1jqe_A* 2aow_A* Back     alignment and structure
>1iy9_A Spermidine synthase; rossmann fold, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacillus subtilis} SCOP: c.66.1.17 Back     alignment and structure
>1mjf_A Spermidine synthase; spermidine synthetase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus furiosus} SCOP: c.66.1.17 PDB: 2e5w_A* 2zsu_A* Back     alignment and structure
>2qm3_A Predicted methyltransferase; putative methyltransferase, structural genomics, pyrococcus PSI-2, protein structure initiative; HET: MSE; 2.05A {Pyrococcus furiosus dsm 3638} Back     alignment and structure
>2yx1_A Hypothetical protein MJ0883; methyl transferase, tRNA modification enzyme, transferase; HET: SFG; 2.20A {Methanocaldococcus jannaschii} PDB: 2zzn_A* 3ay0_A* 2zzm_A* Back     alignment and structure
>1wg8_A Predicted S-adenosylmethionine-dependent methyltransferase; S-adenosyl-methyltransferase, MRAW; HET: SAM; 2.00A {Thermus thermophilus} SCOP: a.60.13.1 c.66.1.23 Back     alignment and structure
>2jjq_A Uncharacterized RNA methyltransferase pyrab10780; metal-binding, tRNA methyltransferase, S-adenosyl-L-methionine, iron, 4Fe-4S, iron-sulfur; HET: SAH; 1.8A {Pyrococcus abyssi} PDB: 2vs1_A* Back     alignment and structure
>1uir_A Polyamine aminopropyltransferase; spermidien synthase, spermine synthase, riken STR genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} SCOP: c.66.1.17 PDB: 3anx_A* Back     alignment and structure
>2o07_A Spermidine synthase; structural genomics, structural genomics consortium, SGC, transferase; HET: SPD MTA; 1.89A {Homo sapiens} SCOP: c.66.1.17 PDB: 2o06_A* 2o05_A* 2o0l_A* 3rw9_A* Back     alignment and structure
>3cbg_A O-methyltransferase; cyanobacterium; HET: SAH FER 4FE; 2.00A {Synechocystis SP} Back     alignment and structure
>3reo_A (ISO)eugenol O-methyltransferase; directed evolution, saturation mutagenesis, regioselectivity transferase; HET: SAH EUG; 1.90A {Clarkia breweri} PDB: 3tky_A* 1kyz_A* 1kyw_A* Back     alignment and structure
>3bt7_A TRNA (uracil-5-)-methyltransferase; methyluridine, methyltransferase, TRMA, RUMT; HET: 5MU; 2.43A {Escherichia coli} Back     alignment and structure
>2i62_A Nicotinamide N-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAH; 1.80A {Mus musculus} PDB: 2iip_A* 3rod_A* Back     alignment and structure
>1x19_A CRTF-related protein; methyltransferase, bacteriochllochlorophyll, BCHU, SAM, SAH, adenosylmethyonine, S-adenosylhomocysteine, ADO-Met; 2.27A {Chlorobium tepidum} PDB: 1x1a_A* 1x1b_A* 1x1c_A* 1x1d_A* Back     alignment and structure
>2pjd_A Ribosomal RNA small subunit methyltransferase C; gene duplication, RNA modification, SAM binding; 2.10A {Escherichia coli} Back     alignment and structure
>2b2c_A Spermidine synthase; beta-alpha, transferase; 2.50A {Caenorhabditis elegans} SCOP: c.66.1.17 Back     alignment and structure
>3p9c_A Caffeic acid O-methyltransferase; S-adenosylmethionine dependent O-methyltransferase; HET: SAH; 1.80A {Lolium perenne} PDB: 3p9i_A* 3p9k_A* Back     alignment and structure
>3bzb_A Uncharacterized protein; RED ALGA, protein structure initiat center for eukaryotic structural genomics, CESG, structural genomics; 2.79A {Cyanidioschyzon merolae} Back     alignment and structure
>3fzg_A 16S rRNA methylase; methyltransferase, plasmid, transferase; HET: SAM; 2.00A {Escherichia coli} Back     alignment and structure
>1qyr_A KSGA, high level kasugamycin resistance protein, S-adenosylMet; adenosine dimethyltransferase, rRNA modification, transferase, translation; 2.10A {Escherichia coli} SCOP: c.66.1.24 PDB: 4adv_V 3tpz_A Back     alignment and structure
>3lst_A CALO1 methyltransferase; calicheamicin, enediyne, SAH, STRU genomics, PSI-2, protein structure initiative; HET: SAH; 2.40A {Micromonospora echinospora} Back     alignment and structure
>1tw3_A COMT, carminomycin 4-O-methyltransferase; anthracycline, methylate, tailoring enzyme, polyketide, S-adenosyl-L-homocystein; HET: SAH ERT; 2.35A {Streptomyces peucetius} SCOP: a.4.5.29 c.66.1.12 PDB: 1tw2_A* Back     alignment and structure
>2f8l_A Hypothetical protein LMO1582; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE SAM; 2.20A {Listeria monocytogenes} SCOP: c.66.1.45 Back     alignment and structure
>2a14_A Indolethylamine N-methyltransferase; SGC,INMT, structural genomics, structural genomics consortium; HET: SAH; 1.70A {Homo sapiens} SCOP: c.66.1.15 Back     alignment and structure
>2ip2_A Probable phenazine-specific methyltransferase; pyocyanin, phenazine-1-carboxy PHZM; 1.80A {Pseudomonas aeruginosa} Back     alignment and structure
>1zg3_A Isoflavanone 4'-O-methyltransferase; rossman fold, plant Pro transferase; HET: 2HI SAH; 2.35A {Medicago truncatula} PDB: 1zga_A* 1zhf_A* 1zgj_A* Back     alignment and structure
>2k4m_A TR8_protein, UPF0146 protein MTH_1000; alpha+beta, rossman fold, structural genomics, PSI-2; NMR {Methanothermobacterthermautotrophicus str} Back     alignment and structure
>2dul_A N(2),N(2)-dimethylguanosine tRNA methyltransferas; tRNA modification enzyme, guanine 26, N(2),N(2)-dimethyltran structural genomics; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.58 PDB: 2ejt_A* 2eju_A* 2ytz_A* Back     alignment and structure
>3gwz_A MMCR; methyltransferase, mitomycin, S-adenosyl methionine, transferase; HET: MSE SAH; 1.91A {Streptomyces lavendulae} PDB: 3gxo_A* Back     alignment and structure
>3ftd_A Dimethyladenosine transferase; KSGA, rossmann-like fold, RNA methyltransferase, mtase, anti resistance, methyltransferase, RNA-binding; 1.44A {Aquifex aeolicus} PDB: 3ftc_A 3fte_A 3ftf_A* 3r9x_B* Back     alignment and structure
>3i53_A O-methyltransferase; CO-complex, rossmann-like fold; HET: SAH; 2.08A {Streptomyces carzinostaticus subsp} PDB: 3i58_A* 3i5u_A* 3i64_A* Back     alignment and structure
>3axs_A Probable N(2),N(2)-dimethylguanosine tRNA methylt TRM1; structural genomics, riken structural genomics/proteomics in RSGI; HET: SFG; 2.16A {Aquifex aeolicus} PDB: 3axt_A* Back     alignment and structure
>3uzu_A Ribosomal RNA small subunit methyltransferase A; ssgcid, seattle structural genomics center for infectio disease; 1.75A {Burkholderia pseudomallei} Back     alignment and structure
