Citrus Sinensis ID: 030342
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 179 | ||||||
| 225445565 | 185 | PREDICTED: axial regulator YABBY 5 [Viti | 0.675 | 0.654 | 0.759 | 2e-49 | |
| 224087122 | 188 | predicted protein [Populus trichocarpa] | 0.687 | 0.654 | 0.757 | 1e-47 | |
| 351724725 | 186 | uncharacterized protein LOC100499942 [Gl | 0.692 | 0.666 | 0.719 | 1e-46 | |
| 356548475 | 186 | PREDICTED: axial regulator YABBY 5-like | 0.692 | 0.666 | 0.712 | 5e-46 | |
| 255638088 | 186 | unknown [Glycine max] | 0.675 | 0.650 | 0.720 | 3e-45 | |
| 255572533 | 185 | Axial regulator YABBY5, putative [Ricinu | 0.687 | 0.664 | 0.721 | 1e-43 | |
| 357478135 | 191 | YABBY protein [Medicago truncatula] gi|3 | 0.681 | 0.638 | 0.692 | 2e-43 | |
| 217073506 | 191 | unknown [Medicago truncatula] gi|3884906 | 0.681 | 0.638 | 0.692 | 2e-43 | |
| 302399149 | 188 | YABBY domain class transcription factor | 0.681 | 0.648 | 0.695 | 2e-42 | |
| 449464626 | 193 | PREDICTED: axial regulator YABBY 5-like | 0.675 | 0.626 | 0.676 | 6e-40 |
| >gi|225445565|ref|XP_002285328.1| PREDICTED: axial regulator YABBY 5 [Vitis vinifera] gi|297738980|emb|CBI28225.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 200 bits (509), Expect = 2e-49, Method: Compositional matrix adjust.
Identities = 98/129 (75%), Positives = 107/129 (82%), Gaps = 8/129 (6%)
Query: 51 KAPSYASPECRIDLGSSSKCNNKISAMRTPTNKATEERVVNRRESPHSTTPEKRQRVPSA 110
+AP+Y SP+ RIDLGSSSKCN K+ AMR P + +EER+VNR PEKRQRVPSA
Sbjct: 65 QAPNYTSPDYRIDLGSSSKCNTKM-AMRAPASNISEERIVNR-------PPEKRQRVPSA 116
Query: 111 YNQFIKEEIQRIKANNPDISHREAFSTAAKNWAHFPHIHFGLMLEANNQPKLDDASGNRL 170
YNQFIKEEIQRIKANNPDISHREAFSTAAKNWAHFPHIHFGLMLE NNQPKLD+ S L
Sbjct: 117 YNQFIKEEIQRIKANNPDISHREAFSTAAKNWAHFPHIHFGLMLETNNQPKLDEGSEKHL 176
Query: 171 MSRTALRNK 179
MS+ ALRNK
Sbjct: 177 MSKAALRNK 185
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224087122|ref|XP_002308074.1| predicted protein [Populus trichocarpa] gi|222854050|gb|EEE91597.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|351724725|ref|NP_001238347.1| uncharacterized protein LOC100499942 [Glycine max] gi|255627893|gb|ACU14291.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356548475|ref|XP_003542627.1| PREDICTED: axial regulator YABBY 5-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|255638088|gb|ACU19358.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|255572533|ref|XP_002527201.1| Axial regulator YABBY5, putative [Ricinus communis] gi|223533466|gb|EEF35214.1| Axial regulator YABBY5, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|357478135|ref|XP_003609353.1| YABBY protein [Medicago truncatula] gi|355510408|gb|AES91550.1| YABBY protein [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|217073506|gb|ACJ85113.1| unknown [Medicago truncatula] gi|388490620|gb|AFK33376.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|302399149|gb|ADL36869.1| YABBY domain class transcription factor [Malus x domestica] | Back alignment and taxonomy information |
|---|
| >gi|449464626|ref|XP_004150030.1| PREDICTED: axial regulator YABBY 5-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 179 | ||||||
| TAIR|locus:2066311 | 164 | YAB5 "YABBY5" [Arabidopsis tha | 0.564 | 0.615 | 0.699 | 4.6e-34 | |