>3dp7_A SAM-dependent methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research; 2.33A {Bacteroides vulgatus} Back     alignment and structure
>2oyr_A UPF0341 protein YHIQ; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Shigella flexneri 2A} SCOP: c.66.1.55 PDB: 2pgx_A 2pkw_A Back     alignment and structure
>2g72_A Phenylethanolamine N-methyltransferase; HET: SAM F21; 2.00A {Homo sapiens} SCOP: c.66.1.15 PDB: 1yz3_A* 2an4_A* 2an5_A* 2g70_A* 2g71_A* 2an3_A* 2g8n_A* 2ony_A* 3hcb_A* 3hcc_A* 3hcd_A* 3hcf_A* 3kpj_A* 3kpu_A* 3kpv_A* 3kpw_A* 3kpy_A* 3kqm_A* 3kqo_A* 3kqp_A* ... Back     alignment and structure
>3ldu_A Putative methylase; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE GTP; 1.70A {Clostridium difficile} Back     alignment and structure
>2hwk_A Helicase NSP2; rossman fold, alpha/beta/alpha, multi-domain, hydrolase; 2.45A {Venezuelan equine encephalitis virus} Back     alignment and structure
>4e2x_A TCAB9; kijanose, tetronitrose, tetradeoxy sugar, sugar methylation, transferase; HET: SAH TYD; 1.40A {Micromonospora chalcea} PDB: 3ndi_A* 3ndj_A* 4e32_A* 4e33_A* 4e2y_A* 4e31_A* 4e2w_A* 4e2z_A* 4e30_A* Back     alignment and structure
>3k0b_A Predicted N6-adenine-specific DNA methylase; methylase,PF01170, putative RNA methylase, PSI,MCSG, structu genomics; 1.50A {Listeria monocytogenes str} Back     alignment and structure
>3tka_A Ribosomal RNA small subunit methyltransferase H; HET: SAM CTN PG4; 2.25A {Escherichia coli} Back     alignment and structure
>1vlm_A SAM-dependent methyltransferase; possible histamine methyltransferase, structural genomics, JCSG, protein struc initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>3ldg_A Putative uncharacterized protein SMU.472; YPSC, methyltransferase, transferase; HET: SAH; 1.96A {Streptococcus mutans} Back     alignment and structure
>2okc_A Type I restriction enzyme stysji M protein; NP_813429.1, N-6 DNA methylase, type I restriction enzyme ST protein; HET: SAM; 2.20A {Bacteroides thetaiotaomicron vpi-5482} SCOP: c.66.1.45 Back     alignment and structure
>2cmg_A Spermidine synthase; transferase, putrescine aminopropyltransferase, spermidine biosynthesis, polyamine biosynthesis, SPEE; 2.0A {Helicobacter pylori} PDB: 2cmh_A Back     alignment and structure
>3giw_A Protein of unknown function DUF574; rossmann-fold protein, structural genomics, joint center for structural genomics, JCSG; HET: MSE UNL; 1.45A {Streptomyces avermitilis} PDB: 3go4_A* Back     alignment and structure
>1af7_A Chemotaxis receptor methyltransferase CHER; chemotaxis receptor methylation; HET: SAH; 2.00A {Salmonella typhimurium} SCOP: a.58.1.1 c.66.1.8 PDB: 1bc5_A* Back     alignment and structure
>1u2z_A Histone-lysine N-methyltransferase, H3 lysine-79 specific; histone methyltransferase, nucleosome; HET: SAH; 2.20A {Saccharomyces cerevisiae} SCOP: c.66.1.31 Back     alignment and structure
>3frh_A 16S rRNA methylase; methyltransferase domain, helical N-terminal domain, methyltransferase, plasmid, transferase; HET: SAH; 1.20A {Escherichia coli} PDB: 3fri_A* 3b89_A* Back     alignment and structure
>2ar0_A M.ecoki, type I restriction enzyme ecoki M protein; structural genomics, protein structure initiative, nysgxrc; 2.80A {Escherichia coli} SCOP: c.66.1.45 PDB: 2y7c_B 2y7h_B* Back     alignment and structure
>4a6d_A Hydroxyindole O-methyltransferase; melatonin, circadian clock; HET: SAM; 2.40A {Homo sapiens} PDB: 4a6e_A* Back     alignment and structure
>3lcv_B Sisomicin-gentamicin resistance methylase SGM; antibiotic resistance, methyltransferase, transferase; HET: SAM; 2.00A {Micromonospora zionensis} PDB: 3lcu_A* Back     alignment and structure
>4gqb_A Protein arginine N-methyltransferase 5; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} PDB: 4g56_A* Back     alignment and structure
>3lkd_A Type I restriction-modification system methyltransferase subunit; Q5M500_STRT2, STU0711, NESG, SUR80, structural genomics, PSI-2; 2.25A {Streptococcus thermophilus} Back     alignment and structure
>3ua3_A Protein arginine N-methyltransferase 5; TIM-barrel, rossmann fold, beta-barrel, symmetric arginine dimethylase, SAM binding; HET: SAH; 3.00A {Caenorhabditis elegans} PDB: 3ua4_A Back     alignment and structure
>3g7u_A Cytosine-specific methyltransferase; DNA-binding, NAD-binding, structural GENO protein structure initiative, PSI; 1.75A {Escherichia coli O157} Back     alignment and structure
>1i4w_A Mitochondrial replication protein MTF1; mitochondrial transcription factor, transcription initiation; 2.60A {Saccharomyces cerevisiae} SCOP: c.66.1.24 Back     alignment and structure
>3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* Back     alignment and structure
>3s1s_A Restriction endonuclease bpusi; PD--(D/E)XK catalytic motif, gamma-N6M-adenosine methyltrans S-adenosyl-methionine binding, hydrolase; HET: SAH; 2.35A {Bacillus pumilus} Back     alignment and structure
>3cvo_A Methyltransferase-like protein of unknown functio; rossman fold, structural genomics, joint center for structur genomics, JCSG; HET: MSE PG4; 1.80A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>2qy6_A UPF0209 protein YFCK; structural genomics, unknown function, PSI-2, protein struct initiative; 2.00A {Escherichia coli} Back     alignment and structure
>1g55_A DNA cytosine methyltransferase DNMT2; human DNA methyltransferase homologue; HET: DNA SAH; 1.80A {Homo sapiens} SCOP: c.66.1.26 Back     alignment and structure
>3khk_A Type I restriction-modification system methylation subunit; structural genomics, PSI-2, protein structure initiative; 2.55A {Methanosarcina mazei} Back     alignment and structure
>3ufb_A Type I restriction-modification system methyltran subunit; methyltransferase activity, transferase; 1.80A {Vibrio vulnificus} Back     alignment and structure
>3o4f_A Spermidine synthase; aminopropyltransferase, polyamine synthase, rossmann fold, P biosynthesis, spermidine biosynthesis, transferase; 2.90A {Escherichia coli} Back     alignment and structure
>2zig_A TTHA0409, putative modification methylase; methyltransferase, S- adenosylmethionine, structural genomics, NPPSFA; 2.10A {Thermus thermophilus} PDB: 2zie_A* 2zif_A Back     alignment and structure
>2wk1_A NOVP; transferase, O-methyltransferase, novobiocin, TYLF superfamily; HET: SAH; 1.40A {Streptomyces caeruleus} Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
>2qrv_A DNA (cytosine-5)-methyltransferase 3A; DNA methyltransferase 3A (DNMT3A) and ITS regulatory factor; HET: DNA SAH; 2.89A {Homo sapiens} Back     alignment and structure
>4h0n_A DNMT2; SAH binding, transferase; HET: SAH; 2.71A {Spodoptera frugiperda} Back     alignment and structure
>2py6_A Methyltransferase FKBM; YP_546752.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; 2.15A {Methylobacillus flagellatus KT} SCOP: c.66.1.56 Back     alignment and structure
>4e4y_A Short chain dehydrogenase family protein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; 1.80A {Francisella tularensis subsp} Back     alignment and structure
>3ubt_Y Modification methylase HAEIII; protein-DNA complex, DNA cytosine-5 methyltransferase, DNA B S-adenosyl methionine binding; HET: ATP 2PE; 2.50A {Haemophilus aegyptius} PDB: 1dct_A* Back     alignment and structure
>2ld4_A Anamorsin; methyltransferase-like fold, alpha/beta fold, iron-sulfur PR biogenesis, apoptosis; NMR {Homo sapiens} PDB: 2yui_A Back     alignment and structure
>2c7p_A Modification methylase HHAI; DNA methyltransferase, methyltransferase, base flipping, restriction system, transferase; HET: 5CM A1P SAH EPE CIT; 1.7A {Haemophilus haemolyticus} SCOP: c.66.1.26 PDB: 10mh_A* 1m0e_A* 1mht_A* 1hmy_A* 1skm_A* 2c7o_A* 2c7q_A* 2hmy_B* 2hr1_A* 3eeo_A* 3mht_A* 4mht_A* 5mht_A* 6mht_A* 7mht_A* 8mht_A* 9mht_A* 2zcj_A* 2z6u_A* 2z6q_A* ... Back     alignment and structure
>3qv2_A 5-cytosine DNA methyltransferase; DNMT2, ehmeth; HET: SAH; 2.15A {Entamoeba histolytica} Back     alignment and structure
>3mag_A VP39; methylated adenine, methyltransferase, RNA CAP analog, poly (A) polymerase, mRNA processing, transcription; HET: SAH 3MA; 1.80A {Vaccinia virus} SCOP: c.66.1.25 PDB: 1bky_A* 1jsz_A* 1v39_A* 1p39_A* 1vp9_A* 2vp3_A* 1eam_A* 1jte_A* 1jtf_A* 4dcg_A* 3mct_A* 1b42_A* 1eqa_A* 1av6_A* 3er9_A* 2gaf_A 3er8_A 2ga9_A* 3erc_A* Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>3c6k_A Spermine synthase; spermidine aminopropyltransferase, SPMSY, structural genomics, structural genomics consortium, SGC, phosphoprotein; HET: SPD MTA; 1.95A {Homo sapiens} PDB: 3c6m_A* Back     alignment and structure
>3me5_A Cytosine-specific methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.75A {Shigella flexneri 2A} PDB: 3lx6_A Back     alignment and structure
>3vtz_A Glucose 1-dehydrogenase; rossmann fold, oxidoreductase, NAD binding; 2.30A {Thermoplasma volcanium} Back     alignment and structure
>1g60_A Adenine-specific methyltransferase MBOIIA; structural genomics, DNA methylation, S- adenosylmethionine, PSI, protein structure initiative; HET: SAM; 1.74A {Moraxella bovis} SCOP: c.66.1.11 Back     alignment and structure
>1vpt_A VP39; RNA CAP, poly(A) polymerase, methyltransferase; HET: SAM; 1.80A {Vaccinia virus} SCOP: c.66.1.25 PDB: 1vp3_A* Back     alignment and structure
>3b5i_A S-adenosyl-L-methionine:salicylic acid carboxyl methyltransferase-like protein; sabath family, indole-3-acetic acid, S-AD methionine; HET: SAH; 2.75A {Arabidopsis thaliana} Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2dph_A Formaldehyde dismutase; dismutation of aldehydes, oxidoreductase; HET: NAD; 2.27A {Pseudomonas putida} Back     alignment and structure
>3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} Back     alignment and structure
>1dhr_A Dihydropteridine reductase; oxidoreductase(acting on NADH or NADPH); HET: NAD; 2.30A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1dir_A* 1hdr_A* Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Back     alignment and structure
>3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* Back     alignment and structure
>4b79_A PA4098, probable short-chain dehydrogenase; oxidoreductase, infectious disease, structure-based inhibito; HET: NAD; 1.98A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>2efj_A 3,7-dimethylxanthine methyltransferase; SAM-dependant methyltransferase, SAH, theobromine; HET: SAH 37T; 2.00A {Coffea canephora} PDB: 2eg5_A* Back     alignment and structure
>2fwm_X 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; enterobactin, rossman fold, chorismate metabolism, short-CHA oxidoreductase, tetramer; 2.00A {Escherichia coli} Back     alignment and structure
>2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* Back     alignment and structure
>1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* Back     alignment and structure
>3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti} Back     alignment and structure
>3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} Back     alignment and structure
>2v6g_A Progesterone 5-beta-reductase; tyrosine-dependent oxidoreductase, oxidoreductase, SDR, cardenolides, cardiac glycosides; HET: NAP; 2.3A {Digitalis lanata} PDB: 2v6f_A* Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>2pk3_A GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, short-chain dehydrogenase/reductase, rossmann fold, oxidoreductase; HET: A2R GDD; 1.82A {Aneurinibacillus thermoaerophilus} Back     alignment and structure
>3d7l_A LIN1944 protein; APC89317, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; 2.06A {Listeria innocua} Back     alignment and structure
>1ooe_A Dihydropteridine reductase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; HET: MES; 1.65A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>1db3_A GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lyase; 2.30A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>2dtx_A Glucose 1-dehydrogenase related protein; rossmann fold, oxidoreductase; HET: BMA; 1.60A {Thermoplasma acidophilum} PDB: 2dtd_A* 2dte_A* 2zk7_A Back     alignment and structure
>3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} Back     alignment and structure
>1rpn_A GDP-mannose 4,6-dehydratase; short-chain dehydrogenase/reductase, rossmann fold, lyase; HET: NDP GDP; 2.15A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis} Back     alignment and structure