| TAIR|locus:2826731 | 184 | YAB2 "YABBY2" [Arabidopsis tha | 0.508 | 0.494 | 0.652 | 2.2e-25 | |
| TAIR|locus:2126931 | 240 | YAB3 "YABBY3" [Arabidopsis tha | 0.469 | 0.35 | 0.654 | 5.9e-25 | |
| TAIR|locus:2005492 | 229 | AFO "AT2G45190" [Arabidopsis t | 0.351 | 0.275 | 0.815 | 2.6e-24 | |
| UNIPROTKB|Q7XIM7 | 169 | YAB1 "Protein YABBY 1" [Oryza | 0.290 | 0.307 | 0.846 | 1e-20 | |
| TAIR|locus:2028020 | 231 | INO "INNER NO OUTER" [Arabidop | 0.357 | 0.277 | 0.625 | 5.3e-17 | |
| TAIR|locus:2026418 | 181 | CRC "AT1G69180" [Arabidopsis t | 0.251 | 0.248 | 0.711 | 3e-14 | |
| UNIPROTKB|Q76EJ0 | 194 | DL "Protein DROOPING LEAF" [Or | 0.240 | 0.221 | 0.767 | 7.9e-14 |
| TAIR|locus:2066311 YAB5 "YABBY5" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 370 (135.3 bits), Expect = 4.6e-34, P = 4.6e-34
Identities = 79/113 (69%), Positives = 88/113 (77%)
Query: 50 FKAPSYASPECRIDLGSSSKCNNKISAMRTPTNKATEERVVNRRESPHSTTPEKRQRVPS 109
F+A +YA PE GSSS+ + KI + R T TE+R+VNR P PEKRQRVPS
Sbjct: 63 FQATNYAVPE----YGSSSRSHTKIPS-RISTRTITEQRIVNR---P----PEKRQRVPS 110
Query: 110 AYNQFIKEEIQRIKANNPDISHREAFSTAAKNWAHFPHIHFGLMLEANNQPKL 162
AYNQFIKEEIQRIKANNPDISHREAFSTAAKNWAHFPHIHFGLMLE+N Q K+
Sbjct: 111 AYNQFIKEEIQRIKANNPDISHREAFSTAAKNWAHFPHIHFGLMLESNKQAKI 163
|
|
| TAIR|locus:2826731 YAB2 "YABBY2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2126931 YAB3 "YABBY3" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2005492 AFO "AT2G45190" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q7XIM7 YAB1 "Protein YABBY 1" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2028020 INO "INNER NO OUTER" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2026418 CRC "AT1G69180" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q76EJ0 DL "Protein DROOPING LEAF" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 179 | |||
| pfam04690 | 170 | pfam04690, YABBY, YABBY protein | 7e-38 | |
| cd01390 | 66 | cd01390, HMGB-UBF_HMG-box, HMGB-UBF_HMG-box, class | 0.003 | |
| cd00084 | 66 | cd00084, HMG-box, High Mobility Group (HMG)-box is | 0.004 |
| >gnl|CDD|113458 pfam04690, YABBY, YABBY protein | Back alignment and domain information |
|---|
Score = 127 bits (321), Expect = 7e-38
Identities = 51/60 (85%), Positives = 53/60 (88%)
Query: 93 RESPHSTTPEKRQRVPSAYNQFIKEEIQRIKANNPDISHREAFSTAAKNWAHFPHIHFGL 152
R P + PEKRQRVPSAYN+FIKEEIQRIKA NPDISHREAFS AAKNWAHFPHIHFGL
Sbjct: 111 RVPPVNRPPEKRQRVPSAYNRFIKEEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGL 170
|
YABBY proteins are a group of plant-specific transcription involved in the specification of abaxial polarity in lateral organs. Length = 170 |
| >gnl|CDD|238686 cd01390, HMGB-UBF_HMG-box, HMGB-UBF_HMG-box, class II and III members of the HMG-box superfamily of DNA-binding proteins | Back alignment and domain information |
|---|
| >gnl|CDD|238037 cd00084, HMG-box, High Mobility Group (HMG)-box is found in a variety of eukaryotic chromosomal proteins and transcription factors | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 179 | |||
| PF04690 | 170 | YABBY: YABBY protein; InterPro: IPR006780 YABBY pr | 100.0 | |
| PF09011 | 73 | HMG_box_2: HMG-box domain; InterPro: IPR015101 Thi | 98.53 | |
| cd01390 | 66 | HMGB-UBF_HMG-box HMGB-UBF_HMG-box, class II and II | 98.27 | |
| PF00505 | 69 | HMG_box: HMG (high mobility group) box; InterPro: | 98.18 | |
| cd00084 | 66 | HMG-box High Mobility Group (HMG)-box is found in | 98.18 | |
| smart00398 | 70 | HMG high mobility group. | 98.16 | |
| cd01388 | 72 | SOX-TCF_HMG-box SOX-TCF_HMG-box, class I member of | 98.15 | |
| cd01389 | 77 | MATA_HMG-box MATA_HMG-box, class I member of the H | 98.14 | |
| PTZ00199 | 94 | high mobility group protein; Provisional | 98.01 | |
| KOG0381 | 96 | consensus HMG box-containing protein [General func | 97.3 | |
| PF06244 | 122 | DUF1014: Protein of unknown function (DUF1014); In | 97.11 | |
| KOG3223 | 221 | consensus Uncharacterized conserved protein [Funct | 94.07 | |
| COG5648 | 211 | NHP6B Chromatin-associated proteins containing the | 80.33 |
| >PF04690 YABBY: YABBY protein; InterPro: IPR006780 YABBY proteins are a group of plant-specific transcription factors involved in the specification of abaxial polarity in lateral organs such as leaves and floral organs [, ] | Back alignment and domain information |
|---|
Probab=100.00 E-value=3.2e-49 Score=321.88 Aligned_cols=136 Identities=46% Similarity=0.636 Sum_probs=97.2
Q ss_pred HhhhccccceeeeeecCCcchhHHHHHHHHhCCCCchhh-hhh-c---CCCC--CCCCCcCCC---CCCCcccccccccc
Q 030342 9 VREYGSRFSVTVMARCSSSSGFLLQLLLLLLGITLFEEI-EAF-K---APSY--ASPECRIDL---GSSSKCNNKISAMR 78 (179)
Q Consensus 9 ~~~y~s~~~~tVtVRCG~Cs~lLsv~l~~ll~~~p~qD~-q~~-~---~~~~--~~~~~~~~~---~SsS~~~~~~~~~~ 78 (179)
|.-+.|++++|||||||||+|||||+|+.++..+|.|++ ++. . .++. ..+.+.... ++++.+.... .+.
T Consensus 24 VsVP~ssL~~~VTVRCGHCtNLLSVNm~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~ 102 (170)
T PF04690_consen 24 VSVPCSSLLKTVTVRCGHCTNLLSVNMRALLQPLPSQDHLQHSLLPPQSQELQFQPENFGSNSSSSSSSSSSSSSS-SMS 102 (170)
T ss_pred EecchhhhhhhhceeccCccceeeeeccccccCCCcccchhccccccccccccccccccccccccCCCcccccccc-ccC
Confidence 333556677799999999999999999999988888776 111 1 1111 111222111 1111111110 112
Q ss_pred CCCCCcccccc-ccccCCCCCCCCcccCCCchhhhHHHHHHHHHHHhhCCCCCHHHHHHHHHHhhccCCCccccc
Q 030342 79 TPTNKATEERV-VNRRESPHSTTPEKRQRVPSAYNQFIKEEIQRIKANNPDISHREAFSTAAKNWAHFPHIHFGL 152 (179)
Q Consensus 79 ~~~~~~~~~~~-~~r~~~a~~~p~eK~~R~PSAYN~FMKeEIqRIKa~nP~isHKEAFs~AAkNWa~~P~~~~gl 152 (179)
....++.++.. ++| |||||||+|||||+|||+||+|||++||||+|||||++|||||||+|||||||
T Consensus 103 ~~~~~~~pr~~~v~k-------PPEKRqR~psaYn~f~k~ei~rik~~~p~ishkeaFs~aAknW~h~phihfgl 170 (170)
T PF04690_consen 103 FSEEEEIPRAPPVNK-------PPEKRQRVPSAYNRFMKEEIQRIKAENPDISHKEAFSAAAKNWAHFPHIHFGL 170 (170)
T ss_pred ccccccccccccccC-------CccccCCCchhHHHHHHHHHHHHHhcCCCCCHHHHHHHHHHhhhhCcccccCC
Confidence 22344555544 467 99999999999999999999999999999999999999999999999999997
|
|
| >PF09011 HMG_box_2: HMG-box domain; InterPro: IPR015101 This domain is predominantly found in Maelstrom homologue proteins | Back alignment and domain information |
|---|
| >cd01390 HMGB-UBF_HMG-box HMGB-UBF_HMG-box, class II and III members of the HMG-box superfamily of DNA-binding proteins | Back alignment and domain information |
|---|
| >PF00505 HMG_box: HMG (high mobility group) box; InterPro: IPR000910 High mobility group (HMG or HMGB) proteins are a family of relatively low molecular weight non-histone components in chromatin | Back alignment and domain information |