>3tos_A CALS11; methyltransferase, calicheamicin, structural genomic protein structure initiative, PSI, natPro; HET: MSE SAH GLU; 1.55A {Micromonospora echinospora} PDB: 4gf5_A* Back     alignment and structure
>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* Back     alignment and structure
>2hrz_A AGR_C_4963P, nucleoside-diphosphate-sugar epimerase; agrobacterium tumefa structural genomics, PSI-2, protein structure initiative; 1.85A {Agrobacterium tumefaciens} Back     alignment and structure
>1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 Back     alignment and structure
>2ag5_A DHRS6, dehydrogenase/reductase (SDR family) member 6; protein-CO-factor complex, structural genomics, structural G consortium, SGC, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Back     alignment and structure
>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* Back     alignment and structure
>1kol_A Formaldehyde dehydrogenase; oxidoreductase; HET: NAD; 1.65A {Pseudomonas putida} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1uay_A Type II 3-hydroxyacyl-COA dehydrogenase; beta oxidation, fatty acid, structural genomi structural genomics/proteomics initiative, RSGI; HET: ADN; 1.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 Back     alignment and structure
>2h7i_A Enoyl-[acyl-carrier-protein] reductase [NADH]; oxidoreductase, INHA, enoyl acyl carrier reductase, pyrrolid carboxamide; HET: NAD 566; 1.62A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1p44_A* 1p45_A* 2b35_A* 2b36_A* 2b37_A* 2aq8_A* 2h7l_A* 2h7m_A* 2h7n_A* 2h7p_A* 2nsd_A* 2pr2_A* 2x22_A* 2x23_A* 3fne_A* 3fnf_A* 3fng_A* 3fnh_A* 3oew_A* 2aqh_A* ... Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Back     alignment and structure
>3sc4_A Short chain dehydrogenase (A0QTM2 homolog); ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.50A {Mycobacterium thermoresistibile} Back     alignment and structure
>1f8f_A Benzyl alcohol dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.20A {Acinetobacter calcoaceticus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1m6e_X S-adenosyl-L-methionnine:salicylic acid carboxyl methyltransferase; rossmann fold, protein-small molecule complex; HET: SAH SAL; 3.00A {Clarkia breweri} SCOP: c.66.1.35 Back     alignment and structure
>2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>3fpc_A NADP-dependent alcohol dehydrogenase; oxydoreductase, bacterial alcohol dehydrogenase, domain exchange, chimera, metal-binding; 1.40A {Thermoanaerobacter brockii} PDB: 2nvb_A* 1ykf_A* 1bxz_A* 3ftn_A 3fsr_A 1y9a_A* 2oui_A* 3fpl_A* 1jqb_A 1kev_A* 1ped_A 2b83_A Back     alignment and structure
>3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus} Back     alignment and structure
>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} Back     alignment and structure
>3swr_A DNA (cytosine-5)-methyltransferase 1; epigenetics, DNA methyltransferase fold, maintenance methyla transferase; HET: DNA SFG MES; 2.49A {Homo sapiens} PDB: 3pta_A* 3pt6_A* 3pt9_A* 4da4_A* Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Back     alignment and structure
>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>2pd4_A Enoyl-[acyl-carrier-protein] reductase [NADH]; antibacterial target, type II fatty acid biosynthesis, enoyl-ACP-reductase, FABI; HET: NAD DCN; 2.30A {Helicobacter pylori} SCOP: c.2.1.2 PDB: 2pd3_A* Back     alignment and structure
>3ek2_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, oxidoreductase, structural genomics; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.2 Back     alignment and structure
>3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV} Back     alignment and structure
>1qsg_A Enoyl-[acyl-carrier-protein] reductase; enoyl reductase, oxidoreductase; HET: GLC NAD TCL; 1.75A {Escherichia coli} SCOP: c.2.1.2 PDB: 1c14_A* 1i2z_A* 1i30_A* 1lx6_A* 1lxc_A* 1mfp_A* 2fhs_A 1qg6_A* 1dfg_A* 1dfh_A* 1d8a_A* 1dfi_A* 3pje_A* 3pjd_A* 3pjf_A* Back     alignment and structure
>3kvo_A Hydroxysteroid dehydrogenase-like protein 2; HSDL2, human hydroxysteroid dehydrogenase like 2, SDHL2, STR genomics, structural genomics consortium; HET: NAP; 2.25A {Homo sapiens} Back     alignment and structure
>1i24_A Sulfolipid biosynthesis protein SQD1; SDR, short-chain dehydrogenase/reductase, rossmann fold, BIO protein; HET: NAD UPG; 1.20A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1i2c_A* 1i2b_A* 1qrr_A* Back     alignment and structure
>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Back     alignment and structure
>2p91_A Enoyl-[acyl-carrier-protein] reductase [NADH]; NADH-dependent enoyl-ACP reductase, FABI, aquifex A VF5, structural genomics, PSI; 2.00A {Aquifex aeolicus} Back     alignment and structure
>3uko_A Alcohol dehydrogenase class-3; alcohol dehydrogenase III, homodimer, reduction of GSNO, NAD binding, oxidoreductase; HET: NAD SO4; 1.40A {Arabidopsis thaliana} Back     alignment and structure
>3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>2nm0_A Probable 3-oxacyl-(acyl-carrier-protein) reductas; oxidoreductase; 1.99A {Streptomyces coelicolor} Back     alignment and structure
>1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 Back     alignment and structure
>4eez_A Alcohol dehydrogenase 1; site-saturation mutagenesis, directed evolution, isobutyraldehyde, biofuel, oxidoreductase; HET: PG4; 1.90A {Lactococcus lactis subsp} PDB: 4eex_A* Back     alignment and structure
>2rh8_A Anthocyanidin reductase; flavonoids, rossmann fold, short chain dehydrogenase/reductase, oxidoreductase; 2.22A {Vitis vinifera} PDB: 3hfs_A Back     alignment and structure
>3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} Back     alignment and structure
>3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} SCOP: c.2.1.0 Back     alignment and structure
>3gdg_A Probable NADP-dependent mannitol dehydrogenase; rossmann fold, beta-alpha-beta motifs, open twisted sheet, A NADP, oxidoreductase; 2.30A {Cladosporium herbarum} SCOP: c.2.1.0 PDB: 3gdf_A Back     alignment and structure
>1pqw_A Polyketide synthase; rossmann fold, dimer, structural genomics, PSI, protein STRU initiative; 2.66A {Mycobacterium tuberculosis} SCOP: c.2.1.1 Back     alignment and structure
>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} Back     alignment and structure