|---|
| >cd00084 HMG-box High Mobility Group (HMG)-box is found in a variety of eukaryotic chromosomal proteins and transcription factors | Back alignment and domain information |
|---|
| >smart00398 HMG high mobility group | Back alignment and domain information |
|---|
| >cd01388 SOX-TCF_HMG-box SOX-TCF_HMG-box, class I member of the HMG-box superfamily of DNA-binding proteins | Back alignment and domain information |
|---|
| >cd01389 MATA_HMG-box MATA_HMG-box, class I member of the HMG-box superfamily of DNA-binding proteins | Back alignment and domain information |
|---|
| >PTZ00199 high mobility group protein; Provisional | Back alignment and domain information |
|---|
| >KOG0381 consensus HMG box-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF06244 DUF1014: Protein of unknown function (DUF1014); InterPro: IPR010422 This family consists of several hypothetical eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >KOG3223 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >COG5648 NHP6B Chromatin-associated proteins containing the HMG domain [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 179 | |||
| 3tq6_A | 214 | Transcription factor A, mitochondrial; transcripti | 2e-04 | |
| 3tmm_A | 238 | Transcription factor A, mitochondrial; HMG, high m | 3e-04 | |
| 2yrq_A | 173 | High mobility group protein B1; HMG box domain, DN | 6e-04 |
| >3tq6_A Transcription factor A, mitochondrial; transcription, transcription regulation, mitochondrion; HET: DNA BRU 1PE; 2.45A {Homo sapiens} Length = 214 | Back alignment and structure |
|---|
Score = 39.4 bits (91), Expect = 2e-04
Identities = 15/49 (30%), Positives = 22/49 (44%)
Query: 98 STTPEKRQRVPSAYNQFIKEEIQRIKANNPDISHREAFSTAAKNWAHFP 146
S ++ S+Y +F KE++ KA NPD E A+ W P
Sbjct: 4 SVLASCPKKPVSSYLRFSKEQLPIFKAQNPDAKTTELIRRIAQRWRELP 52
|
| >3tmm_A Transcription factor A, mitochondrial; HMG, high mobility group, transcription, LSP1, mitochon transcription-DNA complex; HET: DNA; 2.50A {Homo sapiens} Length = 238 | Back alignment and structure |
|---|
| >2yrq_A High mobility group protein B1; HMG box domain, DNA binding, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 173 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 179 | |||
| 1wz6_A | 82 | HMG-box transcription factor BBX; bobby SOX homolo | 98.58 | |
| 2crj_A | 92 | SWI/SNF-related matrix-associated actin- dependent | 98.43 | |
| 3nm9_A | 73 | HMG-D, high mobility group protein D; DNA bending, | 98.43 | |
| 2cs1_A | 92 | PMS1 protein homolog 1; DNA mismatch repair protei | 98.4 | |
| 1hme_A | 77 | High mobility group protein fragment-B; DNA-bindin | 98.33 | |
| 2e6o_A | 87 | HMG box-containing protein 1; HMG-box domain, HMG- | 98.28 | |
| 3f27_D | 83 | Transcription factor SOX-17; protein-DNA complex, | 98.27 | |
| 1wxl_A | 73 | Single-strand recognition protein; FACT, SSRP1, HM | 98.26 | |
| 1hry_A | 76 | Human SRY; DNA, DNA-binding protein, DNA binding p | 98.24 | |
| 2co9_A | 102 | Thymus high mobility group box protein TOX; TOX pr | 98.22 | |
| 1ckt_A | 71 | High mobility group 1 protein; high-mobility group | 98.21 | |
| 1j46_A | 85 | SRY, sex-determining region Y protein; MALE sex de | 98.2 | |
| 1i11_A | 81 | Transcription factor SOX-5; HMG BOX, DNA bending, | 98.19 | |
| 1wgf_A | 90 | Upstream binding factor 1; transcription factor, D | 98.18 | |
| 4a3n_A | 71 | Transcription factor SOX-17; 2.40A {Homo sapiens} | 98.13 | |
| 1gt0_D | 80 | Transcription factor SOX-2; POU factors, SOX prote | 98.12 | |
| 2eqz_A | 86 | High mobility group protein B3; HMG-box domain, mo | 98.12 | |
| 1k99_A | 99 | Upstream binding factor 1; alpha-helix, L-shape, D | 98.09 | |
| 4euw_A | 106 | Transcription factor SOX-9; protein-DNA complex, H | 98.06 | |
| 3u2b_C | 79 | Transcription factor SOX-4; HMG domain, transcript | 97.99 | |
| 2lef_A | 86 | LEF-1 HMG, protein (lymphoid enhancer-binding fact | 97.97 | |
| 2gzk_A | 159 | Sex-determining region on Y / HMGB1; protein-DNA c | 97.96 | |
| 1aab_A | 83 | High mobility group protein; HMG-BOX, DNA-binding; | 97.95 | |
| 2d7l_A | 81 | WD repeat and HMG-box DNA binding protein 1; high | 97.93 | |
| 2yrq_A | 173 | High mobility group protein B1; HMG box domain, DN | 97.93 | |
| 2lhj_A | 97 | High mobility group protein homolog NHP1; structur | 97.89 | |
| 1cg7_A | 93 | Protein (NON histone protein 6 A); HMG BOX, DNA be | 97.82 | |
| 3tq6_A | 214 | Transcription factor A, mitochondrial; transcripti | 97.8 | |
| 2yrq_A | 173 | High mobility group protein B1; HMG box domain, DN | 97.71 | |
| 3tmm_A | 238 | Transcription factor A, mitochondrial; HMG, high m | 97.57 | |
| 1l8y_A | 91 | Upstream binding factor 1; HUBF, HMG box 5, DNA bi | 97.56 | |
| 2gzk_A | 159 | Sex-determining region on Y / HMGB1; protein-DNA c | 97.44 | |
| 1v63_A | 101 | Nucleolar transcription factor 1; DNA binding, str | 97.42 | |
| 3fgh_A | 67 | Transcription factor A, mitochondrial; HMG domain, | 97.39 | |
| 2yuk_A | 90 | Myeloid/lymphoid or mixed-lineage leukemia protein | 96.95 | |
| 1v64_A | 108 | Nucleolar transcription factor 1; DNA binding, str | 96.65 | |
| 3tmm_A | 238 | Transcription factor A, mitochondrial; HMG, high m | 96.41 | |
| 3tq6_A | 214 | Transcription factor A, mitochondrial; transcripti | 96.31 | |
| 2cto_A | 93 | Novel protein; high mobility group box domain, hel | 96.12 |
| >1wz6_A HMG-box transcription factor BBX; bobby SOX homolog, HMG_BOX domain, structural genomics, NPPSFA, riken structural genomics/proteomics initiative; NMR {Mus musculus} | Back alignment and structure |
|---|
Probab=98.58 E-value=6.7e-08 Score=66.45 Aligned_cols=51 Identities=22% Similarity=0.311 Sum_probs=47.7
Q ss_pred CCCCCcccCCCchhhhHHHHHHHHHHHhhCCCCCHHHHHHHHHHhhccCCC
Q 030342 97 HSTTPEKRQRVPSAYNQFIKEEIQRIKANNPDISHREAFSTAAKNWAHFPH 147 (179)
Q Consensus 97 ~~~p~eK~~R~PSAYN~FMKeEIqRIKa~nP~isHKEAFs~AAkNWa~~P~ 147 (179)
|++++.+++|.+|||..|+++.-..|+++||++++.|.-+.++..|+..++
T Consensus 1 g~~~~~~pkrP~~af~lf~~~~r~~~~~~~p~~~~~eisk~lg~~Wk~ls~ 51 (82)
T 1wz6_A 1 GSSGSSGARRPMNAFLLFCKRHRSLVRQEHPRLDNRGATKILADWWAVLDP 51 (82)
T ss_dssp CCSSCCCSCCCCCHHHHHHHHHHHHHHHHCSSSCTTHHHHHHHHHHHTCCH
T ss_pred CCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHhhCCH
Confidence 577899999999999999999999999999999999999999999998653
|
| >2crj_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; structural DNA-binding protein BRAF35, DNA-bending; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3nm9_A HMG-D, high mobility group protein D; DNA bending, non-sequence-specific, HMG chromosomal protein; HET: DNA; 2.85A {Drosophila melanogaster} SCOP: a.21.1.1 PDB: 1e7j_A* 1hma_A 1qrv_A* | Back alignment and structure |