>3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* Back     alignment and structure
>4h15_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, nysgrc; HET: MSE; 1.45A {Sinorhizobium meliloti} PDB: 4h16_A* Back     alignment and structure
>2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* Back     alignment and structure
>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Back     alignment and structure
>3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* Back     alignment and structure
>1pl8_A Human sorbitol dehydrogenase; NAD, oxidoreductase; HET: NAD; 1.90A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 1pl7_A 1pl6_A* 3qe3_A Back     alignment and structure
>2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* Back     alignment and structure
>3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} Back     alignment and structure
>2oo3_A Protein involved in catabolism of external DNA; structural genomics, unknown function, PSI-2, protein structure initiative; 2.00A {Legionella pneumophila subsp} SCOP: c.66.1.59 Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 Back     alignment and structure
>3m6i_A L-arabinitol 4-dehydrogenase; medium chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 2.60A {Neurospora crassa} Back     alignment and structure
>1e3j_A NADP(H)-dependent ketose reductase; oxidoreductase, fructose reduction; 2.3A {Bemisia argentifolii} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3uog_A Alcohol dehydrogenase; structural genomics, protein structure initiative, PSI-biolo YORK structural genomics research consortium; 2.20A {Sinorhizobium meliloti 1021} Back     alignment and structure
>3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} Back     alignment and structure
>3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} Back     alignment and structure
>1n7h_A GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, short-chain dehydrogenase/reductase, LYA; HET: NDP GDP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1n7g_A* Back     alignment and structure
>1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2 Back     alignment and structure
>1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2 Back     alignment and structure
>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} Back     alignment and structure
>2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A* Back     alignment and structure
>1t2a_A GDP-mannose 4,6 dehydratase; structural genomics consortium, rossman-fold, short-chain dehydrogenase/reductase, SDR, structural genomics,lyase; HET: NDP GDP; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3jv7_A ADH-A; dehydrogenase, nucleotide binding, rossmann-fold, oxidoreduc; HET: NAD; 2.00A {Rhodococcus ruber} PDB: 2xaa_A* Back     alignment and structure
>3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>1jtv_A 17 beta-hydroxysteroid dehydrogenase type 1; steroid hormones, alternative binding mode, oxidoreductase; HET: TES; 1.54A {Homo sapiens} SCOP: c.2.1.2 PDB: 1dht_A* 1equ_A* 1bhs_A* 1i5r_A* 1qyv_A* 1qyw_A* 1qyx_A* 3dey_X* 3dhe_A* 3hb4_X* 3hb5_X* 3klp_X* 3km0_A* 1iol_A* 1fds_A* 1fdt_A* 3klm_X* 1fdw_A* 1fdu_A* 1fdv_A* ... Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Back     alignment and structure
>1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1gy8_A UDP-galactose 4-epimerase; oxidoreductase; HET: NAD UDP; 2.0A {Trypanosoma brucei} SCOP: c.2.1.2 PDB: 2cnb_A* Back     alignment and structure
>2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus} Back     alignment and structure
>4imr_A 3-oxoacyl-(acyl-carrier-protein) reductase; oxidoreductase, nicotinamide adenine dinucleotide phosphate, structural genomics; HET: NAP; 1.96A {Agrobacterium fabrum} Back     alignment and structure
>3gk3_A Acetoacetyl-COA reductase; acetoacetyl-CO reductase, oxidoreductase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} SCOP: c.2.1.0 PDB: 3tn7_A* Back     alignment and structure
>3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} SCOP: c.2.1.0 Back     alignment and structure
>2c20_A UDP-glucose 4-epimerase; carbohydrate metabolism, galactose metabolism, isomerase, NAD, spine; HET: NAD; 2.7A {Bacillus anthracis} Back     alignment and structure
>3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* Back     alignment and structure
>3ip1_A Alcohol dehydrogenase, zinc-containing; structural genomics, metal-binding, oxidoreductase, PSI-2, protein structure initiative; 2.09A {Thermotoga maritima} Back     alignment and structure
>3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} Back     alignment and structure
>3gms_A Putative NADPH:quinone reductase; structural genomics, putative quinone oxidoreductase, unknown function, PSI-2; 1.76A {Bacillus thuringiensis} Back     alignment and structure
>3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} Back     alignment and structure
>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* Back     alignment and structure
>1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 Back     alignment and structure
>2wyu_A Enoyl-[acyl carrier protein] reductase; oxidoreductase, fatty acid biosynthesis, oxidation reduction; 1.50A {Thermus thermophilus} PDB: 1ulu_A 2wyv_A* 2wyw_A* 2yw9_A* Back     alignment and structure
>4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} Back     alignment and structure
>4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A Back     alignment and structure
>2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* Back     alignment and structure
>1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 179
d1ej0a_180 c.66.1.2 (A:) RNA methyltransferase FtsJ {Escheric 5e-27
d2p41a1257 c.66.1.25 (A:8-264) An RNA cap (nucleoside-2'-O-)- 6e-21
>d1ej0a_ c.66.1.2 (A:) RNA methyltransferase FtsJ {Escherichia coli [TaxId: 562]} Length = 180 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: RNA methyltransferase FtsJ
domain: RNA methyltransferase FtsJ
species: Escherichia coli [TaxId: 562]
 Score = 98.4 bits (244), Expect = 5e-27
 Identities = 41/130 (31%), Positives = 62/130 (47%), Gaps = 12/130 (9%)

Query: 20  GWRARSAFKLLQIDEEFNIFEGVKRVVDLCAAPGSWSQVLSRKLYLPAKLSPDSREGDLP 79
           G R+R+ FKL +I +   +F+    VVDL AAPG WSQ +              + G   
Sbjct: 1   GLRSRAWFKLDEIQQSDKLFKPGMTVVDLGAAPGGWSQYVVT------------QIGGKG 48

Query: 80  LIVAIDLQPMAPIEGVIQVQGDITNARTAEVVIRHFDGCKADLVVCDGAPDVTGLHDMDE 139
            I+A DL PM PI GV  +QGD  +    + ++      K  +V+ D AP+++G   +D 
Sbjct: 49  RIIACDLLPMDPIVGVDFLQGDFRDELVMKALLERVGDSKVQVVMSDMAPNMSGTPAVDI 108

Query: 140 FVQSQLILAV 149
                L+   
Sbjct: 109 PRAMYLVELA 118


>d2p41a1 c.66.1.25 (A:8-264) An RNA cap (nucleoside-2'-O-)-methyltransferase domain of RNA polymerase NS5 {Dengue virus 2 [TaxId: 11060]} Length = 257 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query179
d1ej0a_180 RNA methyltransferase FtsJ {Escherichia coli [TaxI 100.0
d2p41a1257 An RNA cap (nucleoside-2'-O-)-methyltransferase do 99.85
d1xxla_234 Hypothetical protein YcgJ {Bacillus subtilis [TaxI 99.18
d1vl5a_231 Hypothetical protein BH2331 {Bacillus halodurans [ 99.18
d1nkva_245 Hypothetical Protein YjhP {Escherichia coli [TaxId 99.09
d2o57a1282 Putative sarcosine dimethylglycine methyltransfera 99.08
d1g8aa_227 Fibrillarin homologue {Archaeon Pyrococcus horikos 99.07
d1sqga2284 Ribosomal RNA small subunit methyltransferase B, R 99.03
d1ixka_313 Hypothetical methyltransferase PH1374 {Archaeon Py 99.02
d1nt2a_209 Fibrillarin homologue {Archaeon Archaeoglobus fulg 98.97
d2b9ea1293 NOL1R {Human (Homo sapiens) [TaxId: 9606]} 98.97
d1dl5a1213 Protein-L-isoaspartyl O-methyltransferase {Thermot 98.97
d1p91a_268 rRNA methyltransferase RlmA {Escherichia coli [Tax 98.9
d1ve3a1226 Hypothetical protein PH0226 {Archaeon Pyrococcus h 98.89
d1i9ga_264 Probable methyltransferase Rv2118c {Mycobacterium 98.88
d1yb2a1250 Hypothetical protein Ta0852 {Thermoplasma acidophi 98.87
d2i6ga1198 Putative methyltransferase TehB {Salmonella typhim 98.87
d1g8sa_230 Fibrillarin homologue {Archaeon Methanococcus jann 98.86
d1ne2a_197 Hypothetical protein Ta1320 {Archaeon Thermoplasma 98.84
d2fk8a1 280 Methoxy mycolic acid synthase 4, Mma4 {Mycobacteri 98.84
d1l3ia_186 Precorrin-6Y methyltransferase (CbiT) {Archaeon Me 98.83
d2avna1246 Hypothetical methyltransferase TM1389 {Thermotoga 98.82
d1ri5a_252 mRNA cap (Guanine N-7) methyltransferase {Fungus ( 98.81
d2ex4a1222 Adrenal gland protein AD-003 (C9orf32) {Human (Hom 98.8
d1kpga_285 CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} 98.8
d1pjza_201 Thiopurine S-methyltransferase {Pseudomonas syring 98.8
d1wy7a1201 Hypothetical protein PH1948 {Archaeon Pyrococcus h 98.77
d1wxxa2318 Hypothetical protein TTHA1280, middle and C-termin 98.77
d1wzna1251 Hypothetical methyltransferase PH1305 {Archaeon Py 98.76
d1y8ca_246 Putative methyltransferase CAC2371 {Clostridium ac 98.76
d2as0a2324 Hypothetical protein PH1915, middle and C-terminal 98.73
d1i1na_224 Protein-L-isoaspartyl O-methyltransferase {Human ( 98.71
d1kpia_ 291 CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} 98.7
d2p7ia1225 Hypothetical protein ECA1738 {Erwinia carotovora [ 98.7
d1vlma_208 Possible histamine N-methyltransferase TM1293 {The 98.7
d1dusa_194 Hypothetical protein MJ0882 {Archaeon Methanococcu 98.69
d2b78a2317 Hypothetical protein SMu776, middle and C-terminal 98.68
d1xtpa_254 Hypothetical protein Lmaj004091aaa (LmjF30.0810) { 98.68
d2gh1a1 281 Methyltransferase BC2162 {Bacillus cereus [TaxId: 98.68
d1oria_ 316 Protein arginine N-methyltransferase 1, PRMT1 {Rat 98.66
d2b25a1324 Hypothetical protein FLJ20628 {Human (Homo sapiens 98.66
d1im8a_225 Hypothetical protein HI0319 (YecO) {Haemophilus in 98.65
d1g6q1_ 328 Arginine methyltransferase, HMT1 {Baker's yeast (S 98.64
d1m6ya2192 TM0872, methyltransferase domain {Thermotoga marit 98.64
d1vbfa_224 Protein-L-isoaspartyl O-methyltransferase {Sulfolo 98.63
d2nxca1254 PrmA-like protein TTHA0656 (TT0836) {Thermus therm 98.63
d2bzga1229 Thiopurine S-methyltransferase {Human (Homo sapien 98.62
d2b3ta1274 N5-glutamine methyltransferase, HemK {Escherichia 98.61
d1o54a_266 Hypothetical protein TM0748 {Thermotoga maritima [ 98.6
d2fyta1 311 Protein arginine N-methyltransferase 3, PRMT3 {Hum 98.58
d2fcaa1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacil 98.57
d2frna1260 Hypothetical protein PH0793 {Pyrococcus horikoshii 98.56
d1nw3a_328 Catalytic, N-terminal domain of histone methyltran 98.52
d1zx0a1229 Guanidinoacetate methyltransferase {Human (Homo sa 98.51
d1tw3a2253 Carminomycin 4-O-methyltransferase {Streptomyces p 98.5
d2esra1152 Putative methyltransferase SPy1538 {Streptococcus 98.48
d1jg1a_215 Protein-L-isoaspartyl O-methyltransferase {Archaeo 98.44
d1yzha1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Strep 98.4
d1r18a_223 Protein-L-isoaspartyl O-methyltransferase {Fruit f 98.37
d1wg8a2182 TM0872, methyltransferase domain {Thermus thermoph 98.36
d2igta1309 Putative methyltransferase Atu0340 {Agrobacterium 98.31
d1jqea_280 Histamine methyltransferase {Human (Homo sapiens) 98.3
d1xvaa_ 292 Glycine N-methyltransferase {Rat (Rattus norvegicu 98.3
d1yuba_245 rRNA adenine dimethylase {Streptococcus pneumoniae 98.27
d1qama_235 rRNA adenine dimethylase {Bacillus subtilis, Ermc' 98.23
d1ws6a1171 Methyltransferase TTHA0928 {Thermus thermophilus [ 98.23
d2ih2a1223 DNA methylase TaqI, N-terminal domain {Thermus aqu 98.16
d2fpoa1183 Methylase YhhF {Escherichia coli [TaxId: 562]} 98.12
d1qzza2256 Aclacinomycin-10-hydroxylase RdmB {Streptomyces pu 98.07
d2fhpa1182 Putative methylase EF2452 {Enterococcus faecalis [ 98.03
d1u2za_406 Catalytic, N-terminal domain of histone methyltran 98.01
d2cl5a1214 Catechol O-methyltransferase, COMT {Rat (Rattus no 97.83
d1uwva2358 rRNA (Uracil-5-)-methyltransferase RumA, catalytic 97.79
d2avda1219 COMT domain-containing protein 1, COMTD1 {Human (H 97.78
d2h00a1250 Methyltransferase 10 domain containing protein MET 97.64
d1fp1d2244 Chalcone O-methyltransferase {Alfalfa (Medicago sa 97.64
d2a14a1257 Indolethylamine N-methyltransferase, INMT {Human ( 97.59
d1kyza2243 Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltra 97.58
d2f8la1328 Hypothetical protein Lmo1582 {Listeria monocytogen 97.46
d1qyra_ 252 High level kasugamycin resistance protein KsgA {Es 97.44
d2bm8a1232 Cephalosporin hydroxylase CmcI {Streptomyces clavu 97.43
d1nv8a_271 N5-glutamine methyltransferase, HemK {Thermotoga m 97.35