|---|
| >2cs1_A PMS1 protein homolog 1; DNA mismatch repair protein PMS1, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1hme_A High mobility group protein fragment-B; DNA-binding; NMR {Rattus norvegicus} SCOP: a.21.1.1 PDB: 1hmf_A 1nhm_A 1nhn_A 1hsm_A 1hsn_A 1j3c_A 1j3d_A 2yqi_A | Back alignment and structure |
|---|
| >2e6o_A HMG box-containing protein 1; HMG-box domain, HMG-box transcription factor 1, high mobility group box transcription factor 1, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3f27_D Transcription factor SOX-17; protein-DNA complex, HMG domain, endodermal, activator, DNA- nucleus, transcription regulation, transcrip complex; HET: DNA; 2.75A {Mus musculus} SCOP: a.21.1.1 PDB: 2yul_A | Back alignment and structure |
|---|
| >1wxl_A Single-strand recognition protein; FACT, SSRP1, HMG, DNA binding protein; NMR {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1hry_A Human SRY; DNA, DNA-binding protein, DNA binding protein/DNA complex; HET: DNA; NMR {Homo sapiens} SCOP: a.21.1.1 PDB: 1hrz_A* | Back alignment and structure |
|---|
| >2co9_A Thymus high mobility group box protein TOX; TOX protein, HMG box domain, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1ckt_A High mobility group 1 protein; high-mobility group domain, BENT DNA, protein-drug-DNA compl regulation-DNA complex; HET: DNA 5IU; 2.50A {Rattus norvegicus} SCOP: a.21.1.1 PDB: 1j3x_A | Back alignment and structure |
|---|
| >1j46_A SRY, sex-determining region Y protein; MALE sex determining factor, SRY, sex-reversal mutation; NMR {Homo sapiens} SCOP: a.21.1.1 PDB: 1j47_A | Back alignment and structure |
|---|
| >1i11_A Transcription factor SOX-5; HMG BOX, DNA bending, DNA recognition, chromatin, DNA binding protein, DNA sequence specific, testis determining.; NMR {Mus musculus} SCOP: a.21.1.1 | Back alignment and structure |
|---|
| >1wgf_A Upstream binding factor 1; transcription factor, DNA binding, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: a.21.1.1 | Back alignment and structure |
|---|
| >4a3n_A Transcription factor SOX-17; 2.40A {Homo sapiens} SCOP: a.21.1.0 | Back alignment and structure |
|---|
| >1gt0_D Transcription factor SOX-2; POU factors, SOX proteins; 2.6A {Mus musculus} SCOP: a.21.1.1 PDB: 2le4_A 1o4x_B | Back alignment and structure |
|---|
| >2eqz_A High mobility group protein B3; HMG-box domain, mobility group protein 2A, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1k99_A Upstream binding factor 1; alpha-helix, L-shape, DNA binding protein; NMR {Homo sapiens} SCOP: a.21.1.1 | Back alignment and structure |
|---|
| >4euw_A Transcription factor SOX-9; protein-DNA complex, HMG domain, activator, DNA-binding, NUC transcription; HET: DNA; 2.77A {Homo sapiens} | Back alignment and structure |
|---|
| >3u2b_C Transcription factor SOX-4; HMG domain, transcriptional regulation, transcription-DNA CO; HET: DNA; 2.40A {Mus musculus} SCOP: a.21.1.1 | Back alignment and structure |
|---|
| >2lef_A LEF-1 HMG, protein (lymphoid enhancer-binding factor); LEF1, HMG, TCR-A, transcription factor; HET: DNA; NMR {Mus musculus} SCOP: a.21.1.1 | Back alignment and structure |
|---|
| >2gzk_A Sex-determining region on Y / HMGB1; protein-DNA complex, HMG BOX, amphoterin, DNA/structural protein complex; NMR {Homo sapiens} SCOP: a.21.1.1 a.21.1.1 | Back alignment and structure |
|---|
| >1aab_A High mobility group protein; HMG-BOX, DNA-binding; NMR {Rattus norvegicus} SCOP: a.21.1.1 | Back alignment and structure |
|---|
| >2d7l_A WD repeat and HMG-box DNA binding protein 1; high mobility group box domain, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yrq_A High mobility group protein B1; HMG box domain, DNA binding, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lhj_A High mobility group protein homolog NHP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid; NMR {Babesia bovis} | Back alignment and structure |
|---|
| >1cg7_A Protein (NON histone protein 6 A); HMG BOX, DNA bending, DNA recognition, chromatin, DNA binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.21.1.1 PDB: 1j5n_A 1lwm_A | Back alignment and structure |
|---|
| >3tq6_A Transcription factor A, mitochondrial; transcription, transcription regulation, mitochondrion; HET: DNA BRU 1PE; 2.45A {Homo sapiens} | Back alignment and structure |
|---|
| >2yrq_A High mobility group protein B1; HMG box domain, DNA binding, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3tmm_A Transcription factor A, mitochondrial; HMG, high mobility group, transcription, LSP1, mitochon transcription-DNA complex; HET: DNA; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1l8y_A Upstream binding factor 1; HUBF, HMG box 5, DNA binding domain, DNA binding protein; NMR {Homo sapiens} SCOP: a.21.1.1 PDB: 1l8z_A 2hdz_A | Back alignment and structure |
|---|
| >2gzk_A Sex-determining region on Y / HMGB1; protein-DNA complex, HMG BOX, amphoterin, DNA/structural protein complex; NMR {Homo sapiens} SCOP: a.21.1.1 a.21.1.1 | Back alignment and structure |
|---|
| >1v63_A Nucleolar transcription factor 1; DNA binding, structural genomics, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: a.21.1.1 | Back alignment and structure |
|---|
| >3fgh_A Transcription factor A, mitochondrial; HMG domain, mitochondrial transcription, activator, DNA- binding, mitochondrion, phosphoprotein; 1.35A {Homo sapiens} | Back alignment and structure |
|---|
| >2yuk_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1v64_A Nucleolar transcription factor 1; DNA binding, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: a.21.1.1 | Back alignment and structure |
|---|
| >3tmm_A Transcription factor A, mitochondrial; HMG, high mobility group, transcription, LSP1, mitochon transcription-DNA complex; HET: DNA; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3tq6_A Transcription factor A, mitochondrial; transcription, transcription regulation, mitochondrion; HET: DNA BRU 1PE; 2.45A {Homo sapiens} | Back alignment and structure |
|---|
| >2cto_A Novel protein; high mobility group box domain, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 179 | ||||
| d1k99a_ | 91 | a.21.1.1 (A:) Nucleolar transcription factor 1 (Up | 0.002 |