d1zq9a1 278 Probable dimethyladenosine transferase {Human (Hom 97.32
d2g72a1263 Phenylethanolamine N-methyltransferase, PNMTase {H 97.28
d2ifta1183 Putative methylase HI0767 {Haemophilus influenzae 97.25
d1fp2a2244 Isoflavone O-methyltransferase {Alfalfa (Medicago 97.17
d1susa1227 Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicag 97.06
d1i4wa_ 322 Transcription factor sc-mtTFB {Baker's yeast (Sacc 96.77
d1iy9a_274 Spermidine synthase {Bacillus subtilis [TaxId: 142 96.59
d2b2ca1312 Spermidine synthase {Caenorhabditis elegans [TaxId 96.43
d1jsxa_207 Glucose-inhibited division protein B (GidB) {Esche 96.27
d2okca1 425 Type I restriction enzyme StySJI M protein {Bacter 96.12
d1uira_312 Spermidine synthase {Thermus thermophilus [TaxId: 96.1
d1mjfa_276 Putative spermidine synthetase PF0127 (SpeE) {Arch 96.02
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 95.8
d1xj5a_290 Spermidine synthase {Thale cress (Arabidopsis thal 95.68
d2o07a1285 Spermidine synthase {Human (Homo sapiens) [TaxId: 95.65
d1inla_295 Spermidine synthase {Thermotoga maritima [TaxId: 2 95.28
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 94.61
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 94.5
d1g55a_ 343 DNMT2 {Human (Homo sapiens) [TaxId: 9606]} 94.47
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 94.42
d2oyra1250 Hypothetical protein YhiQ {Shigella flexneri [TaxI 94.27
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 94.15
d1dcta_ 324 DNA methylase HaeIII {Haemophilus aegyptius [TaxId 93.68
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 93.44
d1xdza_239 Glucose-inhibited division protein B (GidB) {Bacil 93.34
d2ar0a1 524 M.EcoKI {Escherichia coli [TaxId: 562]} 93.33
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 92.82
d1pr9a_ 244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 92.81
d2dula1 375 N(2),N(2)-dimethylguanosine tRNA methyltransferase 92.46
d1cyda_ 242 Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 92.33
d1i24a_ 393 Sulfolipid biosynthesis protein SQD1 {Thale cress 92.19
d2c7pa1 327 DNA methylase HhaI {Haemophilus haemolyticus [TaxI 92.06
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 91.31
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 91.15
d1gy8a_ 383 Uridine diphosphogalactose-4-epimerase (UDP-galact 91.0
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 91.0
d1rkxa_ 356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 90.92
d2blla1 342 Polymyxin resistance protein ArnA (PrmI) {Escheric 90.67
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 89.7
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 89.3
d1kewa_ 361 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 89.28
d1af7a2193 Chemotaxis receptor methyltransferase CheR, C-term 88.99
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 88.75
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 88.7
d1udca_ 338 Uridine diphosphogalactose-4-epimerase (UDP-galact 88.44
d1qora2179 Quinone oxidoreductase {Escherichia coli [TaxId: 5 87.82
d1db3a_ 357 GDP-mannose 4,6-dehydratase {Escherichia coli [Tax 87.63
d1ydea1 250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 87.19
d1uzma1 237 beta-keto acyl carrier protein reductase {Mycobact 86.51
d1orra_ 338 CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 86.39
d1yb1a_244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 85.94
d1xg5a_ 257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 85.15
d2fy8a1129 Potassium channel-related protein MthK {Archaeon M 84.75
d2ew8a1 247 (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb 84.71
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 84.68
d1zk4a1 251 R-specific alcohol dehydrogenase {Lactobacillus br 84.63
d2py6a1395 Methyltransferase FkbM {Methylobacillus flagellatu 84.52
d1ulsa_ 242 beta-keto acyl carrier protein reductase {Thermus 84.19
d1ae1a_ 258 Tropinone reductase {Jimsonweed (Datura stramonium 83.84
d1hdca_ 254 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre 83.02
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 82.98
d2bgka1 268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 82.94
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 81.5
d1id1a_153 Rck domain from putative potassium channel Kch {Es 81.36
d1nffa_ 244 Putative oxidoreductase Rv2002 {Mycobacterium tube 81.27
d2c5aa1 363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 81.06
d2gdza1 254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 80.64
>d1ej0a_ c.66.1.2 (A:) RNA methyltransferase FtsJ {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: RNA methyltransferase FtsJ
domain: RNA methyltransferase FtsJ
species: Escherichia coli [TaxId: 562]
Probab=100.00  E-value=1e-36  Score=239.97  Aligned_cols=142  Identities=31%  Similarity=0.397  Sum_probs=132.3

Q ss_pred             CCcchhhhcHHhHHHHhCCCCCCCEEEEEccCCChHHHHHHHHhCCCCCCCCCCCCCCCCeEEEEeCCCCCCCCCeeEEe
Q 030299           20 GWRARSAFKLLQIDEEFNIFEGVKRVVDLCAAPGSWSQVLSRKLYLPAKLSPDSREGDLPLIVAIDLQPMAPIEGVIQVQ   99 (179)
Q Consensus        20 ~~~sRaa~KL~eid~~~~ll~~g~~VlDLgagpGg~s~~l~~~~~~~~~~~~~~~~~~~~~VvavD~~~~~~~~~v~~i~   99 (179)
                      ||||||||||.||+++|++++++.+||||||+||||+|++.++.+.            .+.|+|+|+.||++++|+.+++
T Consensus         1 GyrsRaafKL~EI~~k~~l~k~~~~vlDLg~aPGgw~q~~~~~~~~------------~~~v~~vDl~~~~~i~~~~~~~   68 (180)
T d1ej0a_           1 GLRSRAWFKLDEIQQSDKLFKPGMTVVDLGAAPGGWSQYVVTQIGG------------KGRIIACDLLPMDPIVGVDFLQ   68 (180)
T ss_dssp             CCSCHHHHHHHHHHHHHCCCCTTCEEEEESCTTCHHHHHHHHHHCT------------TCEEEEEESSCCCCCTTEEEEE
T ss_pred             CchhHHHHHHHHHHHHhCccCCCCeEEEEeccCCcceEEEEeeccc------------cceEEEeecccccccCCceEee
Confidence            8999999999999999999999999999999999999999999874            6899999999999999999999


Q ss_pred             ccccchhhHHHHHhhcCCCCccEEeeCCCCCCCCCCcccHHHHHHHHHHHHHHHH------------------HHHHHHH
Q 030299          100 GDITNARTAEVVIRHFDGCKADLVVCDGAPDVTGLHDMDEFVQSQLILAVSIQFF------------------IYELVFC  161 (179)
Q Consensus       100 gDi~~~~~~~~l~~~~~~~~~D~VlsD~~~~~~g~~~~d~~~q~~L~~~AL~~~~------------------~~~~~~~  161 (179)
                      +|+++.++...+.......++|+|+|||+|+++|.++.||..+.+|++++|..++                  ...+++.