| >d1k99a_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Human (Homo sapiens) [TaxId: 9606]} Length = 91 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: HMG-box superfamily: HMG-box family: HMG-box domain: Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) species: Human (Homo sapiens) [TaxId: 9606]
Score = 34.1 bits (78), Expect = 0.002
Identities = 8/46 (17%), Positives = 22/46 (47%)
Query: 101 PEKRQRVPSAYNQFIKEEIQRIKANNPDISHREAFSTAAKNWAHFP 146
P+ ++ + Y +F E+ + +P++S+ + +K + P
Sbjct: 8 PDFPKKPLTPYFRFFMEKRAKYAKLHPEMSNLDLTKILSKKYKELP 53
|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 179 | |||
| d1wgfa_ | 90 | Nucleolar transcription factor 1 (Upstream binding | 98.48 | |
| d1qrva_ | 73 | HMG-D {Drosophila melanogaster [TaxId: 7227]} | 98.4 | |
| d1hsma_ | 79 | High mobility group protein 1, HMG1 {Hamster (Cric | 98.35 | |
| d1k99a_ | 91 | Nucleolar transcription factor 1 (Upstream binding | 98.33 | |
| d1lwma_ | 93 | NHP6a {Baker's yeast (Saccharomyces cerevisiae) [T | 98.33 | |
| d1ckta_ | 71 | High mobility group protein 1, HMG1 {Rat (Rattus n | 98.24 | |
| d1gt0d_ | 80 | Sox-2 {Mouse (Mus musculus) [TaxId: 10090]} | 98.1 | |
| d1j46a_ | 85 | SRY {Human (Homo sapiens) [TaxId: 9606]} | 98.09 | |
| d1i11a_ | 70 | Sox-5 {Mouse (Mus musculus) [TaxId: 10090]} | 97.87 | |
| d2lefa_ | 86 | Lymphoid enhancer-binding factor, LEF1 {Mouse (Mus | 97.67 | |
| d1v63a_ | 101 | Nucleolar transcription factor 1 (Upstream binding | 97.51 | |
| d1v64a_ | 108 | Nucleolar transcription factor 1 (Upstream binding | 97.23 |
| >d1wgfa_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: HMG-box superfamily: HMG-box family: HMG-box domain: Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) species: Mouse (Mus musculus) [TaxId: 10090]
Probab=98.48 E-value=8.3e-08 Score=65.67 Aligned_cols=48 Identities=25% Similarity=0.401 Sum_probs=44.3
Q ss_pred CCcccCCCchhhhHHHHHHHHHHHhhCCCCCHHHHHHHHHHhhccCCC
Q 030342 100 TPEKRQRVPSAYNQFIKEEIQRIKANNPDISHREAFSTAAKNWAHFPH 147 (179)
Q Consensus 100 p~eK~~R~PSAYN~FMKeEIqRIKa~nP~isHKEAFs~AAkNWa~~P~ 147 (179)
.+.+++|.+|+|..||++.-++|+++||++++.|+.+.++..|+..++
T Consensus 17 ~~~~PKrP~say~lF~~e~r~~~~~~~p~~~~~ei~k~l~~~W~~Ls~ 64 (90)
T d1wgfa_ 17 GSEKPKRPVSAMFIFSEEKRRQLQEERPELSESELTRLLARMWNDLSE 64 (90)
T ss_dssp CCCCCCCCCCHHHHHHHHTHHHHHHHCTTSCHHHHHHHHHHHHHHSCH
T ss_pred CCCCCCCCCcHHHHHHHHHHHHHHHhCCCCCHHHHHHHHHHHHHhCCH
Confidence 567778899999999999999999999999999999999999998654
|
| >d1qrva_ a.21.1.1 (A:) HMG-D {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1hsma_ a.21.1.1 (A:) High mobility group protein 1, HMG1 {Hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1k99a_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lwma_ a.21.1.1 (A:) NHP6a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ckta_ a.21.1.1 (A:) High mobility group protein 1, HMG1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1gt0d_ a.21.1.1 (D:) Sox-2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1j46a_ a.21.1.1 (A:) SRY {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i11a_ a.21.1.1 (A:) Sox-5 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2lefa_ a.21.1.1 (A:) Lymphoid enhancer-binding factor, LEF1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1v63a_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1v64a_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|