T Consensus        69 ~d~~~~~~~~~~~~~~~~~~~DlVlSD~ap~~sg~~~~d~~~~~~L~~~~l~~a~~~Lk~gG~fV~K~F~g~~~~~l~~~  148 (180)
T d1ej0a_          69 GDFRDELVMKALLERVGDSKVQVVMSDMAPNMSGTPAVDIPRAMYLVELALEMCRDVLAPGGSFVVKVFQGEGFDEYLRE  148 (180)
T ss_dssp             SCTTSHHHHHHHHHHHTTCCEEEEEECCCCCCCSCHHHHHHHHHHHHHHHHHHHHHHEEEEEEEEEEEESSTTHHHHHHH
T ss_pred             cccccchhhhhhhhhccCcceeEEEecccchhcccchhHHHHHHHHHHHHHHhhhhccCCCCcEEEEEecCccHHHHHHH
Confidence            9999998888887777778999999999999999999999999999999998763                  2678999


Q ss_pred             HHHhhceEEEee
Q 030299          162 LRQLLQYVILDG  173 (179)
Q Consensus       162 ~~~~f~~v~~~~  173 (179)
                      |+++|++|.+.+
T Consensus       149 l~~~F~~V~~~K  160 (180)
T d1ej0a_         149 IRSLFTKVKVRK  160 (180)
T ss_dssp             HHHHEEEEEEEC
T ss_pred             HHhhcCEEEEEC
Confidence            999999999764



>d2p41a1 c.66.1.25 (A:8-264) An RNA cap (nucleoside-2'-O-)-methyltransferase domain of RNA polymerase NS5 {Dengue virus 2 [TaxId: 11060]} Back     information, alignment and structure
>d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]} Back     information, alignment and structure
>d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1sqga2 c.66.1.38 (A:145-428) Ribosomal RNA small subunit methyltransferase B, RsmB (Sun, Fmu/Fmv), C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ixka_ c.66.1.38 (A:) Hypothetical methyltransferase PH1374 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2b9ea1 c.66.1.38 (A:133-425) NOL1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1ne2a_ c.66.1.32 (A:) Hypothetical protein Ta1320 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2fk8a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} Back     information, alignment and structure
>d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kpga_ c.66.1.18 (A:) CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d1wy7a1 c.66.1.32 (A:4-204) Hypothetical protein PH1948 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1wxxa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d2as0a2 c.66.1.51 (A:73-396) Hypothetical protein PH1915, middle and C-terminal domains {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kpia_ c.66.1.18 (A:) CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]} Back     information, alignment and structure
>d1vlma_ c.66.1.41 (A:) Possible histamine N-methyltransferase TM1293 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2b78a2 c.66.1.51 (A:69-385) Hypothetical protein SMu776, middle and C-terminal domains {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1m6ya2 c.66.1.23 (A:2-114,A:216-294) TM0872, methyltransferase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b3ta1 c.66.1.30 (A:2-275) N5-glutamine methyltransferase, HemK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fcaa1 c.66.1.53 (A:10-213) tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2frna1 c.66.1.47 (A:19-278) Hypothetical protein PH0793 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tw3a2 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} Back     information, alignment and structure
>d2esra1 c.66.1.46 (A:28-179) Putative methyltransferase SPy1538 {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1jg1a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1yzha1 c.66.1.53 (A:8-211) tRNA (guanine-N(7)-)-methyltransferase TrmB {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1r18a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1wg8a2 c.66.1.23 (A:5-108,A:207-284) TM0872, methyltransferase domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2igta1 c.66.1.51 (A:1-309) Putative methyltransferase Atu0340 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1yuba_ c.66.1.24 (A:) rRNA adenine dimethylase {Streptococcus pneumoniae, Ermam [TaxId: 1313]} Back     information, alignment and structure
>d1qama_ c.66.1.24 (A:) rRNA adenine dimethylase {Bacillus subtilis, Ermc' [TaxId: 1423]} Back     information, alignment and structure
>d1ws6a1 c.66.1.46 (A:15-185) Methyltransferase TTHA0928 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2ih2a1 c.66.1.27 (A:21-243) DNA methylase TaqI, N-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2fpoa1 c.66.1.46 (A:10-192) Methylase YhhF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qzza2 c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d2fhpa1 c.66.1.46 (A:1-182) Putative methylase EF2452 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cl5a1 c.66.1.1 (A:3-216) Catechol O-methyltransferase, COMT {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1uwva2 c.66.1.40 (A:75-432) rRNA (Uracil-5-)-methyltransferase RumA, catalytic domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2avda1 c.66.1.1 (A:44-262) COMT domain-containing protein 1, COMTD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h00a1 c.66.1.54 (A:5-254) Methyltransferase 10 domain containing protein METT10D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fp1d2 c.66.1.12 (D:129-372) Chalcone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d2a14a1 c.66.1.15 (A:5-261) Indolethylamine N-methyltransferase, INMT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kyza2 c.66.1.12 (A:120-362) Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d2f8la1 c.66.1.45 (A:2-329) Hypothetical protein Lmo1582 {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1qyra_ c.66.1.24 (A:) High level kasugamycin resistance protein KsgA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bm8a1 c.66.1.50 (A:2-233) Cephalosporin hydroxylase CmcI {Streptomyces clavuligerus [TaxId: 1901]} Back     information, alignment and structure
>d1nv8a_ c.66.1.30 (A:) N5-glutamine methyltransferase, HemK {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1zq9a1 c.66.1.24 (A:36-313) Probable dimethyladenosine transferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g72a1 c.66.1.15 (A:18-280) Phenylethanolamine N-methyltransferase, PNMTase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifta1 c.66.1.46 (A:11-193) Putative methylase HI0767 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1fp2a2 c.66.1.12 (A:109-352) Isoflavone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1susa1 c.66.1.1 (A:21-247) Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1i4wa_ c.66.1.24 (A:) Transcription factor sc-mtTFB {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1iy9a_ c.66.1.17 (A:) Spermidine synthase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2b2ca1 c.66.1.17 (A:3-314) Spermidine synthase {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1jsxa_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2okca1 c.66.1.45 (A:9-433) Type I restriction enzyme StySJI M protein {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1uira_ c.66.1.17 (A:) Spermidine synthase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1mjfa_ c.66.1.17 (A:) Putative spermidine synthetase PF0127 (SpeE) {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1xj5a_ c.66.1.17 (A:) Spermidine synthase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2o07a1 c.66.1.17 (A:16-300) Spermidine synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1inla_ c.66.1.17 (A:) Spermidine synthase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1g55a_ c.66.1.26 (A:) DNMT2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2oyra1 c.66.1.55 (A:1-250) Hypothetical protein YhiQ {Shigella flexneri [TaxId: 623]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1dcta_ c.66.1.26 (A:) DNA methylase HaeIII {Haemophilus aegyptius [TaxId: 197575]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xdza_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2ar0a1 c.66.1.45 (A:6-529) M.EcoKI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dula1 c.66.1.58 (A:3-377) N(2),N(2)-dimethylguanosine tRNA methyltransferase Trm1 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2c7pa1 c.66.1.26 (A:1-327) DNA methylase HhaI {Haemophilus haemolyticus [TaxId: 726]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1gy8a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1af7a2 c.66.1.8 (A:92-284) Chemotaxis receptor methyltransferase CheR, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fy8a1 c.2.1.9 (A:116-244) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Back     information, alignment and structure
>d2py6a1 c.66.1.56 (A:14-408) Methyltransferase FkbM {Methylobacillus flagellatus [TaxId: 405]} Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure